From e564db2c26018a3647de4850ea0b0f979b740340 Mon Sep 17 00:00:00 2001 From: ModelHub XC Date: Wed, 20 May 2026 02:01:05 +0800 Subject: [PATCH] =?UTF-8?q?=E5=88=9D=E5=A7=8B=E5=8C=96=E9=A1=B9=E7=9B=AE?= =?UTF-8?q?=EF=BC=8C=E7=94=B1ModelHub=20XC=E7=A4=BE=E5=8C=BA=E6=8F=90?= =?UTF-8?q?=E4=BE=9B=E6=A8=A1=E5=9E=8B?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Model: facebook/galactica-30b Source: Original Platform --- .gitattributes | 34 + README.md | 176 + config.json | 31 + generation_config.json | 7 + pytorch_model-00001-of-00007.bin | 3 + pytorch_model-00002-of-00007.bin | 3 + pytorch_model-00003-of-00007.bin | 3 + pytorch_model-00004-of-00007.bin | 3 + pytorch_model-00005-of-00007.bin | 3 + pytorch_model-00006-of-00007.bin | 3 + pytorch_model-00007-of-00007.bin | 3 + pytorch_model.bin.index.json | 780 + special_tokens_map.json | 1 + tokenizer.json | 99996 +++++++++++++++++++++++++++++ tokenizer_config.json | 5 + 15 files changed, 101051 insertions(+) create mode 100644 .gitattributes create mode 100644 README.md create mode 100644 config.json create mode 100644 generation_config.json create mode 100644 pytorch_model-00001-of-00007.bin create mode 100644 pytorch_model-00002-of-00007.bin create mode 100644 pytorch_model-00003-of-00007.bin create mode 100644 pytorch_model-00004-of-00007.bin create mode 100644 pytorch_model-00005-of-00007.bin create mode 100644 pytorch_model-00006-of-00007.bin create mode 100644 pytorch_model-00007-of-00007.bin create mode 100644 pytorch_model.bin.index.json create mode 100644 special_tokens_map.json create mode 100644 tokenizer.json create mode 100644 tokenizer_config.json diff --git a/.gitattributes b/.gitattributes new file mode 100644 index 0000000..c7d9f33 --- /dev/null +++ b/.gitattributes @@ -0,0 +1,34 @@ +*.7z filter=lfs diff=lfs merge=lfs -text +*.arrow filter=lfs diff=lfs merge=lfs -text +*.bin filter=lfs diff=lfs merge=lfs -text +*.bz2 filter=lfs diff=lfs merge=lfs -text +*.ckpt filter=lfs diff=lfs merge=lfs -text +*.ftz filter=lfs diff=lfs merge=lfs -text +*.gz filter=lfs diff=lfs merge=lfs -text +*.h5 filter=lfs diff=lfs merge=lfs -text +*.joblib filter=lfs diff=lfs merge=lfs -text +*.lfs.* filter=lfs diff=lfs merge=lfs -text +*.mlmodel filter=lfs diff=lfs merge=lfs -text +*.model filter=lfs diff=lfs merge=lfs -text +*.msgpack filter=lfs diff=lfs merge=lfs -text +*.npy filter=lfs diff=lfs merge=lfs -text +*.npz filter=lfs diff=lfs merge=lfs -text +*.onnx filter=lfs diff=lfs merge=lfs -text +*.ot filter=lfs diff=lfs merge=lfs -text +*.parquet filter=lfs diff=lfs merge=lfs -text +*.pb filter=lfs diff=lfs merge=lfs -text +*.pickle filter=lfs diff=lfs merge=lfs -text +*.pkl filter=lfs diff=lfs merge=lfs -text +*.pt filter=lfs diff=lfs merge=lfs -text +*.pth filter=lfs diff=lfs merge=lfs -text +*.rar filter=lfs diff=lfs merge=lfs -text +*.safetensors filter=lfs diff=lfs merge=lfs -text +saved_model/**/* filter=lfs diff=lfs merge=lfs -text +*.tar.* filter=lfs diff=lfs merge=lfs -text +*.tflite filter=lfs diff=lfs merge=lfs -text +*.tgz filter=lfs diff=lfs merge=lfs -text +*.wasm filter=lfs diff=lfs merge=lfs -text +*.xz filter=lfs diff=lfs merge=lfs -text +*.zip filter=lfs diff=lfs merge=lfs -text +*.zst filter=lfs diff=lfs merge=lfs -text +*tfevents* filter=lfs diff=lfs merge=lfs -text diff --git a/README.md b/README.md new file mode 100644 index 0000000..31605aa --- /dev/null +++ b/README.md @@ -0,0 +1,176 @@ +--- +license: cc-by-nc-4.0 +tags: +- galactica + +widget: +- text: "The Transformer architecture [START_REF]" +- text: "The Schwarzschild radius is defined as: \\[" +- text: "A force of 0.6N is applied to an object, which accelerates at 3m/s. What is its mass? " +- text: "Lecture 1: The Ising Model\n\n" +- text: "[START_I_SMILES]" +- text: "[START_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END_AMINO] ## Keywords" +inference: false +--- + +![logo](https://s3.amazonaws.com/moonup/production/uploads/1668679814649-62441d1d9fdefb55a0b7d12c.png) + +# GALACTICA 30 B (large) + +Model card from the original [repo](https://github.com/paperswithcode/galai/blob/main/docs/model_card.md) + +Following [Mitchell et al. (2018)](https://arxiv.org/abs/1810.03993), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the [release paper](https://galactica.org/paper.pdf). + +## Model Details + +The GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models: + +| Size | Parameters | +|:-----------:|:-----------:| +| `mini` | 125 M | +| `base` | 1.3 B | +| `standard` | 6.7 B | +| `large` | 30 B | +| `huge` | 120 B | + + +## Release Date + +November 2022 + +## Model Type + +Transformer based architecture in a decoder-only setup with a few modifications (see paper for more details). + +## Paper & Demo + +[Paper](https://galactica.org/paper.pdf) / [Demo](https://galactica.org) + +## Model Use + +The primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate. + +The models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the README.md of this repository. + +## Training Data + +The GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the README.md for more information. See the paper for full information on the training data. + +## How to use + +Find below some example scripts on how to use the model in `transformers`: + +## Using the Pytorch model + +### Running the model on a CPU + +
+ Click to expand + +```python + +from transformers import AutoTokenizer, OPTForCausalLM + +tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-30b") +model = OPTForCausalLM.from_pretrained("facebook/galactica-30b") + +input_text = "The Transformer architecture [START_REF]" +input_ids = tokenizer(input_text, return_tensors="pt").input_ids + +outputs = model.generate(input_ids) +print(tokenizer.decode(outputs[0])) +``` + +
+ +### Running the model on a GPU + +
+ Click to expand + +```python +# pip install accelerate +from transformers import AutoTokenizer, OPTForCausalLM + +tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-30b") +model = OPTForCausalLM.from_pretrained("facebook/galactica-30b", device_map="auto") + +input_text = "The Transformer architecture [START_REF]" +input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda") + +outputs = model.generate(input_ids) +print(tokenizer.decode(outputs[0])) +``` + +
+ +### Running the model on a GPU using different precisions + +#### FP16 + +
+ Click to expand + +```python +# pip install accelerate +import torch +from transformers import AutoTokenizer, OPTForCausalLM + +tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-30b") +model = OPTForCausalLM.from_pretrained("facebook/galactica-30b", device_map="auto", torch_dtype=torch.float16) + +input_text = "The Transformer architecture [START_REF]" +input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda") + +outputs = model.generate(input_ids) +print(tokenizer.decode(outputs[0])) +``` + +
+ +#### INT8 + +
+ Click to expand + +```python +# pip install bitsandbytes accelerate +from transformers import AutoTokenizer, OPTForCausalLM + +tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-30b") +model = OPTForCausalLM.from_pretrained("facebook/galactica-30b", device_map="auto", load_in_8bit=True) + +input_text = "The Transformer architecture [START_REF]" +input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda") + +outputs = model.generate(input_ids) +print(tokenizer.decode(outputs[0])) +``` + +
+ + +## Performance and Limitations + +The model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section. + +As with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales. + +In addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations. + +## Broader Implications + +GALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA. + +We encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models. + + +## Citation + +```bibtex +@inproceedings{GALACTICA, + title={GALACTICA: A Large Language Model for Science}, + author={Ross Taylor and Marcin Kardas and Guillem Cucurull and Thomas Scialom and Anthony Hartshorn and Elvis Saravia and Andrew Poulton and Viktor Kerkez and Robert Stojnic}, + year={2022} +} +``` \ No newline at end of file diff --git a/config.json b/config.json new file mode 100644 index 0000000..6919ecc --- /dev/null +++ b/config.json @@ -0,0 +1,31 @@ +{ + "_remove_final_layer_norm": false, + "activation_dropout": 0.0, + "activation_function": "gelu", + "architectures": [ + "OPTForCausalLM" + ], + "attention_dropout": 0.1, + "enable_bias": true, + "bos_token_id": 0, + "do_layer_norm_before": true, + "dropout": 0.1, + "eos_token_id": 2, + "ffn_dim": 28672, + "hidden_size": 7168, + "init_std": 0.02, + "layer_norm_elementwise_affine": true, + "layerdrop": 0.0, + "learned_embeddings": true, + "max_position_embeddings": 2048, + "model_type": "opt", + "num_attention_heads": 56, + "num_hidden_layers": 48, + "pad_token_id": 1, + "scale_embeddings": false, + "torch_dtype": "float16", + "transformers_version": "4.21.0.dev0", + "use_cache": true, + "vocab_size": 50000, + "word_embed_proj_dim": 7168 +} diff --git a/generation_config.json b/generation_config.json new file mode 100644 index 0000000..9475ded --- /dev/null +++ b/generation_config.json @@ -0,0 +1,7 @@ +{ + "_from_model_config": true, + "bos_token_id": 0, + "eos_token_id": 2, + "pad_token_id": 1, + "transformers_version": "4.27.0.dev0" +} diff --git a/pytorch_model-00001-of-00007.bin b/pytorch_model-00001-of-00007.bin new file mode 100644 index 0000000..c79fde4 --- /dev/null +++ b/pytorch_model-00001-of-00007.bin @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:deb205287c0b95b6cd12508994ea5ecc4aa6291bc0abfc7b0ef1de434c7f1c24 +size 9790570949 diff --git a/pytorch_model-00002-of-00007.bin b/pytorch_model-00002-of-00007.bin new file mode 100644 index 0000000..0704f7a --- /dev/null +++ b/pytorch_model-00002-of-00007.bin @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:d7c44ec1aafe99448fd6f89d85c1e686a19f045a18399e4f4161191b14d756ef +size 9866538155 diff --git a/pytorch_model-00003-of-00007.bin b/pytorch_model-00003-of-00007.bin new file mode 100644 index 0000000..9c9a761 --- /dev/null +++ b/pytorch_model-00003-of-00007.bin @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:6553abdc4f32588be38944b889e710e924c51ae511b2ae3558835e57d2c506f7 +size 9866538219 diff --git a/pytorch_model-00004-of-00007.bin b/pytorch_model-00004-of-00007.bin new file mode 100644 index 0000000..f20ba42 --- /dev/null +++ b/pytorch_model-00004-of-00007.bin @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:8605d4b83a9b0d41a084c8328d78141de776dc56f750a77c9991295460a49fdc +size 9866538219 diff --git a/pytorch_model-00005-of-00007.bin b/pytorch_model-00005-of-00007.bin new file mode 100644 index 0000000..bc2d0c0 --- /dev/null +++ b/pytorch_model-00005-of-00007.bin @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:5465c9ddce18821e67e5fbabf3c8e7e6f746a1952ecbd175e6d5d4132e41e0e3 +size 9866538219 diff --git a/pytorch_model-00006-of-00007.bin b/pytorch_model-00006-of-00007.bin new file mode 100644 index 0000000..db68452 --- /dev/null +++ b/pytorch_model-00006-of-00007.bin @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:547868f116637febb71438f2fb5db63fe640d067cecc958c76aba7bf405d3b66 +size 9866538219 diff --git a/pytorch_model-00007-of-00007.bin b/pytorch_model-00007-of-00007.bin new file mode 100644 index 0000000..8442380 --- /dev/null +++ b/pytorch_model-00007-of-00007.bin @@ -0,0 +1,3 @@ +version https://git-lfs.github.com/spec/v1 +oid sha256:e77a69c7dbc7d17a3c4bc427d93a83f8a226c1f3c0c4a2a50fe5a74d5aa18f21 +size 1538986704 diff --git a/pytorch_model.bin.index.json b/pytorch_model.bin.index.json new file mode 100644 index 0000000..3176323 --- /dev/null +++ b/pytorch_model.bin.index.json @@ -0,0 +1,780 @@ +{ + "metadata": { + "total_size": 60661981184 + }, + "weight_map": { + "lm_head.weight": "pytorch_model-00007-of-00007.bin", + "model.decoder.embed_positions.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.embed_tokens.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.fc1.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.fc1.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.fc2.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.fc2.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.0.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.fc1.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.fc1.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.fc2.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.fc2.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.1.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.10.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.10.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.11.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.12.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.13.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.14.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.15.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.15.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.15.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.15.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.15.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.15.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.15.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.16.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.16.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.17.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.18.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.19.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.2.fc1.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.fc1.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.fc2.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.fc2.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.2.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.20.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.20.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.21.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.fc1.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.fc1.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.fc2.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.fc2.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.final_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.final_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.22.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.23.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.23.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.23.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.23.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.23.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.23.self_attn.k_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn.k_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn.out_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn.out_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn.q_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn.q_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn.v_proj.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn.v_proj.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn_layer_norm.bias": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.23.self_attn_layer_norm.weight": "pytorch_model-00003-of-00007.bin", + "model.decoder.layers.24.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.24.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.25.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.26.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.27.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.28.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.29.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.3.fc1.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.fc1.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.fc2.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.fc2.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.3.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.30.fc1.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.fc1.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.fc2.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.fc2.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.final_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.final_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.30.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.31.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.31.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.31.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.31.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.31.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.31.self_attn.k_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn.k_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn.out_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn.out_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn.q_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn.q_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn.v_proj.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn.v_proj.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn_layer_norm.bias": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.31.self_attn_layer_norm.weight": "pytorch_model-00004-of-00007.bin", + "model.decoder.layers.32.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.32.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.33.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.34.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.35.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.36.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.37.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.fc1.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.fc1.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.fc2.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.fc2.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.final_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.final_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.38.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.39.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.39.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.39.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.39.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.39.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.39.self_attn.k_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn.k_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn.out_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn.out_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn.q_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn.q_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn.v_proj.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn.v_proj.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn_layer_norm.bias": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.39.self_attn_layer_norm.weight": "pytorch_model-00005-of-00007.bin", + "model.decoder.layers.4.fc1.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.fc1.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.fc2.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.fc2.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.4.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.40.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.40.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.41.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.42.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.43.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.44.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.45.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.fc1.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.fc1.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.fc2.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.fc2.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.final_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.final_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.46.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.fc1.bias": "pytorch_model-00007-of-00007.bin", + "model.decoder.layers.47.fc1.weight": "pytorch_model-00007-of-00007.bin", + "model.decoder.layers.47.fc2.bias": "pytorch_model-00007-of-00007.bin", + "model.decoder.layers.47.fc2.weight": "pytorch_model-00007-of-00007.bin", + "model.decoder.layers.47.final_layer_norm.bias": "pytorch_model-00007-of-00007.bin", + "model.decoder.layers.47.final_layer_norm.weight": "pytorch_model-00007-of-00007.bin", + "model.decoder.layers.47.self_attn.k_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn.k_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn.out_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn.out_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn.q_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn.q_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn.v_proj.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn.v_proj.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn_layer_norm.bias": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.47.self_attn_layer_norm.weight": "pytorch_model-00006-of-00007.bin", + "model.decoder.layers.5.fc1.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.fc1.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.fc2.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.fc2.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.5.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.fc1.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.fc1.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.fc2.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.fc2.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.final_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.final_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.6.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.7.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.7.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.7.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.7.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.7.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.7.self_attn.k_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn.k_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn.out_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn.out_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn.q_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn.q_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn.v_proj.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn.v_proj.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn_layer_norm.bias": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.7.self_attn_layer_norm.weight": "pytorch_model-00001-of-00007.bin", + "model.decoder.layers.8.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.8.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.fc1.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.fc1.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.fc2.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.fc2.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.final_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.final_layer_norm.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.k_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.k_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.out_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.out_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.q_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.q_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.v_proj.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn.v_proj.weight": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn_layer_norm.bias": "pytorch_model-00002-of-00007.bin", + "model.decoder.layers.9.self_attn_layer_norm.weight": "pytorch_model-00002-of-00007.bin" + } +} diff --git a/special_tokens_map.json b/special_tokens_map.json new file mode 100644 index 0000000..0967ef4 --- /dev/null +++ b/special_tokens_map.json @@ -0,0 +1 @@ +{} diff --git a/tokenizer.json b/tokenizer.json new file mode 100644 index 0000000..e18054f --- /dev/null +++ b/tokenizer.json @@ -0,0 +1,99996 @@ +{ + "version": "1.0", + "truncation": null, + "padding": null, + "added_tokens": [ + { + "id": 0, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 1, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 2, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 3, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 4, + "content": "[START_REF]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 5, + "content": "[END_REF]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 6, + "content": "[IMAGE]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 7, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 8, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 9, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 10, + "content": "", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 11, + "content": "[START_SUP]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 12, + "content": "[END_SUP]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 13, + "content": "[START_SUB]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 14, + "content": "[END_SUB]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 15, + "content": "[START_DNA]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 16, + "content": "[END_DNA]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 17, + "content": "[START_AMINO]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 18, + "content": "[END_AMINO]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 19, + "content": "[START_SMILES]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 20, + "content": "[END_SMILES]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 21, + "content": "[START_I_SMILES]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + }, + { + "id": 22, + "content": "[END_I_SMILES]", + "single_word": false, + "lstrip": false, + "rstrip": false, + "normalized": false, + "special": true + } + ], + "normalizer": { + "type": "NFKC" + }, + "pre_tokenizer": { + "type": "Sequence", + "pretokenizers": [ + { + "type": "Split", + "pattern": { + "String": "SPL1T-TH1S-Pl3A5E" + }, + "behavior": "Removed", + "invert": false + }, + { + "type": "Digits", + "individual_digits": true + }, + { + "type": "Split", + "pattern": { + "Regex": "[\\(\\)\\[\\]\\{\\}]|([!\"\\#\\$%\\&'\\*\\+,\\-\\./:;<=>\\?\\\\\\^_`\\|\\~])\\1*" + }, + "behavior": "Isolated", + "invert": false + }, + { + "type": "Split", + "pattern": { + "String": "\n" + }, + "behavior": "Isolated", + "invert": false + }, + { + "type": "ByteLevel", + "add_prefix_space": false, + "trim_offsets": true, + "use_regex": true + } + ] + }, + "post_processor": null, + "decoder": { + "type": "ByteLevel", + "add_prefix_space": true, + "trim_offsets": true, + "use_regex": true + }, + "model": { + "type": "BPE", + "dropout": null, + "unk_token": null, + "continuing_subword_prefix": null, + "end_of_word_suffix": null, + "fuse_unk": false, + "vocab": { + "": 0, + "": 1, + "": 2, + "": 3, + "[START_REF]": 4, + "[END_REF]": 5, + "[IMAGE]": 6, + "": 7, + "": 8, + "": 9, + "": 10, + "[START_SUP]": 11, + "[END_SUP]": 12, + "[START_SUB]": 13, + "[END_SUB]": 14, + "[START_DNA]": 15, + "[END_DNA]": 16, + "[START_AMINO]": 17, + "[END_AMINO]": 18, + "[START_SMILES]": 19, + "[END_SMILES]": 20, + "[START_I_SMILES]": 21, + "[END_I_SMILES]": 22, + "!": 23, + "\"": 24, + "#": 25, + "$": 26, + "%": 27, + "&": 28, + "'": 29, + "(": 30, + ")": 31, + "*": 32, + "+": 33, + ",": 34, + "-": 35, + ".": 36, + "/": 37, + "0": 38, + "1": 39, + "2": 40, + "3": 41, + "4": 42, + "5": 43, + "6": 44, + "7": 45, + "8": 46, + "9": 47, + ":": 48, + ";": 49, + "<": 50, + "=": 51, + ">": 52, + "?": 53, + "@": 54, + "A": 55, + "B": 56, + "C": 57, + "D": 58, + "E": 59, + "F": 60, + "G": 61, + "H": 62, + "I": 63, + "J": 64, + "K": 65, + "L": 66, + "M": 67, + "N": 68, + "O": 69, + "P": 70, + "Q": 71, + "R": 72, + "S": 73, + "T": 74, + "U": 75, + "V": 76, + "W": 77, + "X": 78, + "Y": 79, + "Z": 80, + "[": 81, + "\\": 82, + "]": 83, + "^": 84, + "_": 85, + "`": 86, + "a": 87, + "b": 88, + "c": 89, + "d": 90, + "e": 91, + "f": 92, + "g": 93, + "h": 94, + "i": 95, + "j": 96, + "k": 97, + "l": 98, + "m": 99, + "n": 100, + "o": 101, + "p": 102, + "q": 103, + "r": 104, + "s": 105, + "t": 106, + "u": 107, + "v": 108, + "w": 109, + "x": 110, + "y": 111, + "z": 112, + "{": 113, + "|": 114, + "}": 115, + "~": 116, + "¡": 117, + "¢": 118, + "£": 119, + "¤": 120, + "¥": 121, + "¦": 122, + "§": 123, + "¨": 124, + "©": 125, + "ª": 126, + "«": 127, + "¬": 128, + "®": 129, + "¯": 130, + "°": 131, + "±": 132, + "²": 133, + "³": 134, + "´": 135, + "µ": 136, + "¶": 137, + "·": 138, + "¸": 139, + "¹": 140, + "º": 141, + "»": 142, + "¼": 143, + "½": 144, + "¾": 145, + "¿": 146, + "À": 147, + "Á": 148, + "Â": 149, + "Ã": 150, + "Ä": 151, + "Å": 152, + "Æ": 153, + "Ç": 154, + "È": 155, + "É": 156, + "Ê": 157, + "Ë": 158, + "Ì": 159, + "Í": 160, + "Î": 161, + "Ï": 162, + "Ð": 163, + "Ñ": 164, + "Ò": 165, + "Ó": 166, + "Ô": 167, + "Õ": 168, + "Ö": 169, + "×": 170, + "Ø": 171, + "Ù": 172, + "Ú": 173, + "Û": 174, + "Ü": 175, + "Ý": 176, + "Þ": 177, + "ß": 178, + "à": 179, + "á": 180, + "â": 181, + "ã": 182, + "ä": 183, + "å": 184, + "æ": 185, + "ç": 186, + "è": 187, + "é": 188, + "ê": 189, + "ë": 190, + "ì": 191, + "í": 192, + "î": 193, + "ï": 194, + "ð": 195, + "ñ": 196, + "ò": 197, + "ó": 198, + "ô": 199, + "õ": 200, + "ö": 201, + "÷": 202, + "ø": 203, + "ù": 204, + "ú": 205, + "û": 206, + "ü": 207, + "ý": 208, + "þ": 209, + "ÿ": 210, + "Ā": 211, + "ā": 212, + "Ă": 213, + "ă": 214, + "Ą": 215, + "ą": 216, + "Ć": 217, + "ć": 218, + "Ĉ": 219, + "ĉ": 220, + "Ċ": 221, + "ċ": 222, + "Č": 223, + "č": 224, + "Ď": 225, + "ď": 226, + "Đ": 227, + "đ": 228, + "Ē": 229, + "ē": 230, + "Ĕ": 231, + "ĕ": 232, + "Ė": 233, + "ė": 234, + "Ę": 235, + "ę": 236, + "Ě": 237, + "ě": 238, + "Ĝ": 239, + "ĝ": 240, + "Ğ": 241, + "ğ": 242, + "Ġ": 243, + "ġ": 244, + "Ģ": 245, + "ģ": 246, + "Ĥ": 247, + "ĥ": 248, + "Ħ": 249, + "ħ": 250, + "Ĩ": 251, + "ĩ": 252, + "Ī": 253, + "ī": 254, + "Ĭ": 255, + "ĭ": 256, + "Į": 257, + "į": 258, + "İ": 259, + "ı": 260, + "IJ": 261, + "ij": 262, + "Ĵ": 263, + "ĵ": 264, + "Ķ": 265, + "ķ": 266, + "ĸ": 267, + "Ĺ": 268, + "ĺ": 269, + "Ļ": 270, + "ļ": 271, + "Ľ": 272, + "ľ": 273, + "Ŀ": 274, + "ŀ": 275, + "Ł": 276, + "ł": 277, + "Ń": 278, + "Ġt": 279, + "in": 280, + "Ġa": 281, + "he": 282, + "on": 283, + "re": 284, + "at": 285, + "Ġthe": 286, + "er": 287, + "Ġs": 288, + "Ġo": 289, + "en": 290, + "al": 291, + "Ġc": 292, + "ti": 293, + "or": 294, + "ed": 295, + "es": 296, + "is": 297, + "Ġp": 298, + "Ġof": 299, + "nd": 300, + "Ġin": 301, + "Ġf": 302, + "Ġw": 303, + "ĠĠ": 304, + "it": 305, + "an": 306, + "ro": 307, + "ar": 308, + "Ġd": 309, + "Ġm": 310, + "Ġb": 311, + "Ġand": 312, + "ic": 313, + "le": 314, + "ing": 315, + "ion": 316, + "as": 317, + "Ġe": 318, + "Ġre": 319, + "ation": 320, + "Ġto": 321, + "el": 322, + "ent": 323, + "ac": 324, + "et": 325, + "ec": 326, + "tion": 327, + "om": 328, + "st": 329, + "ĠT": 330, + "Ġn": 331, + "Ġth": 332, + "ol": 333, + "ul": 334, + "im": 335, + "RE": 336, + "ig": 337, + "us": 338, + "REF": 339, + "Ġl": 340, + "Ġh": 341, + "ur": 342, + "Ġis": 343, + "ĠĠĠĠ": 344, + "Ġfor": 345, + "id": 346, + "am": 347, + "ĠS": 348, + "ve": 349, + "il": 350, + "ĠA": 351, + "ĠC": 352, + "Ġg": 353, + "ot": 354, + "ith": 355, + "ly": 356, + "ce": 357, + "Ġcon": 358, + "ow": 359, + "Ġst": 360, + "ut": 361, + "os": 362, + "Ġwith": 363, + "od": 364, + "ra": 365, + "Ġv": 366, + "Ġpro": 367, + "um": 368, + "ĠI": 369, + "if": 370, + "uc": 371, + "ter": 372, + "un": 373, + "AR": 374, + "ST": 375, + "res": 376, + "Ġon": 377, + "EN": 378, + "ere": 379, + "ĠP": 380, + "ĠThe": 381, + "ĠM": 382, + "Ġas": 383, + "ART": 384, + "Ġan": 385, + "END": 386, + "START": 387, + "Ġthat": 388, + "qu": 389, + "em": 390, + "Ġbe": 391, + "Ġex": 392, + "ri": 393, + "ab": 394, + "ity": 395, + "tic": 396, + "ver": 397, + "Ġal": 398, + "pl": 399, + "ts": 400, + "ĠF": 401, + "Ġâ": 402, + "ure": 403, + "Ġby": 404, + "ate": 405, + "ag": 406, + "ir": 407, + "oc": 408, + "per": 409, + "ĠB": 410, + "ay": 411, + "ĠD": 412, + "Ġcom": 413, + "ĠH": 414, + "ated": 415, + "ĠR": 416, + "Ġare": 417, + "rom": 418, + "ĠE": 419, + "op": 420, + "ad": 421, + "se": 422, + "ĠL": 423, + "igh": 424, + "ĠN": 425, + "ment": 426, + "her": 427, + "og": 428, + "ain": 429, + "ect": 430, + "ud": 431, + "Ġde": 432, + "Ġr": 433, + "Ġat": 434, + "Ġwas": 435, + "Ġus": 436, + "Ġres": 437, + "ell": 438, + "iz": 439, + "ine": 440, + "ph": 441, + "Ġac": 442, + "ess": 443, + "ore": 444, + "ical": 445, + "th": 446, + "und": 447, + "rac": 448, + "Ġwe": 449, + "ath": 450, + "ĠG": 451, + "Ġfrom": 452, + "ati": 453, + "up": 454, + "ist": 455, + "ant": 456, + "Ġor": 457, + "ff": 458, + "Ġcomp": 459, + "Ġwh": 460, + "ĠW": 461, + "ch": 462, + "ers": 463, + "Ġsp": 464, + "orm": 465, + "Ġch": 466, + "ations": 467, + "ran": 468, + "ub": 469, + "te": 470, + "di": 471, + "Ġsh": 472, + "ge": 473, + "ase": 474, + "Ġwere": 475, + "ĠĠĠĠĠĠĠĠ": 476, + "ĠÎ": 477, + "ap": 478, + "ĠIn": 479, + "and": 480, + "Ġse": 481, + "vel": 482, + "Ġim": 483, + "ĠâĪ": 484, + "ens": 485, + "ies": 486, + "ich": 487, + "ight": 488, + "duc": 489, + "ĠO": 490, + "Ġit": 491, + "tions": 492, + "end": 493, + "Ġco": 494, + "Ġthis": 495, + "Ġcan": 496, + "Ġk": 497, + "âĢ": 498, + "lec": 499, + "ted": 500, + "Ġmod": 501, + "math": 502, + "Ġcont": 503, + "Ġne": 504, + "Ġpar": 505, + "ib": 506, + "ĠĠĠ": 507, + "Ġle": 508, + "iv": 509, + "ug": 510, + "ence": 511, + "ign": 512, + "ous": 513, + "ents": 514, + "ys": 515, + "ave": 516, + "red": 517, + "ress": 518, + "able": 519, + "por": 520, + "all": 521, + "iff": 522, + "est": 523, + "Ġap": 524, + "Ġinc": 525, + "nt": 526, + "ary": 527, + "iti": 528, + "Ġwhich": 529, + "Ġnot": 530, + "form": 531, + "Ġsy": 532, + "Ġad": 533, + "low": 534, + "ak": 535, + "Ġper": 536, + "Ġhe": 537, + "pro": 538, + "ance": 539, + "ial": 540, + "ue": 541, + "Ġen": 542, + "Ġcl": 543, + "ass": 544, + "ip": 545, + "rans": 546, + "Ġob": 547, + "Ġgen": 548, + "tim": 549, + "Ġdis": 550, + "unc": 551, + "Ġint": 552, + "ep": 553, + "etw": 554, + "Ġdiff": 555, + "ach": 556, + "ther": 557, + "ime": 558, + "age": 559, + "ple": 560, + "ill": 561, + "yp": 562, + "ĠK": 563, + "act": 564, + "ari": 565, + "Ġmet": 566, + "ors": 567, + "Ġhave": 568, + "Ġstud": 569, + "ong": 570, + "ĠU": 571, + "Ġpl": 572, + "ide": 573, + "ma": 574, + "hen": 575, + "ific": 576, + "ome": 577, + "Ġi": 578, + "ular": 579, + "ĠV": 580, + "ally": 581, + "Ġshow": 582, + "rib": 583, + "ia": 584, + "enti": 585, + "Ġass": 586, + "ond": 587, + "ft": 588, + "Ġab": 589, + "Ġinter": 590, + "ĠTh": 591, + "The": 592, + "str": 593, + "Ġcell": 594, + "cal": 595, + "Ġmodel": 596, + "ata": 597, + "ast": 598, + "Ġeff": 599, + "Ġtrans": 600, + "ates": 601, + "ased": 602, + "ost": 603, + "vi": 604, + "ang": 605, + "our": 606, + "Ġme": 607, + "ard": 608, + "Ġdiffere": 609, + "Ġpre": 610, + "Ġdi": 611, + "ĠâĪĴ": 612, + "olog": 613, + "ution": 614, + "ound": 615, + "ace": 616, + "Ġresul": 617, + "erm": 618, + "pos": 619, + "here": 620, + "tive": 621, + "ord": 622, + "so": 623, + "stem": 624, + "yl": 625, + "Ġph": 626, + "Ġy": 627, + "ame": 628, + "ork": 629, + "ative": 630, + "Ġqu": 631, + "ric": 632, + "SU": 633, + "wo": 634, + "Ġun": 635, + "Ġev": 636, + "are": 637, + "##": 638, + "de": 639, + "een": 640, + "tiv": 641, + "Ġgro": 642, + "ory": 643, + "Ġcons": 644, + "Ġsub": 645, + "ta": 646, + "--": 647, + "Ġstr": 648, + "ber": 649, + "erv": 650, + "etween": 651, + "enc": 652, + "Ġanal": 653, + "int": 654, + "Ġhas": 655, + "uch": 656, + "Ġreg": 657, + "Ġbetween": 658, + "Ġdet": 659, + "Ġall": 660, + "cess": 661, + "Ġexp": 662, + "ection": 663, + "ĠâĢ": 664, + "ind": 665, + "ater": 666, + "Ġsign": 667, + "pt": 668, + "ugh": 669, + "ite": 670, + "ility": 671, + "Ġusing": 672, + "Ġval": 673, + "Ġro": 674, + "ree": 675, + "Ġrel": 676, + "out": 677, + "Ġfunc": 678, + "ition": 679, + "Ġcor": 680, + "Ġalso": 681, + "Ġtwo": 682, + "ne": 683, + "ĠJ": 684, + "Ġsystem": 685, + "cl": 686, + "uct": 687, + "Ġsim": 688, + "tain": 689, + "ust": 690, + "ied": 691, + "port": 692, + "Ġrec": 693, + "Ġresp": 694, + "Ġdata": 695, + "rm": 696, + "resent": 697, + "uld": 698, + "xt": 699, + "Ġj": 700, + "ry": 701, + "ack": 702, + "Ġra": 703, + "par": 704, + "Ġform": 705, + "Ġsc": 706, + "frac": 707, + "ĠWe": 708, + "ating": 709, + "ech": 710, + "hod": 711, + "Ġfol": 712, + "ined": 713, + "ĠSt": 714, + "ual": 715, + "Ġused": 716, + "Ġone": 717, + "Ġdes": 718, + "ĠÏ": 719, + "Ġvari": 720, + "Ġdist": 721, + "Ġnum": 722, + "ym": 723, + "ew": 724, + "rec": 725, + "ob": 726, + "Ġinf": 727, + "Ġar": 728, + "lect": 729, + "ll": 730, + "ons": 731, + "ĠThis": 732, + "ose": 733, + "ile": 734, + "play": 735, + "ear": 736, + "ox": 737, + "ures": 738, + "one": 739, + "Ġstudy": 740, + "ysis": 741, + "Ġfollow": 742, + "yle": 743, + "ract": 744, + "dis": 745, + "Ġpos": 746, + "right": 747, + "Ġthan": 748, + "ros": 749, + "av": 750, + "Fig": 751, + "Ġtime": 752, + "ization": 753, + "ulation": 754, + "ized": 755, + "Ġsur": 756, + "oth": 757, + "Ġout": 758, + "Ġcol": 759, + "ature": 760, + "ive": 761, + "Ġsol": 762, + "Ġx": 763, + "eld": 764, + "Ġother": 765, + "plic": 766, + "Ġdef": 767, + "erg": 768, + "Ġgener": 769, + "ely": 770, + "Ġbeen": 771, + "Ġincre": 772, + "Ġthese": 773, + "Ġno": 774, + "ax": 775, + "style": 776, + "arg": 777, + "ian": 778, + "Ġind": 779, + "Ġsuch": 780, + "Ġfunction": 781, + "ting": 782, + "Ġequ": 783, + "aus": 784, + "Ġund": 785, + "mathb": 786, + "tical": 787, + "Ġhigh": 788, + "rain": 789, + "Ġam": 790, + "ield": 791, + "oun": 792, + "ression": 793, + "Ġspec": 794, + "Ġop": 795, + "Ġdec": 796, + "Ġover": 797, + "Ġmethod": 798, + "Ġset": 799, + "âĪ": 800, + "Ġif": 801, + "dition": 802, + "ues": 803, + "ects": 804, + "display": 805, + "hem": 806, + "Ġpati": 807, + "Ġresults": 808, + "old": 809, + "anc": 810, + "displaystyle": 811, + "Ġeach": 812, + "Ġmore": 813, + "les": 814, + "pr": 815, + "acter": 816, + "Ġtheir": 817, + "Ġacc": 818, + "Ġappro": 819, + "iss": 820, + "ize": 821, + "Ġinv": 822, + "ases": 823, + "Ġcells": 824, + "irst": 825, + "lu": 826, + "ail": 827, + "Ġmeas": 828, + "Ġlow": 829, + "ov": 830, + "the": 831, + "ik": 832, + "**": 833, + "ef": 834, + "Ġbut": 835, + "hes": 836, + "fter": 837, + "Ġdifferent": 838, + "vely": 839, + "Ġext": 840, + "Ġthere": 841, + "oci": 842, + "Ġprob": 843, + "Ġits": 844, + "ron": 845, + "ments": 846, + "Ġag": 847, + "NA": 848, + "Ġpo": 849, + "ice": 850, + "ype": 851, + "Ġgroup": 852, + "âĢĵ": 853, + "ever": 854, + "ult": 855, + "ism": 856, + "tern": 857, + "ability": 858, + "ions": 859, + "ark": 860, + "Ġnon": 861, + "to": 862, + "ĠĠĠĠĠĠĠ": 863, + "Ġobs": 864, + "Ġtre": 865, + "als": 866, + "left": 867, + "ĠPro": 868, + "Ġonly": 869, + "Ġman": 870, + "der": 871, + "Ġpol": 872, + "uring": 873, + "amet": 874, + "rol": 875, + "In": 876, + "yn": 877, + "Ġunder": 878, + "ĠCh": 879, + "Ġwhere": 880, + "ood": 881, + "ĠX": 882, + "nce": 883, + "Ġpartic": 884, + "ected": 885, + "ĠFig": 886, + "Ġem": 887, + "Ġfact": 888, + "ĠAn": 889, + "Ġperform": 890, + "Ġso": 891, + "Ġanalysis": 892, + "stract": 893, + "hed": 894, + "Ġmay": 895, + "atic": 896, + "Ġrep": 897, + "tein": 898, + "duced": 899, + "Ġup": 900, + "Ġinto": 901, + "Ġnumber": 902, + "Ġour": 903, + "Ġet": 904, + "eg": 905, + "itle": 906, + "over": 907, + "ix": 908, + "ator": 909, + "ulti": 910, + "Ġincl": 911, + "ould": 912, + "ici": 913, + "bstract": 914, + "Ġcomple": 915, + "Ġpatients": 916, + "Ġdo": 917, + "Ġexper": 918, + "vid": 919, + "ange": 920, + "Ġlevel": 921, + "Ġprocess": 922, + "mathcal": 923, + "ps": 924, + "Ġsignific": 925, + "Ġsam": 926, + "Title": 927, + "Ġbl": 928, + "Ġstruct": 929, + "eta": 930, + "Ġobserv": 931, + "raph": 932, + "gr": 933, + "Ġactiv": 934, + "Ġfirst": 935, + "velop": 936, + "gen": 937, + "ible": 938, + "Ġsm": 939, + "Ġwill": 940, + "ĠQ": 941, + "Ġmeasure": 942, + "put": 943, + "Ġloc": 944, + "Ġmo": 945, + "vers": 946, + "of": 947, + "tal": 948, + "ered": 949, + "own": 950, + "Ġmat": 951, + "ities": 952, + "til": 953, + "inal": 954, + "Ġcar": 955, + "pha": 956, + "Ġboth": 957, + "Ġcur": 958, + "SUB": 959, + "its": 960, + "rel": 961, + "Ġwhen": 962, + "Ġz": 963, + "Ġchar": 964, + "Ġbi": 965, + "cent": 966, + "Ġthen": 967, + "ise": 968, + "owever": 969, + "Ġmin": 970, + "ĠFor": 971, + "ĠY": 972, + "ption": 973, + "Ġes": 974, + "mun": 975, + "Ġinclud": 976, + "istic": 977, + "con": 978, + "Ġobtain": 979, + "ared": 980, + "duction": 981, + "Ġsignificant": 982, + "ĠZ": 983, + "Ġpresent": 984, + "ann": 985, + "Ġid": 986, + "ency": 987, + "Ġver": 988, + "val": 989, + "yd": 990, + "rough": 991, + "SUP": 992, + "fore": 993, + "Ġsome": 994, + "ĠAs": 995, + "Ġsup": 996, + "Ġafter": 997, + "ological": 998, + "entif": 999, + "Ġcase": 1000, + "Ġsec": 1001, + "elf": 1002, + "Ġdep": 1003, + "ks": 1004, + "Ġcal": 1005, + "ved": 1006, + "Ġtem": 1007, + "Ġuse": 1008, + "ĠCom": 1009, + "lam": 1010, + "ines": 1011, + "ays": 1012, + "Ġgiv": 1013, + "Ġconsid": 1014, + "Ġelect": 1015, + "ational": 1016, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 1017, + "iqu": 1018, + "ties": 1019, + "Ġline": 1020, + "Ġsu": 1021, + "Abstract": 1022, + "ount": 1023, + "Ġdevelop": 1024, + "ĠCon": 1025, + "ology": 1026, + "alpha": 1027, + "ans": 1028, + "prime": 1029, + "cc": 1030, + "ogen": 1031, + "Ġwork": 1032, + "ven": 1033, + "ium": 1034, + "ective": 1035, + "Ġpa": 1036, + "ten": 1037, + "ĠAl": 1038, + "Ġï": 1039, + "Ġfe": 1040, + "âĢĻ": 1041, + "ential": 1042, + "line": 1043, + "Ġparamet": 1044, + "Ġprotein": 1045, + "Ġdisc": 1046, + "face": 1047, + "ces": 1048, + "Ġwell": 1049, + "ural": 1050, + "eng": 1051, + "Ġduring": 1052, + "row": 1053, + "ants": 1054, + "Ġrem": 1055, + "formation": 1056, + "Ġexam": 1057, + "Ġmic": 1058, + "âĪĴ": 1059, + "lem": 1060, + "ergy": 1061, + "Ġassoci": 1062, + "ĠÃ": 1063, + "rop": 1064, + "Ġfield": 1065, + "ty": 1066, + "Ġclass": 1067, + "Ġu": 1068, + "ie": 1069, + "Ġbec": 1070, + "Ġexperim": 1071, + "sp": 1072, + "Ġpr": 1073, + "ilar": 1074, + "tial": 1075, + "Ġconst": 1076, + "ĠIt": 1077, + "Ġcontrol": 1078, + "da": 1079, + "Ġmulti": 1080, + "itive": 1081, + "ics": 1082, + "urn": 1083, + "Ġindic": 1084, + "Ġfound": 1085, + "text": 1086, + "Ġnew": 1087, + "Ġref": 1088, + "gor": 1089, + "rap": 1090, + "Ġdesc": 1091, + "Ġsame": 1092, + "Ġfollowing": 1093, + "Ġdistrib": 1094, + "Figure": 1095, + "ild": 1096, + "Ġanti": 1097, + "etwork": 1098, + "ove": 1099, + "Ġthrough": 1100, + "Ġmost": 1101, + "cer": 1102, + "Ġdeterm": 1103, + "ha": 1104, + "elta": 1105, + "arge": 1106, + "Ġshown": 1107, + "ince": 1108, + "Ġany": 1109, + "ren": 1110, + "dot": 1111, + "ral": 1112, + "ration": 1113, + "amma": 1114, + "oid": 1115, + "Ġmed": 1116, + "ension": 1117, + "art": 1118, + "Ġpred": 1119, + "met": 1120, + "mathbb": 1121, + "ake": 1122, + "Ġcalc": 1123, + "Ġhig": 1124, + "Ġthree": 1125, + "Ġbased": 1126, + "mon": 1127, + "arch": 1128, + "----": 1129, + "ples": 1130, + "ages": 1131, + "ause": 1132, + "ish": 1133, + "tively": 1134, + "qui": 1135, + "resp": 1136, + "Ġcharacter": 1137, + "ock": 1138, + "Ġtreat": 1139, + "Ġproper": 1140, + "ex": 1141, + "Ġsmall": 1142, + "Ġterm": 1143, + "bda": 1144, + "Ġkn": 1145, + "ode": 1146, + "ings": 1147, + "Ġexpression": 1148, + "Ġmon": 1149, + "emb": 1150, + "ute": 1151, + "echn": 1152, + "hib": 1153, + "Ġdirec": 1154, + "ination": 1155, + "ithm": 1156, + "ulated": 1157, + "Ġcy": 1158, + "Ġpot": 1159, + "Ġorder": 1160, + "ote": 1161, + "ically": 1162, + "Ġvalues": 1163, + "ort": 1164, + "urther": 1165, + "cept": 1166, + "ynam": 1167, + "ough": 1168, + "echan": 1169, + "Ġâī": 1170, + "ok": 1171, + "ement": 1172, + "Ġμ": 1173, + "Ġestim": 1174, + "Ġeffect": 1175, + "Ġpath": 1176, + "Ġconf": 1177, + "Ġapp": 1178, + "Ġgiven": 1179, + "Ġend": 1180, + "set": 1181, + "Ġgl": 1182, + "Ġthey": 1183, + "ning": 1184, + "Ġtest": 1185, + "Ġtemper": 1186, + "ves": 1187, + "Ġvalue": 1188, + "ited": 1189, + "ality": 1190, + "Ġlim": 1191, + "Ġspect": 1192, + "ently": 1193, + "tit": 1194, + "Ġsequ": 1195, + "Ġidentif": 1196, + "//": 1197, + "igma": 1198, + "Ġenergy": 1199, + "inc": 1200, + "ness": 1201, + "ensity": 1202, + "Ġproblem": 1203, + "ydro": 1204, + "agn": 1205, + "ane": 1206, + "rent": 1207, + "com": 1208, + "ject": 1209, + "Ġimport": 1210, + "ĉĉ": 1211, + "Ġoper": 1212, + "olution": 1213, + "Ġaut": 1214, + "ectively": 1215, + "ĠHowever": 1216, + "ho": 1217, + "ental": 1218, + "Ġsing": 1219, + "ey": 1220, + "mu": 1221, + "ross": 1222, + "action": 1223, + "epend": 1224, + "ĠEx": 1225, + "vious": 1226, + "Ġstudies": 1227, + "sc": 1228, + "ormal": 1229, + "Ġhad": 1230, + "Ġmain": 1231, + "alth": 1232, + "gorithm": 1233, + "Ġfl": 1234, + "omet": 1235, + "ĠÂ": 1236, + "..": 1237, + "err": 1238, + "Ġposs": 1239, + "Ġdifferen": 1240, + "Ġobserved": 1241, + "ray": 1242, + "Ġpredic": 1243, + "Ġgene": 1244, + "Ġstate": 1245, + "We": 1246, + "Ġstructure": 1247, + "Ġret": 1248, + "respond": 1249, + "requ": 1250, + "ily": 1251, + "ĠâĪĪ": 1252, + "Ġser": 1253, + "Ġbound": 1254, + "Ġrepresent": 1255, + "phi": 1256, + "Ġtreatment": 1257, + "hat": 1258, + "Ġrequi": 1259, + "app": 1260, + "uman": 1261, + "Ġhigher": 1262, + "Ġlarge": 1263, + "Ġtra": 1264, + "ward": 1265, + "Ġobtained": 1266, + "Ġcould": 1267, + "tig": 1268, + "ĠUn": 1269, + "Ġdescrib": 1270, + "Ġsimilar": 1271, + "ported": 1272, + "ins": 1273, + "Ġaddition": 1274, + "osis": 1275, + "Ġnetwork": 1276, + "Ġele": 1277, + "pi": 1278, + "rix": 1279, + "Ġrate": 1280, + "gan": 1281, + "ugg": 1282, + "uss": 1283, + "Ġmechan": 1284, + "Ġdise": 1285, + "Ġeffects": 1286, + "Ġmodels": 1287, + "orph": 1288, + "ike": 1289, + "Ġsecond": 1290, + "mathbf": 1291, + "Ġdue": 1292, + "Ġq": 1293, + "Ġpres": 1294, + "Ġtechn": 1295, + "els": 1296, + "Ġcorrespond": 1297, + "Ġassociated": 1298, + "posed": 1299, + "Ġmass": 1300, + "round": 1301, + "view": 1302, + "Ġins": 1303, + "ĠâĢ¢": 1304, + "ditions": 1305, + "Ġwhile": 1306, + "ole": 1307, + "Ġlong": 1308, + "alu": 1309, + "Ġcap": 1310, + "Ġsurface": 1311, + "Ġcomplex": 1312, + "Ġcent": 1313, + "Ġcompared": 1314, + "Ġfind": 1315, + "arget": 1316, + "atory": 1317, + "fer": 1318, + "Ġsize": 1319, + "Ġcontain": 1320, + "usion": 1321, + "utions": 1322, + "Ġdem": 1323, + "ES": 1324, + "Ġdepend": 1325, + "atis": 1326, + "sum": 1327, + "ffici": 1328, + "Ġbas": 1329, + "lambda": 1330, + "ier": 1331, + "AT": 1332, + "Ġmax": 1333, + "Ġimp": 1334, + "Ġevalu": 1335, + "Ġtemperature": 1336, + "ink": 1337, + "ector": 1338, + "Ġscal": 1339, + "Ġgrow": 1340, + "ower": 1341, + "Ġrespectively": 1342, + "lear": 1343, + "sh": 1344, + "ick": 1345, + "Ġfil": 1346, + "irc": 1347, + "ilon": 1348, + "ram": 1349, + "Ġα": 1350, + "ification": 1351, + "Ġocc": 1352, + "Ġyear": 1353, + "Ġsugg": 1354, + "Ġradi": 1355, + "ified": 1356, + "havi": 1357, + "Ġwithin": 1358, + "Ġsens": 1359, + "Ġinte": 1360, + "Ġwould": 1361, + "Ġconcent": 1362, + "Ġmicro": 1363, + "Ġsingle": 1364, + "ĠSp": 1365, + "ou": 1366, + "Ġatt": 1367, + "Ġself": 1368, + "Ġabout": 1369, + "ength": 1370, + "Ġel": 1371, + "ĠRe": 1372, + "xim": 1373, + "Ġconditions": 1374, + "ude": 1375, + "ĠAt": 1376, + "where": 1377, + "med": 1378, + "Ġneed": 1379, + "iron": 1380, + "Ġpop": 1381, + "Ġresult": 1382, + "Ġpoint": 1383, + "Ġlo": 1384, + "Ġalgorithm": 1385, + "Ġactivity": 1386, + "leq": 1387, + "plement": 1388, + "ĠRes": 1389, + "Ġsym": 1390, + "onstr": 1391, + "atures": 1392, + "Ġimpro": 1393, + "for": 1394, + "Ġgeneral": 1395, + "iter": 1396, + "Ġexpl": 1397, + "###": 1398, + "Ġdom": 1399, + "Ġtri": 1400, + "min": 1401, + "Ġdistribution": 1402, + "Ġtr": 1403, + "ĠThere": 1404, + "oss": 1405, + "uce": 1406, + "mathrm": 1407, + "ull": 1408, + "ER": 1409, + "reg": 1410, + "Ġpe": 1411, + "Ġtotal": 1412, + "Ġlead": 1413, + "==": 1414, + "iod": 1415, + "Ġassum": 1416, + "Ġchang": 1417, + "Ġgra": 1418, + "MI": 1419, + "Ġcomput": 1420, + "Ġcomb": 1421, + "Ġinformation": 1422, + "Ġdesign": 1423, + "Ġiniti": 1424, + "Ġfrequ": 1425, + "imension": 1426, + "cop": 1427, + "Ġproperties": 1428, + "Ġconsider": 1429, + "Ġlevels": 1430, + "ene": 1431, + "Ġtype": 1432, + "ived": 1433, + "ĠHe": 1434, + "ependent": 1435, + "Ġapplic": 1436, + "Ġinves": 1437, + "Ġprevious": 1438, + "aw": 1439, + "Ġspace": 1440, + "Ġprovid": 1441, + "hyl": 1442, + "Ġinvestig": 1443, + "Ġapproach": 1444, + "aterial": 1445, + "onse": 1446, + "lecular": 1447, + "Ġparameters": 1448, + "Ġphase": 1449, + "ulations": 1450, + "ubl": 1451, + "beta": 1452, + "Ġav": 1453, + "Ġflu": 1454, + "Ġpotential": 1455, + "ĠThese": 1456, + "sigma": 1457, + "lo": 1458, + "times": 1459, + "Ġoptim": 1460, + "ision": 1461, + "Ġaff": 1462, + "Ġmean": 1463, + "Ġbehavi": 1464, + "Ġvol": 1465, + "orem": 1466, + "agne": 1467, + "Ġdecre": 1468, + "tional": 1469, + "Ġsolution": 1470, + "Ġhuman": 1471, + "ger": 1472, + "Ġpaper": 1473, + "Ġcompar": 1474, + "Ġlower": 1475, + "andard": 1476, + "Ġcorrel": 1477, + "cri": 1478, + "Ġcurrent": 1479, + "Ġder": 1480, + "ission": 1481, + "ĠFigure": 1482, + "Ġproduc": 1483, + "Ġwater": 1484, + "ĠTo": 1485, + "Ġthose": 1486, + "Ġacid": 1487, + "Ġcancer": 1488, + "Ġlocal": 1489, + "ton": 1490, + "Ġflow": 1491, + "Ġregion": 1492, + "Ġhealth": 1493, + "Ġimportant": 1494, + "ograph": 1495, + "abl": 1496, + "Ġselec": 1497, + "Ġgre": 1498, + "Ġindi": 1499, + "ade": 1500, + "rid": 1501, + "Ġshould": 1502, + "based": 1503, + "Ġabove": 1504, + "ld": 1505, + "Ġsystems": 1506, + "ication": 1507, + "Ġed": 1508, + "Ġtyp": 1509, + "Ġphys": 1510, + "oper": 1511, + "Ġcompon": 1512, + "ON": 1513, + "Ġsuper": 1514, + "ga": 1515, + "hemical": 1516, + "isk": 1517, + "oph": 1518, + "Ġhy": 1519, + "Ġanaly": 1520, + "inu": 1521, + "Ġtarget": 1522, + "ĠAd": 1523, + "Ġpat": 1524, + "gamma": 1525, + "Ġsamples": 1526, + "Ġsl": 1527, + "Ġpart": 1528, + "olds": 1529, + "Ġbel": 1530, + "imum": 1531, + "ĠIm": 1532, + "Ġdisease": 1533, + "II": 1534, + "ists": 1535, + "iver": 1536, + "Ġperformance": 1537, + "ĠĠĠĠĠĠĠĠĠĠĠ": 1538, + "gle": 1539, + "Ġox": 1540, + "ndom": 1541, + "ĠĠĠĠĠ": 1542, + "Ġbecause": 1543, + "ayer": 1544, + "Ġrange": 1545, + "Ġcoun": 1546, + "Ġincreased": 1547, + "och": 1548, + "onal": 1549, + "Ġvery": 1550, + "Ġdynam": 1551, + "anti": 1552, + "Ġadd": 1553, + "Ġinhib": 1554, + "Ġmethods": 1555, + "idence": 1556, + "inical": 1557, + "erence": 1558, + "ival": 1559, + "ule": 1560, + "Ġfactor": 1561, + "Ġfin": 1562, + "ints": 1563, + "viron": 1564, + "Ġsour": 1565, + "verage": 1566, + "equ": 1567, + "Ġear": 1568, + "Ġshowed": 1569, + "ites": 1570, + "Ġperformed": 1571, + "Ġrese": 1572, + "ĠEn": 1573, + "Ġspecies": 1574, + "AC": 1575, + "ĠCl": 1576, + "hip": 1577, + "tilde": 1578, + "io": 1579, + "ately": 1580, + "Th": 1581, + "ody": 1582, + "Ġincrease": 1583, + "ĠPh": 1584, + "âĢĿ": 1585, + "Ġshows": 1586, + "ĠAc": 1587, + "Ġpost": 1588, + "ording": 1589, + "ences": 1590, + "oy": 1591, + "ner": 1592, + "Ġresponse": 1593, + "Ġoccur": 1594, + "rho": 1595, + "Ġperiod": 1596, + "ars": 1597, + "Ġred": 1598, + "ĠOn": 1599, + "Ġdensity": 1600, + "Ġexample": 1601, + "get": 1602, + "Ġreal": 1603, + "ĠCount": 1604, + "acy": 1605, + "Ġpower": 1606, + "Ġabs": 1607, + "ital": 1608, + "Ġprim": 1609, + "âĢIJ": 1610, + "Ġdefined": 1611, + "Ġnormal": 1612, + "aj": 1613, + "Ġinst": 1614, + "Ġallow": 1615, + "Ġpossible": 1616, + "Ġvis": 1617, + "Ġreported": 1618, + "Ġsignal": 1619, + "theta": 1620, + "Ġden": 1621, + "ables": 1622, + "Ġdeg": 1623, + "Ġindivid": 1624, + "agnetic": 1625, + "Ġgroups": 1626, + "ae": 1627, + "arrow": 1628, + "Ġstat": 1629, + "Ġmechanism": 1630, + "osp": 1631, + "mer": 1632, + "other": 1633, + "Ġprot": 1634, + "Ġcases": 1635, + "Ġcr": 1636, + "Ġte": 1637, + "Ġintegr": 1638, + "ets": 1639, + "Ġdevelopment": 1640, + "Ġrandom": 1641, + "Ġinvol": 1642, + "Ġincluding": 1643, + "Ġerr": 1644, + "gram": 1645, + "Ġparticular": 1646, + "eps": 1647, + "Ġstandard": 1648, + "position": 1649, + "Ġcontrib": 1650, + "sequ": 1651, + "Ġmany": 1652, + "Ġfurther": 1653, + "Ġsignificantly": 1654, + "ators": 1655, + "urb": 1656, + "Ġagain": 1657, + "bar": 1658, + "Ġwithout": 1659, + "Ġsever": 1660, + "Ġtop": 1661, + "ret": 1662, + "led": 1663, + "Ġmatrix": 1664, + "Ġspecific": 1665, + "ateg": 1666, + "ĨĴ": 1667, + "Ġdirect": 1668, + "Ġsample": 1669, + "Ġthem": 1670, + "SA": 1671, + "oint": 1672, + "Ġrole": 1673, + "Ġchanges": 1674, + "raction": 1675, + "Ġsum": 1676, + "Ġindividual": 1677, + "IN": 1678, + "Ġimmun": 1679, + "ced": 1680, + "oh": 1681, + "Ġstrong": 1682, + "Ġep": 1683, + "Ġlinear": 1684, + "ually": 1685, + "delta": 1686, + "way": 1687, + "asing": 1688, + "Ġtim": 1689, + "Ġvi": 1690, + "ison": 1691, + "Ġfunctions": 1692, + "Ġamong": 1693, + "Ġsee": 1694, + "erest": 1695, + "Ġgrowth": 1696, + "Ġrati": 1697, + "ĠSc": 1698, + "ixed": 1699, + "RNA": 1700, + "eed": 1701, + "tau": 1702, + "Ġent": 1703, + "Ġdr": 1704, + "ores": 1705, + "Ġapproxim": 1706, + "ful": 1707, + "Ġrele": 1708, + "Ġfactors": 1709, + "Ġdiscuss": 1710, + "Ġphot": 1711, + "Ġproposed": 1712, + "ero": 1713, + "omega": 1714, + "Ġfour": 1715, + "astic": 1716, + "Ġyears": 1717, + "hesis": 1718, + "ique": 1719, + "Ġmaterial": 1720, + "Ġbre": 1721, + "Ġprof": 1722, + "ĠAp": 1723, + "Ġneg": 1724, + "Ġbu": 1725, + "Ġassess": 1726, + "ĠâĢľ": 1727, + "Ġvir": 1728, + "atter": 1729, + "Ġdescribed": 1730, + "istics": 1731, + "Ġcompos": 1732, + "az": 1733, + "struc": 1734, + "Ġtum": 1735, + "partial": 1736, + "af": 1737, + "Ġwho": 1738, + "atal": 1739, + "Ġdemonstr": 1740, + "ances": 1741, + "yt": 1742, + "Ġremain": 1743, + "Ġless": 1744, + "Ġpositive": 1745, + "omic": 1746, + "Ġsince": 1747, + "ogn": 1748, + "Ġcondition": 1749, + "::": 1750, + "Ġdoes": 1751, + "tice": 1752, + "osph": 1753, + "Ġprov": 1754, + "ĠCO": 1755, + "Ġrat": 1756, + "Ġterms": 1757, + "box": 1758, + "Ġtak": 1759, + "Ġpattern": 1760, + "ale": 1761, + "Ġnan": 1762, + "ules": 1763, + "Ġmut": 1764, + "ished": 1765, + "Ġrelated": 1766, + "Ġtheory": 1767, + "bol": 1768, + "cdot": 1769, + "vironment": 1770, + "air": 1771, + "ivers": 1772, + "ĠAr": 1773, + "Ġï£": 1774, + "ressed": 1775, + "Ġâī¤": 1776, + "ĠMet": 1777, + "ID": 1778, + "ults": 1779, + "Ġβ": 1780, + "Ġdat": 1781, + "pose": 1782, + "Ġorig": 1783, + "Ġreturn": 1784, + "Ġchange": 1785, + "Ġlarg": 1786, + "au": 1787, + "aces": 1788, + "Ġarea": 1789, + "Ġgenes": 1790, + "AS": 1791, + "Ġhydro": 1792, + "Ġconsist": 1793, + "man": 1794, + "Ġresearch": 1795, + "ĠDe": 1796, + "Ġorgan": 1797, + "ask": 1798, + "Ġback": 1799, + "Ġfollows": 1800, + "ung": 1801, + "roll": 1802, + "Ġequation": 1803, + "plied": 1804, + "tr": 1805, + "Ġcorresponding": 1806, + "odes": 1807, + "ested": 1808, + "Ġrelations": 1809, + "nal": 1810, + "Ġfr": 1811, + "Ġlimit": 1812, + "mit": 1813, + "Ġoff": 1814, + "uted": 1815, + "Ġrisk": 1816, + "read": 1817, + "Ġknown": 1818, + "plit": 1819, + "tivity": 1820, + "Ġsequence": 1821, + "Ġconsidered": 1822, + "xi": 1823, + "ĠMod": 1824, + "vity": 1825, + "Ġnuc": 1826, + "cle": 1827, + "ices": 1828, + "Ġlength": 1829, + "Ġseveral": 1830, + "sing": 1831, + "oot": 1832, + "not": 1833, + "Ġstress": 1834, + "ĠIf": 1835, + "CT": 1836, + "roph": 1837, + "Ġcommun": 1838, + "Ġclust": 1839, + "ĠLe": 1840, + "me": 1841, + "antum": 1842, + "Ġmemb": 1843, + "Ġlab": 1844, + "Ġeven": 1845, + "Ġinflu": 1846, + "ck": 1847, + "ĠÃĹ": 1848, + "Ġlog": 1849, + "ving": 1850, + "ests": 1851, + "Ġhis": 1852, + "ank": 1853, + "ĠInd": 1854, + "actions": 1855, + "fty": 1856, + "mod": 1857, + "Ġreview": 1858, + "though": 1859, + "Ġeffici": 1860, + "Ġmap": 1861, + "infty": 1862, + "Ġbeing": 1863, + "land": 1864, + "Ġclinical": 1865, + "Ġmeasured": 1866, + "ering": 1867, + "ĠTable": 1868, + "Ġshe": 1869, + "see": 1870, + "Ġsection": 1871, + "Ġavail": 1872, + "omen": 1873, + "Ġvers": 1874, + "Ġdel": 1875, + "ither": 1876, + "eration": 1877, + "Ġhand": 1878, + "Ġcontinu": 1879, + "Ġconn": 1880, + "hors": 1881, + "rad": 1882, + "Ġfam": 1883, + "Ġlear": 1884, + "Ġinitial": 1885, + "ystem": 1886, + "Ġge": 1887, + "Ġâ̲": 1888, + "Ġcirc": 1889, + "Ġpubl": 1890, + "ĠIs": 1891, + "Ġvia": 1892, + "Ġcommon": 1893, + "ife": 1894, + "Ġmark": 1895, + "Ġever": 1896, + "arc": 1897, + "big": 1898, + "ertain": 1899, + "\\\\": 1900, + "var": 1901, + "As": 1902, + "roscop": 1903, + "Ġage": 1904, + "Ġhow": 1905, + "ĠLet": 1906, + "struct": 1907, + "Ġaverage": 1908, + "vant": 1909, + "ĠSh": 1910, + "imensional": 1911, + "SC": 1912, + "ape": 1913, + "nu": 1914, + "Ġloss": 1915, + "ason": 1916, + "ides": 1917, + "Ġpopulation": 1918, + "Ġdomain": 1919, + "inding": 1920, + "we": 1921, + "AL": 1922, + "Ġaccur": 1923, + "ety": 1924, + "Ġcaus": 1925, + "Delta": 1926, + "rapy": 1927, + "Ġprom": 1928, + "time": 1929, + "Ġintro": 1930, + "Ġmultiple": 1931, + "Ġconstant": 1932, + "pling": 1933, + "ino": 1934, + "ajor": 1935, + "ior": 1936, + "abol": 1937, + "def": 1938, + "Ġpoints": 1939, + "verse": 1940, + "name": 1941, + "ĠSe": 1942, + "itor": 1943, + "Pro": 1944, + "arm": 1945, + "Ġtiss": 1946, + "Ġfib": 1947, + "Ġgraph": 1948, + "Ġcall": 1949, + "atisf": 1950, + "Ġconduc": 1951, + "dex": 1952, + "ĠNe": 1953, + "Ġpers": 1954, + "ern": 1955, + "CR": 1956, + "angle": 1957, + "Ġfrequency": 1958, + "AP": 1959, + "Ġpresented": 1960, + "amp": 1961, + "Ġbefore": 1962, + "ords": 1963, + "Ġinput": 1964, + "ĠâĨĴ": 1965, + "Ġparticip": 1966, + "OR": 1967, + "Ġchild": 1968, + "Ġcre": 1969, + "fficient": 1970, + "Ġsepar": 1971, + "uration": 1972, + "α": 1973, + "Ġexist": 1974, + "ised": 1975, + "Ġlight": 1976, + "imal": 1977, + "****": 1978, + "ĠDNA": 1979, + "hel": 1980, + "Ġinterest": 1981, + "bf": 1982, + "ke": 1983, + "Ġcollec": 1984, + "Ġtrain": 1985, + "ai": 1986, + "ĠPl": 1987, + "Ġλ": 1988, + "ĠCo": 1989, + "Ġimage": 1990, + "Ġhyp": 1991, + "oma": 1992, + "Ġweight": 1993, + "Ġcross": 1994, + "rt": 1995, + "Ġdifference": 1996, + "Ġfeatures": 1997, + "medi": 1998, + "type": 1999, + "Ġpress": 2000, + "IC": 2001, + "Ġtherm": 2002, + "Ġstates": 2003, + "ustr": 2004, + "till": 2005, + "Ġhist": 2006, + "Ġratio": 2007, + "aging": 2008, + "ĠAll": 2009, + "Ġhel": 2010, + "bon": 2011, + "Ġbehavior": 2012, + "Ġpri": 2013, + "Ġsynt": 2014, + "ended": 2015, + "ĠInt": 2016, + "tt": 2017, + "Ġvarious": 2018, + "rect": 2019, + "Ġprec": 2020, + "Ġtimes": 2021, + "MS": 2022, + "Ġanalyz": 2023, + "Ġcare": 2024, + "mat": 2025, + "Ġalong": 2026, + "Ġpur": 2027, + "atively": 2028, + "Ġstar": 2029, + "jects": 2030, + "ii": 2031, + "istance": 2032, + "ĠThen": 2033, + "AN": 2034, + "Ġparameter": 2035, + "ulate": 2036, + "Ġevery": 2037, + "Ġsatisf": 2038, + "Ġdetermined": 2039, + "ina": 2040, + "rane": 2041, + "Ġpair": 2042, + "ool": 2043, + "Table": 2044, + "Ġthus": 2045, + "ogene": 2046, + "ĠÏĨ": 2047, + "Ġprogram": 2048, + "asc": 2049, + "Ġenvironment": 2050, + "MP": 2051, + "Ġread": 2052, + "Ġach": 2053, + "Ġpresence": 2054, + "Ġmice": 2055, + "For": 2056, + "Ġproduction": 2057, + "Ġdifferences": 2058, + "Ġprovide": 2059, + "ste": 2060, + "ames": 2061, + "ĉĠ": 2062, + "Ġ±": 2063, + "roup": 2064, + "Ġelectron": 2065, + "Ġhyper": 2066, + "bit": 2067, + "ĠRec": 2068, + "Ġvector": 2069, + "uble": 2070, + "rangle": 2071, + "Ġwr": 2072, + "wide": 2073, + "ĠâĬ": 2074, + "rack": 2075, + "ryst": 2076, + "Ġinj": 2077, + "ega": 2078, + "Ġwhe": 2079, + "psilon": 2080, + "Ġagainst": 2081, + "Ġdiagn": 2082, + "Ġhom": 2083, + "Ġachie": 2084, + "ns": 2085, + "Ġrece": 2086, + "--------": 2087, + "Ġavailable": 2088, + "inf": 2089, + "Ġsuc": 2090, + "Ġgu": 2091, + "Ġmajor": 2092, + "ĠThus": 2093, + "ware": 2094, + "Ġsupport": 2095, + "lor": 2096, + "Ġexperimental": 2097, + "ĠMo": 2098, + "Ġconcentration": 2099, + "tics": 2100, + "Ġnec": 2101, + "Ġphen": 2102, + "sq": 2103, + "Ġclos": 2104, + "sub": 2105, + "Ġknow": 2106, + "Ġformation": 2107, + "Ġdid": 2108, + "ouse": 2109, + "inary": 2110, + "ict": 2111, + "ĠCD": 2112, + "This": 2113, + "less": 2114, + "Ġnear": 2115, + "Ġimprove": 2116, + "abil": 2117, + "Ġreve": 2118, + "Ġexperiments": 2119, + "ience": 2120, + "ula": 2121, + "ored": 2122, + "Ġunc": 2123, + "__": 2124, + "Ġapplied": 2125, + "Ġreduced": 2126, + "Ġdetail": 2127, + "stand": 2128, + "Ġcho": 2129, + "omy": 2130, + "Ġcalculated": 2131, + "Ġenh": 2132, + "LES": 2133, + "itro": 2134, + "Ġrespons": 2135, + "Ġest": 2136, + "Ġmi": 2137, + "Ġcoe": 2138, + "ĠTherefore": 2139, + "ĠMore": 2140, + "bl": 2141, + "anced": 2142, + "ume": 2143, + "Ġband": 2144, + "Ġact": 2145, + "Ġeither": 2146, + "omes": 2147, + "ĠGen": 2148, + "vare": 2149, + "ET": 2150, + "reen": 2151, + "ĠPar": 2152, + "ĠSim": 2153, + "Ġidentified": 2154, + "Ġinteraction": 2155, + "Ġmade": 2156, + "Ġsource": 2157, + "tis": 2158, + "ots": 2159, + "mega": 2160, + "Ġserv": 2161, + "ms": 2162, + "alysis": 2163, + "vent": 2164, + "ense": 2165, + "gl": 2166, + "Ġlines": 2167, + "Ġappear": 2168, + "tif": 2169, + "Ġfree": 2170, + "oms": 2171, + "ining": 2172, + "eren": 2173, + "Ġchann": 2174, + "varepsilon": 2175, + "sim": 2176, + "Ġcou": 2177, + "°": 2178, + "Ġerror": 2179, + "Ġquanti": 2180, + "ĠEq": 2181, + "by": 2182, + "ĠII": 2183, + "tex": 2184, + "ĠSch": 2185, + "sqrt": 2186, + "ocus": 2187, + "Ġdev": 2188, + "quad": 2189, + "ters": 2190, + "Ġrelationship": 2191, + "oll": 2192, + "Ġgo": 2193, + "Ġwave": 2194, + "Ġleft": 2195, + "ways": 2196, + "hi": 2197, + "Ġright": 2198, + "obal": 2199, + "Ġdown": 2200, + "uk": 2201, + "Ġcoll": 2202, + "Ġmagnetic": 2203, + "Ġprog": 2204, + "dots": 2205, + "Ġstrateg": 2206, + "bs": 2207, + "unction": 2208, + "Ġenc": 2209, + "Ġclear": 2210, + "Ġcost": 2211, + "geb": 2212, + "etter": 2213, + "MILES": 2214, + "lamm": 2215, + "Ġmust": 2216, + "Ġeffective": 2217, + "Ġexc": 2218, + "Ġplas": 2219, + "Ġsuggest": 2220, + "itions": 2221, + "Ġleast": 2222, + "ying": 2223, + "lying": 2224, + "Ġlik": 2225, + "Omega": 2226, + "aking": 2227, + "Ġmaximum": 2228, + "Ġrelative": 2229, + "é": 2230, + "Ġaccording": 2231, + "ient": 2232, + "Ġway": 2233, + "Ġsem": 2234, + "atural": 2235, + "like": 2236, + "resh": 2237, + "ĠMe": 2238, + "Ps": 2239, + "ĠTrans": 2240, + "isc": 2241, + "Ġprac": 2242, + "Ġrun": 2243, + "Ġconver": 2244, + "Ġsk": 2245, + "Ġyield": 2246, + "geq": 2247, + "ably": 2248, + "Ġantib": 2249, + "izing": 2250, + "β": 2251, + "mission": 2252, + "Ġnow": 2253, + "Ġdetection": 2254, + "eloc": 2255, + "Ġget": 2256, + "ert": 2257, + "Ġvariables": 2258, + "Ġopen": 2259, + "Ġpressure": 2260, + "Ġstrain": 2261, + "ument": 2262, + "ĠFurther": 2263, + "Ġquantum": 2264, + "Ġimplement": 2265, + "Ġearly": 2266, + "Ġframe": 2267, + "Ġshort": 2268, + "Ġdrug": 2269, + "Ġrequired": 2270, + "PS": 2271, + "Ġmy": 2272, + "Ġmuch": 2273, + "Ġmem": 2274, + "CC": 2275, + "Ġquality": 2276, + "Ġproteins": 2277, + "Ġlayer": 2278, + "Ġques": 2279, + "Ġrecept": 2280, + "Ġhere": 2281, + "Ġproced": 2282, + "ured": 2283, + "Ġdeveloped": 2284, + "Ġposition": 2285, + "rum": 2286, + "Ġlat": 2287, + "Ġincreasing": 2288, + "EM": 2289, + "Ġmeasurements": 2290, + "Ġben": 2291, + "Ġisol": 2292, + "wh": 2293, + "To": 2294, + "Ġvalid": 2295, + "Ġfunctional": 2296, + "emma": 2297, + "...": 2298, + "orld": 2299, + "ries": 2300, + "Ġprobability": 2301, + "ĠNew": 2302, + "Ġmm": 2303, + "OS": 2304, + "AD": 2305, + "Ġδ": 2306, + "Ġscale": 2307, + "ĠFe": 2308, + "ĠTheorem": 2309, + "ĠQu": 2310, + "Ġcomponents": 2311, + "Ġblood": 2312, + "ĠÏĥ": 2313, + "acc": 2314, + "Ġbetter": 2315, + "Ġstep": 2316, + "Ġγ": 2317, + "Ġfac": 2318, + "aneous": 2319, + "Ġload": 2320, + "Ġmetabol": 2321, + "Ġevolution": 2322, + "son": 2323, + "ream": 2324, + "Ġeas": 2325, + "ird": 2326, + "dimensional": 2327, + "bor": 2328, + "Ġmus": 2329, + "Ġequations": 2330, + "psi": 2331, + "order": 2332, + "olar": 2333, + "Ġnumer": 2334, + "Ġkey": 2335, + "orth": 2336, + "Ġsimple": 2337, + "ift": 2338, + "cale": 2339, + "Ġindex": 2340, + "ĠâĢĵ": 2341, + "Ġconcentr": 2342, + "ges": 2343, + "Ġnegative": 2344, + "Ġveloc": 2345, + "Ġax": 2346, + "ĠEff": 2347, + "Ġfinite": 2348, + "Ġill": 2349, + "ching": 2350, + "Ġpatient": 2351, + "epsilon": 2352, + "Ġmen": 2353, + "Ġcri": 2354, + "IS": 2355, + "Cl": 2356, + "Ġconcl": 2357, + "Ġθ": 2358, + "ibility": 2359, + "Ġsymmet": 2360, + "enter": 2361, + "Ġdistance": 2362, + "Ġpolym": 2363, + "ights": 2364, + "Ġcult": 2365, + "Ġpeak": 2366, + "Ġacross": 2367, + "inition": 2368, + "Ġlet": 2369, + "Ġconstruc": 2370, + "Ġincluded": 2371, + "Ġhowever": 2372, + "Ġregions": 2373, + "Ġlearning": 2374, + "Ġevidence": 2375, + "inally": 2376, + "Ġneut": 2377, + "itation": 2378, + "Ġwhether": 2379, + "Ġoutput": 2380, + "ĠSection": 2381, + "Ġgood": 2382, + "IT": 2383, + "uation": 2384, + "Ġtypes": 2385, + "bm": 2386, + "cos": 2387, + "with": 2388, + "lim": 2389, + "otic": 2390, + "Ġstill": 2391, + "Ġdays": 2392, + "Ġstudied": 2393, + "Ġimages": 2394, + "ble": 2395, + "Ġarg": 2396, + "linear": 2397, + "Ġprocesses": 2398, + "Ġwid": 2399, + "Ġtraining": 2400, + "Ġindependent": 2401, + "plac": 2402, + "Ġresid": 2403, + "Ġsuccess": 2404, + "Ġnucle": 2405, + "GF": 2406, + "let": 2407, + "ploy": 2408, + "Ġtumor": 2409, + "Gamma": 2410, + "Ġtherefore": 2411, + "rast": 2412, + "Ġfocus": 2413, + "ash": 2414, + "Ġbelow": 2415, + "ially": 2416, + "Ġcomparison": 2417, + "Ġadj": 2418, + "Ġlike": 2419, + "Ġmolecular": 2420, + "ried": 2421, + "Ġfit": 2422, + "ĠDi": 2423, + "log": 2424, + "Ġplay": 2425, + "work": 2426, + "ections": 2427, + "Ġelectro": 2428, + "uit": 2429, + "more": 2430, + "Ġmight": 2431, + "Ġanalys": 2432, + "Ġmeans": 2433, + "Ġcorrelation": 2434, + "kn": 2435, + "Ġcontroll": 2436, + "IV": 2437, + "Ch": 2438, + "pec": 2439, + "rag": 2440, + "Ġmagn": 2441, + "Ġphysical": 2442, + "ION": 2443, + "Ġreveal": 2444, + "Ġphosph": 2445, + "Ġrates": 2446, + "Ġlarger": 2447, + "Ġstim": 2448, + "Ġsoft": 2449, + "Ġcompound": 2450, + "be": 2451, + "chi": 2452, + "ĠNo": 2453, + "Ġimpact": 2454, + "tor": 2455, + "Ġprimary": 2456, + "ocial": 2457, + "Ġapplication": 2458, + "Ġsolutions": 2459, + "duce": 2460, + "Ġcharacteristics": 2461, + "Ġelements": 2462, + "Ġview": 2463, + "Ġlater": 2464, + "uture": 2465, + "Ġfamily": 2466, + "rial": 2467, + "Ġtranscri": 2468, + "orption": 2469, + "Ġsw": 2470, + "CD": 2471, + "ED": 2472, + "Ġemb": 2473, + "Ġzero": 2474, + "ols": 2475, + "Ġlife": 2476, + "cep": 2477, + "ĠLi": 2478, + "ths": 2479, + "Ġseries": 2480, + "Ġaround": 2481, + "Ġtransition": 2482, + "ĠCor": 2483, + "ĠâĪĤ": 2484, + "Ġdatas": 2485, + "Ġher": 2486, + "ĠBy": 2487, + "AM": 2488, + "spec": 2489, + "oles": 2490, + "ography": 2491, + "tle": 2492, + "ĠCar": 2493, + "alle": 2494, + "Ġestabl": 2495, + "agement": 2496, + "Ġschem": 2497, + "ground": 2498, + "Ġfail": 2499, + "Ġexpected": 2500, + "Ġrequire": 2501, + "array": 2502, + "Ġexperiment": 2503, + "Ġelement": 2504, + "Ġneu": 2505, + "Ġgenerated": 2506, + "Ġsite": 2507, + "ĠCont": 2508, + "ĠRNA": 2509, + "eral": 2510, + "Ġcontent": 2511, + "Ġbacter": 2512, + "ler": 2513, + "Ġtransfer": 2514, + "ulf": 2515, + "rightarrow": 2516, + "any": 2517, + "ĠSince": 2518, + "induced": 2519, + "Ġreaction": 2520, + "heck": 2521, + "Ġstructures": 2522, + "Ġcount": 2523, + "Ġdetermine": 2524, + "zym": 2525, + "ĠBl": 2526, + "Ġunderstand": 2527, + "ocal": 2528, + "Ġsyn": 2529, + "Ġpoly": 2530, + "ury": 2531, + "Ġbest": 2532, + "Ġfixed": 2533, + "reng": 2534, + "Ġchemical": 2535, + "Ġtissue": 2536, + "Ġpul": 2537, + "Ġboundary": 2538, + "ising": 2539, + "Ġbro": 2540, + "atistical": 2541, + "icity": 2542, + "sk": 2543, + "ring": 2544, + "Ġlast": 2545, + "Ġchildren": 2546, + "rim": 2547, + "Ġreduction": 2548, + "Ġspin": 2549, + "Ġbody": 2550, + "operator": 2551, + "vari": 2552, + "Ġdiv": 2553, + "ymbol": 2554, + "Ġmal": 2555, + "Ġspati": 2556, + "ah": 2557, + "ĠBi": 2558, + "back": 2559, + "sy": 2560, + "Ġseen": 2561, + "ĠWith": 2562, + "ids": 2563, + "plications": 2564, + "Ġnecess": 2565, + "Ġside": 2566, + "Ġbrain": 2567, + "Ġfew": 2568, + "Ġapplications": 2569, + "utes": 2570, + "aches": 2571, + "Ġactive": 2572, + "varphi": 2573, + "term": 2574, + "Ġmom": 2575, + "iversity": 2576, + "Ġfinal": 2577, + "ledge": 2578, + "Ġdynamics": 2579, + "aving": 2580, + "erc": 2581, + "orphism": 2582, + "ones": 2583, + "off": 2584, + "pm": 2585, + "Ġaction": 2586, + "Ġnatural": 2587, + "ĠGe": 2588, + "Ġyou": 2589, + "lex": 2590, + "ĠĠĠĠĠĠ": 2591, + "stit": 2592, + "Ġgas": 2593, + "Ġmake": 2594, + "Ġinduced": 2595, + "ĠAfter": 2596, + "ĠWh": 2597, + "Ġcomponent": 2598, + "Ġinfection": 2599, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 2600, + "Ġconfir": 2601, + "igen": 2602, + "ĠSystem": 2603, + "ticle": 2604, + "Ġprovided": 2605, + "ternal": 2606, + "bers": 2607, + "OD": 2608, + "ĠInter": 2609, + "ott": 2610, + "aves": 2611, + "ĠStud": 2612, + "py": 2613, + "Ġresistance": 2614, + "ĠSur": 2615, + "atch": 2616, + "Ġdim": 2617, + "Ġinterp": 2618, + "Ġcycl": 2619, + "ont": 2620, + "iting": 2621, + "AG": 2622, + "Ġequival": 2623, + "otype": 2624, + "Ġpreviously": 2625, + "Ġadditional": 2626, + "outh": 2627, + "Ġimpl": 2628, + "Ġion": 2629, + "Ġir": 2630, + "Ġcop": 2631, + "Ġhal": 2632, + "Ġactivation": 2633, + "langle": 2634, + "Ġfull": 2635, + "SS": 2636, + "ĠOp": 2637, + "idd": 2638, + "Ġproof": 2639, + "Ġproblems": 2640, + "Ġtransform": 2641, + "Ġinteractions": 2642, + "Ġsupp": 2643, + "des": 2644, + "ĠReg": 2645, + "operatorname": 2646, + "egin": 2647, + "Ġcryst": 2648, + "Ġincreases": 2649, + "ronic": 2650, + "Ġadap": 2651, + "inant": 2652, + "Ġvelocity": 2653, + "ĠAss": 2654, + "iques": 2655, + "Ġcontinuous": 2656, + "ĠComp": 2657, + "ĠProper": 2658, + "Ġprior": 2659, + "orb": 2660, + "Ġnovel": 2661, + "Ġblock": 2662, + "Ġvolume": 2663, + "Ġregard": 2664, + "ometry": 2665, + "EC": 2666, + "Ġresulting": 2667, + "ĠOr": 2668, + "Ġcarbon": 2669, + "arent": 2670, + "Ġbinding": 2671, + "ij": 2672, + "Ġaccess": 2673, + "Ġweak": 2674, + "Ġunit": 2675, + "Ġide": 2676, + "\"\"": 2677, + "Ġcm": 2678, + "Ġcritical": 2679, + "Ġrespect": 2680, + "trans": 2681, + "Ġâī¥": 2682, + "Ġsal": 2683, + "ead": 2684, + "Ġsimulation": 2685, + "Ġcapac": 2686, + "itivity": 2687, + "Ġrecord": 2688, + "rak": 2689, + "Ġneur": 2690, + "onic": 2691, + "ople": 2692, + "Ġmg": 2693, + "Ġstreng": 2694, + "erve": 2695, + "Ġreduc": 2696, + "Ġpass": 2697, + "ordin": 2698, + "exp": 2699, + "jective": 2700, + "ensor": 2701, + "Ġparticles": 2702, + "Ġair": 2703, + "Ġlink": 2704, + "ĠÏĦ": 2705, + "Ġlist": 2706, + "cin": 2707, + "ĠOur": 2708, + "pri": 2709, + "vere": 2710, + "ibr": 2711, + "iform": 2712, + "Ġexplain": 2713, + "Ġfem": 2714, + "Ġutil": 2715, + "St": 2716, + "overline": 2717, + "Ġoften": 2718, + "ery": 2719, + "ope": 2720, + "ĠUsing": 2721, + "begin": 2722, + "Ġdifferenti": 2723, + "pers": 2724, + "self": 2725, + "izes": 2726, + "Ġconcentrations": 2727, + "IR": 2728, + "ĠSup": 2729, + "Ġbasis": 2730, + "Ġinclude": 2731, + "ĠBond": 2732, + "Ġextrac": 2733, + "ĠMethod": 2734, + "ĠData": 2735, + "ĠDef": 2736, + "wn": 2737, + "Ġnetworks": 2738, + "igned": 2739, + "âĢ¢": 2740, + "Ġexpressed": 2741, + "Ġcontrast": 2742, + "esis": 2743, + "col": 2744, + "inter": 2745, + "pid": 2746, + "Ġdri": 2747, + "Ġdefine": 2748, + "Ġinfluence": 2749, + "Ġselected": 2750, + "EL": 2751, + "Ġcontaining": 2752, + "Ġsil": 2753, + "gebra": 2754, + "reat": 2755, + "bolds": 2756, + "Ġinvestigated": 2757, + "ĠCol": 2758, + "ymmet": 2759, + "ytes": 2760, + "Ġmolec": 2761, + "Ġinvolved": 2762, + "Ġday": 2763, + "Ġchain": 2764, + "ĠMoreover": 2765, + "Ġdiag": 2766, + "Ġang": 2767, + "Ġlikely": 2768, + "Ġspectrum": 2769, + "Ġderiv": 2770, + "boldsymbol": 2771, + "Ġhelp": 2772, + "ĠAm": 2773, + "Ġtreated": 2774, + "Ġvariable": 2775, + "ellular": 2776, + "ĠDes": 2777, + "aps": 2778, + "Ġnm": 2779, + "ĠÏģ": 2780, + "ĠWhen": 2781, + "Ġhighly": 2782, + "amin": 2783, + "Ġwhat": 2784, + "related": 2785, + "Ġchrom": 2786, + "Ġsurv": 2787, + "ĠAnalysis": 2788, + "Ġsit": 2789, + "fact": 2790, + "oding": 2791, + "Ġproduct": 2792, + "Ġevents": 2793, + "ras": 2794, + "ĠPer": 2795, + "max": 2796, + "ĠAg": 2797, + "cont": 2798, + "icro": 2799, + "Ġadv": 2800, + "Ġcalled": 2801, + "Ġdegree": 2802, + "AB": 2803, + "TR": 2804, + "Ġseg": 2805, + "ĠCan": 2806, + "Ġdemonstrated": 2807, + "wise": 2808, + "Ġve": 2809, + "ĠCa": 2810, + "Ġdetected": 2811, + "co": 2812, + "Ġderived": 2813, + "Ġexhib": 2814, + "Ġglobal": 2815, + "alax": 2816, + "ulating": 2817, + "Al": 2818, + "angu": 2819, + "bo": 2820, + "Ġrecom": 2821, + "Ġfeature": 2822, + "dependent": 2823, + "Ġrot": 2824, + "vention": 2825, + "Ġremov": 2826, + "Ġwind": 2827, + "Ġaccuracy": 2828, + "size": 2829, + "Ġsumm": 2830, + "Ġmeasurement": 2831, + "Ġfields": 2832, + "wards": 2833, + "Ġliter": 2834, + "ataly": 2835, + "ĠStr": 2836, + "Ġreport": 2837, + "Ġcentral": 2838, + "Ġsqu": 2839, + "Ġtherapy": 2840, + "hest": 2841, + "Ġfeed": 2842, + "SMILES": 2843, + "ĠAN": 2844, + "Ġsites": 2845, + "â̲": 2846, + "ours": 2847, + "omal": 2848, + "Ġlip": 2849, + "Ġanalyzed": 2850, + "Ġ°": 2851, + "Ġwee": 2852, + "tem": 2853, + "Ġanother": 2854, + "iles": 2855, + "Ġcomplete": 2856, + "Ġnext": 2857, + "ĠOne": 2858, + "bi": 2859, + "rip": 2860, + "state": 2861, + "ĠModel": 2862, + "Ġfindings": 2863, + "ĠPre": 2864, + "Ġrecent": 2865, + "ascular": 2866, + "Ġestimate": 2867, + "Ġmechanisms": 2868, + "ĠResults": 2869, + "Ġparticipants": 2870, + "Ġeng": 2871, + "most": 2872, + "ometric": 2873, + "Ġequal": 2874, + "Ġrob": 2875, + "Ġpolar": 2876, + "Ġgenetic": 2877, + "Ġbo": 2878, + "Ġrest": 2879, + "ĠÏĢ": 2880, + "Ġrelation": 2881, + "Ġquestion": 2882, + "epti": 2883, + "Ġdiffic": 2884, + "ems": 2885, + "Ġfuture": 2886, + "ify": 2887, + "Ġmode": 2888, + "Ġmembrane": 2889, + "Ġheat": 2890, + "Aut": 2891, + "ding": 2892, + "Ġoxid": 2893, + "Ġconfig": 2894, + "plication": 2895, + "ĠMon": 2896, + "allel": 2897, + "ided": 2898, + "Ġdirection": 2899, + "pled": 2900, + "Ġprovides": 2901, + "Ġindicate": 2902, + "Ġsets": 2903, + "Ġtechnique": 2904, + "Ġmac": 2905, + "Ġhypot": 2906, + "Ġatten": 2907, + "Ġevent": 2908, + "Ġstage": 2909, + "Ġnode": 2910, + "Ġreference": 2911, + "Ġupper": 2912, + "Ġtechniques": 2913, + "Ġgreater": 2914, + "Ġdirectly": 2915, + "Ġareas": 2916, + "Ġdiss": 2917, + "hor": 2918, + "ĠPol": 2919, + "Ġevaluation": 2920, + "Ġpatterns": 2921, + "ĠAbstract": 2922, + "Ġvirus": 2923, + "vey": 2924, + "PC": 2925, + "Ġwomen": 2926, + "rient": 2927, + "Ġplasma": 2928, + "Ġproduced": 2929, + "Ġε": 2930, + "Ġanalyses": 2931, + "ĠSub": 2932, + "Ġsetting": 2933, + "Ġmoment": 2934, + "Ġthermal": 2935, + "Ġoptimal": 2936, + "Ġtaken": 2937, + "Ġrecogn": 2938, + "Ġvariation": 2939, + "ĠLemma": 2940, + "Ġsus": 2941, + "frak": 2942, + "ĠIL": 2943, + "Ġprocedure": 2944, + "hood": 2945, + "Ġaim": 2946, + "aries": 2947, + "mathfrak": 2948, + "Ġplant": 2949, + "brid": 2950, + "elect": 2951, + "Ġvisual": 2952, + "urs": 2953, + "cence": 2954, + "Ġfive": 2955, + "Ġspatial": 2956, + "Ġreceptor": 2957, + "Ġindicated": 2958, + "Ġess": 2959, + "Ġconsistent": 2960, + "Ġturn": 2961, + "tices": 2962, + "Ġexists": 2963, + "ectors": 2964, + "Ġenzym": 2965, + "meric": 2966, + "Ġnoise": 2967, + "Ġground": 2968, + "Ġestimated": 2969, + "eline": 2970, + "Ġchannel": 2971, + "tition": 2972, + "Ġdiscussed": 2973, + "omer": 2974, + "otes": 2975, + "Ġexact": 2976, + "ĠSec": 2977, + "Ġtake": 2978, + "Ġknowledge": 2979, + "Ġprop": 2980, + "Ġinflamm": 2981, + "Ġdouble": 2982, + "It": 2983, + "Ġcontext": 2984, + "ĠMed": 2985, + "MA": 2986, + "Ġfat": 2987, + "ams": 2988, + "data": 2989, + "ands": 2990, + "Ġcardi": 2991, + "ĠFurthermore": 2992, + "ocy": 2993, + "Ġobservations": 2994, + "apping": 2995, + "ĠInf": 2996, + "omial": 2997, + "Ġpublic": 2998, + "Ġemploy": 2999, + "Ġreason": 3000, + "ygen": 3001, + "Ġfollowed": 3002, + "Ġamount": 3003, + "Ġcertain": 3004, + "which": 3005, + "otyp": 3006, + "ĠCell": 3007, + "Ġchall": 3008, + "Ġparticle": 3009, + "ambda": 3010, + "Ġens": 3011, + "Ġpeople": 3012, + "ault": 3013, + "ĠUnd": 3014, + "ĠBe": 3015, + "umin": 3016, + "roscopy": 3017, + "MR": 3018, + "lation": 3019, + "Ġrepe": 3020, + "Ġable": 3021, + "ĠSo": 3022, + "ĠâĪŀ": 3023, + "Ġenti": 3024, + "Ġmove": 3025, + "Ġtrac": 3026, + "CO": 3027, + "Ġheter": 3028, + "Ġspeed": 3029, + "Ġefficiency": 3030, + "Ġoptical": 3031, + "Ġcombination": 3032, + "eness": 3033, + "Ġchem": 3034, + "LE": 3035, + "appa": 3036, + "Ġdecrease": 3037, + "μ": 3038, + "ped": 3039, + "note": 3040, + "ĠMulti": 3041, + "Ġaltern": 3042, + "Ġassume": 3043, + "ĠForm": 3044, + "stric": 3045, + "que": 3046, + "Ġiss": 3047, + "urrent": 3048, + "Ġprinc": 3049, + "Ġtask": 3050, + "ops": 3051, + "Ġwhereas": 3052, + "CH": 3053, + "Ġrevealed": 3054, + "Ġcannot": 3055, + "active": 3056, + "enz": 3057, + "Ġfore": 3058, + "Ġoperator": 3059, + "Ġcolum": 3060, + "atin": 3061, + "Ġoriginal": 3062, + "Ġsmaller": 3063, + "Ġmaterials": 3064, + "hydro": 3065, + "Ġcurve": 3066, + "Ġselection": 3067, + "akes": 3068, + "Ġexpos": 3069, + "ats": 3070, + "ĠÏī": 3071, + "Ġpack": 3072, + "Ġstability": 3073, + "Ġoverall": 3074, + "Ġmorph": 3075, + "Ġmetric": 3076, + "Ġol": 3077, + "Ġbar": 3078, + "ĠIN": 3079, + "IM": 3080, + "cy": 3081, + "ethyl": 3082, + "SP": 3083, + "Ġresponses": 3084, + "ancy": 3085, + "Ġlay": 3086, + "specific": 3087, + "Ġvs": 3088, + "aged": 3089, + "Ġsocial": 3090, + "Ġcut": 3091, + "IP": 3092, + "Ġlimited": 3093, + "encies": 3094, + "Ġprotoc": 3095, + "Ġcomposition": 3096, + "ĠThey": 3097, + "Ġnumbers": 3098, + "mbox": 3099, + "Ġdecreased": 3100, + "vec": 3101, + "RO": 3102, + "Authors": 3103, + "Ġthick": 3104, + "Ġcoordin": 3105, + "Ġmes": 3106, + "Ġaffect": 3107, + "Ġclose": 3108, + "Ġtransport": 3109, + "CA": 3110, + "rete": 3111, + "come": 3112, + "Ġcollected": 3113, + "ĠFrom": 3114, + "Ġcontains": 3115, + "chit": 3116, + "ĠDet": 3117, + "Ġflux": 3118, + "overy": 3119, + "eu": 3120, + "aff": 3121, + "Ġconducted": 3122, + "Ġcriter": 3123, + "Ġliterature": 3124, + "Ġmemory": 3125, + "Ġsequences": 3126, + "Ġpan": 3127, + "plicit": 3128, + "Ġtrue": 3129, + "Ġmedium": 3130, + "Ġdam": 3131, + "ire": 3132, + "cell": 3133, + "Let": 3134, + "eful": 3135, + "ĠAmeric": 3136, + "Ġnodes": 3137, + "gether": 3138, + "Ġtogether": 3139, + "TP": 3140, + "Ġrather": 3141, + "Ġauthors": 3142, + "Ġsch": 3143, + "Ġprocessing": 3144, + "Ġspectra": 3145, + "Ġevaluated": 3146, + "alk": 3147, + "Ġreduce": 3148, + "ĠHigh": 3149, + "ĠCons": 3150, + "Ġcycle": 3151, + "orn": 3152, + "iers": 3153, + "Ġpropor": 3154, + "ories": 3155, + "rate": 3156, + "Ġhost": 3157, + "ooth": 3158, + "ynt": 3159, + "Ġsources": 3160, + "Ġindividuals": 3161, + "Ġaccount": 3162, + "ĠAlthough": 3163, + "Ġcorrec": 3164, + "Ġplan": 3165, + "entially": 3166, + "Ġdistinc": 3167, + "Ġsoil": 3168, + "Ġsearch": 3169, + "Ġmanagement": 3170, + "Ġversion": 3171, + "âĢĶ": 3172, + "Ġfig": 3173, + "ĠNote": 3174, + "Ġhead": 3175, + "ditional": 3176, + "Ġbuild": 3177, + "ĠGl": 3178, + "asis": 3179, + "group": 3180, + "Ġdisplay": 3181, + "ĠUniversity": 3182, + "ootnote": 3183, + "ameter": 3184, + "minist": 3185, + "opl": 3186, + "ymph": 3187, + "Lambda": 3188, + "Ġidentify": 3189, + "ĠStere": 3190, + "ĠïĢ": 3191, + "Ġprol": 3192, + "ource": 3193, + "icial": 3194, + "Ġsimulations": 3195, + "Ġthresh": 3196, + "point": 3197, + "earch": 3198, + "elling": 3199, + "ĠAcc": 3200, + "Ġframework": 3201, + "Ġstrength": 3202, + "ĠAb": 3203, + "ticles": 3204, + "Ġcos": 3205, + "Footnote": 3206, + "ru": 3207, + "ospital": 3208, + "Ġstable": 3209, + "Ġmotion": 3210, + "Ġtested": 3211, + "Ġtests": 3212, + "aster": 3213, + "ldots": 3214, + "CL": 3215, + "inite": 3216, + "Ġspecial": 3217, + "====": 3218, + "Ġapproaches": 3219, + "ping": 3220, + "Ġconsum": 3221, + "SD": 3222, + "Ġjust": 3223, + "kappa": 3224, + "Ġthough": 3225, + "faces": 3226, + "Ġrapid": 3227, + "ensive": 3228, + "Ġnecessary": 3229, + "Ġtub": 3230, + "Ġforce": 3231, + "Ġblack": 3232, + "volution": 3233, + "ĠAtom": 3234, + "ĠHere": 3235, + "itude": 3236, + "ensions": 3237, + "ffer": 3238, + "rich": 3239, + "Ġgives": 3240, + "Ġshape": 3241, + "Ġhard": 3242, + "omp": 3243, + "Ġrepresentation": 3244, + "ling": 3245, + "ĠDec": 3246, + "Ġnumerical": 3247, + "Ġplace": 3248, + "Ġleading": 3249, + "Ġbenef": 3250, + "Ġregular": 3251, + "Ġcluster": 3252, + "Ġrelatively": 3253, + "Ġpercent": 3254, + "Ġautom": 3255, + "Ġsympt": 3256, + "ibri": 3257, + "ches": 3258, + "henyl": 3259, + "car": 3260, + "Ġillustr": 3261, + "ports": 3262, + "emic": 3263, + "Ġgive": 3264, + "Ġconven": 3265, + "lection": 3266, + "ĠĠĠĠĠĠĠĠĠĠĠĠ": 3267, + "ĠAnd": 3268, + "Ġfood": 3269, + "mic": 3270, + "ographic": 3271, + "Ġcheck": 3272, + "Ġability": 3273, + "iquid": 3274, + "Ġsubstr": 3275, + "ĠâĪĨ": 3276, + "Ġedge": 3277, + "ĠPD": 3278, + "Ġclassification": 3279, + "Ġsurvival": 3280, + "ĠCal": 3281, + "erate": 3282, + "Ġuseful": 3283, + "Ġcarried": 3284, + "Ġintensity": 3285, + "HE": 3286, + "ocenter": 3287, + "Ġpathway": 3288, + "Ġdefinition": 3289, + "Ġscheme": 3290, + "Ġsubsequ": 3291, + "ĠFirst": 3292, + "Ġconsequ": 3293, + "ĠDiff": 3294, + "Ġinhibit": 3295, + "Ġamplit": 3296, + "aser": 3297, + "ĠNetwork": 3298, + "normal": 3299, + "ĠST": 3300, + "Ġsolid": 3301, + "perim": 3302, + "comes": 3303, + "Ġcyt": 3304, + "odies": 3305, + "IF": 3306, + "radi": 3307, + "Ġmor": 3308, + "Ġcore": 3309, + "BS": 3310, + "********": 3311, + "Ġsoftware": 3312, + "ĠGu": 3313, + "ired": 3314, + "ident": 3315, + "Ġdifficult": 3316, + "use": 3317, + "Ġadded": 3318, + "ley": 3319, + "Ġcaused": 3320, + "gence": 3321, + "Ġbase": 3322, + "####": 3323, + "ogenic": 3324, + "from": 3325, + "Ġstatus": 3326, + "Ġassociation": 3327, + "ĠStereocenter": 3328, + "Ġgalax": 3329, + "NO": 3330, + "anguage": 3331, + "Ġdimension": 3332, + "ogenesis": 3333, + "Ġemission": 3334, + "Ġdeath": 3335, + "ulin": 3336, + "Ġagre": 3337, + "turb": 3338, + "nabl": 3339, + "poral": 3340, + "Ġpor": 3341, + "Ġcombined": 3342, + "Ġalgorithms": 3343, + "Cs": 3344, + "Ġsensitivity": 3345, + "Ġallows": 3346, + "Ġcapacity": 3347, + "version": 3348, + "Ġrestric": 3349, + "rome": 3350, + "Ġexposure": 3351, + "hy": 3352, + "anning": 3353, + "Ġobject": 3354, + "Ġcode": 3355, + "fl": 3356, + "roduction": 3357, + "resents": 3358, + "rup": 3359, + "Ġtext": 3360, + "ĠMat": 3361, + "Ġleads": 3362, + "Ġreson": 3363, + "Ġproducts": 3364, + "Ġwhole": 3365, + "Ġmatter": 3366, + "Phi": 3367, + "opt": 3368, + "encing": 3369, + "fficients": 3370, + "na": 3371, + "pecially": 3372, + "Ġhaving": 3373, + "ropy": 3374, + "Ġuncertain": 3375, + "enari": 3376, + "rical": 3377, + "Ġminim": 3378, + "Ġorigin": 3379, + "uper": 3380, + "ĠNon": 3381, + "Ġevaluate": 3382, + "Proof": 3383, + "cap": 3384, + "Ġsignaling": 3385, + "Ġpolymer": 3386, + "tically": 3387, + "itten": 3388, + "antit": 3389, + "Ġuser": 3390, + "level": 3391, + "Ġmeasures": 3392, + "Ġdynamic": 3393, + "Ġmonths": 3394, + "oti": 3395, + "rand": 3396, + "Ġuntil": 3397, + "Ġdenote": 3398, + "Ġnote": 3399, + "Ġmaintain": 3400, + "Ġkin": 3401, + "scill": 3402, + "Ġimaging": 3403, + "Ġpain": 3404, + "avy": 3405, + "Ġmit": 3406, + "othe": 3407, + "Ġregul": 3408, + "known": 3409, + "Ġplot": 3410, + "nabla": 3411, + "Ġfraction": 3412, + "wer": 3413, + "Ġstrategy": 3414, + "Ġgreat": 3415, + "Ġdataset": 3416, + "Ġunique": 3417, + "CM": 3418, + "Ġtw": 3419, + "han": 3420, + "ĠEu": 3421, + "andid": 3422, + "Ġbackground": 3423, + "Ġbroad": 3424, + "ilt": 3425, + "Ġimproved": 3426, + "Ġdiagnosis": 3427, + "ious": 3428, + "Ġdig": 3429, + "rem": 3430, + "era": 3431, + "Ġexcl": 3432, + "Ġmetal": 3433, + "Ġsix": 3434, + "Ġminimum": 3435, + "usions": 3436, + "ee": 3437, + "Ġcompounds": 3438, + "Ġasp": 3439, + "Ġeth": 3440, + "Ġdetect": 3441, + "ference": 3442, + "Ġη": 3443, + "Ġstatistical": 3444, + "atives": 3445, + "ris": 3446, + "Ġtheorem": 3447, + "ĠOF": 3448, + "ww": 3449, + "arily": 3450, + "ception": 3451, + "iving": 3452, + "Ġtesting": 3453, + "Ġdiagnos": 3454, + "Ġrepresents": 3455, + "Sigma": 3456, + "onical": 3457, + "Ġequivalent": 3458, + "Ġbiom": 3459, + "Ġsubst": 3460, + "raints": 3461, + "ĠRef": 3462, + "Ġscore": 3463, + "Ġdoc": 3464, + "Ġimplies": 3465, + "eter": 3466, + "Ġsynthesis": 3467, + "ilibri": 3468, + "attering": 3469, + "CS": 3470, + "alse": 3471, + "Ġneuro": 3472, + "Ġalthough": 3473, + "irus": 3474, + "methyl": 3475, + "Ġtranscription": 3476, + "ÏĢ": 3477, + "ĠMolecular": 3478, + "Ġcause": 3479, + "mut": 3480, + "ĠId": 3481, + "λ": 3482, + "add": 3483, + "Ġplac": 3484, + "Ġagg": 3485, + "ture": 3486, + "Ġlack": 3487, + "Ġprediction": 3488, + "raw": 3489, + "An": 3490, + "Ġult": 3491, + "ynomial": 3492, + "Ġimmune": 3493, + "ili": 3494, + "Ġprep": 3495, + "γ": 3496, + "class": 3497, + "Ġmach": 3498, + "ample": 3499, + "Ġresolution": 3500, + "Ġcoupling": 3501, + "seud": 3502, + "Ġindicates": 3503, + "Ġgeneration": 3504, + "Ġhar": 3505, + "Ġfund": 3506, + "scale": 3507, + "Ġeigen": 3508, + "ĠRel": 3509, + "abor": 3510, + "ĠCH": 3511, + "ext": 3512, + "amm": 3513, + "Ġcorrect": 3514, + "Ġscreen": 3515, + "Ġstructural": 3516, + "ĠpH": 3517, + "Ġrelevant": 3518, + "Ġangle": 3519, + "IG": 3520, + "Ġalgebra": 3521, + "helial": 3522, + "Ġworld": 3523, + "Ġcurves": 3524, + "ĠIntroduction": 3525, + "Ġthird": 3526, + "Ġintroduced": 3527, + "Big": 3528, + "no": 3529, + "auss": 3530, + "subset": 3531, + "Ġtransmission": 3532, + "Ġprofile": 3533, + "Ġν": 3534, + "Ġespecially": 3535, + "Ġattrib": 3536, + "uction": 3537, + "Ġcoefficients": 3538, + "Ġremains": 3539, + "Ġneigh": 3540, + "osen": 3541, + "Ġreli": 3542, + "Ġhighest": 3543, + "Ġuniform": 3544, + "Ġfar": 3545, + "chitect": 3546, + "||": 3547, + "Ġappropri": 3548, + "plex": 3549, + "ĠMass": 3550, + "ogeneous": 3551, + "ales": 3552, + "Ġrefer": 3553, + "Ġneeded": 3554, + "Ġdifferential": 3555, + "ceed": 3556, + "$$": 3557, + "ynamic": 3558, + "Ġsex": 3559, + "Ġspectral": 3560, + "char": 3561, + "PE": 3562, + "TS": 3563, + "Ġapproximately": 3564, + "value": 3565, + "Ġhalf": 3566, + "ending": 3567, + "Ġgradi": 3568, + "Ġcoefficient": 3569, + "ĠPhys": 3570, + "Ġconcer": 3571, + "Ġlabel": 3572, + "iral": 3573, + "Ġcharge": 3574, + "Ġoxygen": 3575, + "Ġdevi": 3576, + "Ġinternal": 3577, + "Ġexpans": 3578, + "load": 3579, + "ĠSm": 3580, + "rang": 3581, + "Con": 3582, + "ĠNa": 3583, + "Ġke": 3584, + "Ġdiab": 3585, + "ached": 3586, + "Ġlocation": 3587, + "Ġvolt": 3588, + "ĠDisc": 3589, + "---": 3590, + "ocytes": 3591, + "oretical": 3592, + "Ġgain": 3593, + "Ġmedi": 3594, + "ympt": 3595, + "oted": 3596, + "ĠVal": 3597, + "Ġcommunity": 3598, + "plementary": 3599, + "Ġtree": 3600, + "ĠTwo": 3601, + "Ġwhose": 3602, + "Ġdone": 3603, + "amine": 3604, + "Ġbiological": 3605, + "inks": 3606, + "Ġalmost": 3607, + "Ġslight": 3608, + "Ġrepro": 3609, + "ģĦ": 3610, + "Ġtherap": 3611, + "ocation": 3612, + "Ġgly": 3613, + "ĠEqu": 3614, + "Ġcolor": 3615, + "Ġnam": 3616, + "section": 3617, + "ĠEm": 3618, + "ready": 3619, + "Hz": 3620, + "PD": 3621, + "function": 3622, + "change": 3623, + "Ġprincip": 3624, + "Ġbecome": 3625, + "ĠâĢĺ": 3626, + "Ġcour": 3627, + "Ġlocated": 3628, + "Ġrang": 3629, + "inity": 3630, + "Ġinterval": 3631, + "gin": 3632, + "Ġinvestigate": 3633, + "free": 3634, + "Ġvitro": 3635, + "Ġsubset": 3636, + "Ġmov": 3637, + "Ġprove": 3638, + "Ġliver": 3639, + "ategor": 3640, + "etes": 3641, + "Ġlymph": 3642, + "dom": 3643, + "ĠElect": 3644, + "Ġserum": 3645, + "Ġscenari": 3646, + "ends": 3647, + "ĠFinally": 3648, + "Ġfilter": 3649, + "IL": 3650, + "Ġabund": 3651, + "mentation": 3652, + "imals": 3653, + "num": 3654, + "enced": 3655, + "Ġproperty": 3656, + "matrix": 3657, + "ĠCompar": 3658, + "Ġland": 3659, + "ĠChar": 3660, + "ressive": 3661, + "ulus": 3662, + "Ġbone": 3663, + "Ex": 3664, + "Ġradiation": 3665, + "Ġsuggested": 3666, + "ĠComput": 3667, + "Ġthreshold": 3668, + "ĠAD": 3669, + "Ġhor": 3670, + "Ġinduc": 3671, + "Ġapproximation": 3672, + "Ġadminist": 3673, + "Ġord": 3674, + "Ġlung": 3675, + "Ġreceived": 3676, + "Ġnorm": 3677, + "Ġestimates": 3678, + "Ġlaw": 3679, + "Ġoutcomes": 3680, + "ĠPr": 3681, + "Ġdepth": 3682, + "Ġelse": 3683, + "Ġcontribution": 3684, + "hetic": 3685, + "Ġconserv": 3686, + "Ġupon": 3687, + "Ġdeep": 3688, + "MD": 3689, + "Ġmel": 3690, + "Ġfilm": 3691, + "ilibrium": 3692, + "Ġoscill": 3693, + "olved": 3694, + "Ġbreast": 3695, + "CP": 3696, + "ĠDist": 3697, + "rices": 3698, + "inated": 3699, + "Ġoptimization": 3700, + "Ġpredicted": 3701, + "sf": 3702, + "dim": 3703, + "ĠSN": 3704, + "Ġavoid": 3705, + "Ġneural": 3706, + "Ġwa": 3707, + "rope": 3708, + "Ġdistributions": 3709, + "oxid": 3710, + "Ġsmooth": 3711, + "path": 3712, + "Ġfluid": 3713, + "Ġsaf": 3714, + "Ġchoice": 3715, + "AA": 3716, + "Ġmolecules": 3717, + "US": 3718, + "Ġalways": 3719, + "ivo": 3720, + "Ġregression": 3721, + "Ġsuccessful": 3722, + "Ġwall": 3723, + "oung": 3724, + "Ġactivities": 3725, + "Ġdependence": 3726, + "Ġrequires": 3727, + "Ġplane": 3728, + "Ġdesigned": 3729, + "PI": 3730, + "down": 3731, + "Ġpopulations": 3732, + "cor": 3733, + "mediate": 3734, + "Ġdose": 3735, + "Ġbond": 3736, + "Co": 3737, + "ĠMan": 3738, + "Ġdiagram": 3739, + "gs": 3740, + "Ġtool": 3741, + "Ġisolated": 3742, + "Ġversus": 3743, + "ney": 3744, + "Ġemerg": 3745, + "ĠAut": 3746, + "aim": 3747, + "field": 3748, + "Ġexamined": 3749, + "Ġsat": 3750, + "SM": 3751, + "ĠSpec": 3752, + "Ġparallel": 3753, + "isation": 3754, + "Ġdistinct": 3755, + "Ġpredict": 3756, + "Ġfer": 3757, + "Ġunderstanding": 3758, + "ĠSimilar": 3759, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 3760, + "udes": 3761, + "Ġorient": 3762, + "hic": 3763, + "uz": 3764, + "Ġmodified": 3765, + "Ġâμ": 3766, + "FF": 3767, + "There": 3768, + "Ġtrial": 3769, + "xy": 3770, + "gery": 3771, + "Ġalready": 3772, + "define": 3773, + "ming": 3774, + "ĠSD": 3775, + "Ġmonitor": 3776, + "Ġpsy": 3777, + "Ġbecomes": 3778, + "istry": 3779, + "ĠÎĵ": 3780, + "Ġhum": 3781, + "rier": 3782, + "ession": 3783, + "Ġhistory": 3784, + "ö": 3785, + "Ġξ": 3786, + "Ġestablished": 3787, + "Ġachieved": 3788, + "estern": 3789, + "ÏĨ": 3790, + "ĠHence": 3791, + "Ġassessment": 3792, + "otor": 3793, + "Ġdescribe": 3794, + "ochond": 3795, + "ylation": 3796, + "sts": 3797, + "space": 3798, + "Ġdiseases": 3799, + "jection": 3800, + "Ġslow": 3801, + "Ġnonlinear": 3802, + "ply": 3803, + "ml": 3804, + "Ġembed": 3805, + "comp": 3806, + "Ġefficient": 3807, + "Ġoperation": 3808, + "Ġcontact": 3809, + "oz": 3810, + "Ġinvari": 3811, + "Ġcenter": 3812, + "Ġconc": 3813, + "widetilde": 3814, + "Ġbeam": 3815, + "Ġclosed": 3816, + "ĠMethods": 3817, + "Ġchronic": 3818, + "aling": 3819, + "Ġsevere": 3820, + "Ġforms": 3821, + "ilit": 3822, + "side": 3823, + "pen": 3824, + "Ġbran": 3825, + "oud": 3826, + "tality": 3827, + "Ġmaps": 3828, + "acts": 3829, + "OL": 3830, + "PR": 3831, + "ĠÍ": 3832, + "sl": 3833, + "Ġinstance": 3834, + "ully": 3835, + "Ġestimation": 3836, + "Ġplate": 3837, + "Ġdevice": 3838, + "ĠIII": 3839, + "sin": 3840, + "Ġplants": 3841, + "ittle": 3842, + "Ġproduce": 3843, + "Ġhence": 3844, + "Ġnature": 3845, + "Ġrelease": 3846, + "ĠMin": 3847, + "rict": 3848, + "Ġconnected": 3849, + "ottom": 3850, + "ellar": 3851, + "Ġformed": 3852, + "Ġmob": 3853, + "Ġcomputed": 3854, + "ĠRE": 3855, + "Ġpolynomial": 3856, + "Ġliquid": 3857, + "gn": 3858, + "Ġassay": 3859, + "Ġmanif": 3860, + "ĠSi": 3861, + "rence": 3862, + "Ġaxis": 3863, + "VID": 3864, + "Ġsignals": 3865, + "θ": 3866, + "tok": 3867, + "ds": 3868, + "Ġrats": 3869, + "Ġtor": 3870, + "olecular": 3871, + "ched": 3872, + "Ġdescri": 3873, + "Ġexpon": 3874, + "Ġperturb": 3875, + "Ġgluc": 3876, + "Ġcolumn": 3877, + "UL": 3878, + "Ġmainly": 3879, + "Ġmul": 3880, + "ider": 3881, + "ĠCR": 3882, + "Ġcataly": 3883, + "Ġlaser": 3884, + "tioned": 3885, + "den": 3886, + "Ġsuggests": 3887, + "fig": 3888, + "Ġpropag": 3889, + "org": 3890, + "rep": 3891, + "Ġcharacterized": 3892, + "ologies": 3893, + "Ġaccum": 3894, + "Ġvary": 3895, + "Ġcontrolled": 3896, + "Ġupd": 3897, + "ĠBr": 3898, + "Ġentire": 3899, + "Ġ@": 3900, + "âģĦ": 3901, + "ĠÌ": 3902, + "Ġdatab": 3903, + "ano": 3904, + "amil": 3905, + "Ġadjust": 3906, + "ye": 3907, + "pression": 3908, + "erences": 3909, + "Ġessential": 3910, + "ĠHydro": 3911, + "ĠTr": 3912, + "Ġappropriate": 3913, + "Ġformula": 3914, + "Ġlattice": 3915, + "Ġacute": 3916, + "Ġusually": 3917, + "itable": 3918, + "Ġmar": 3919, + "Ġμm": 3920, + "ĠUSA": 3921, + "Ġincub": 3922, + "ocks": 3923, + "Ġpepti": 3924, + "iddle": 3925, + "Ġdecom": 3926, + "Ġdamage": 3927, + "Ġgenome": 3928, + "Ġmouse": 3929, + "circ": 3930, + "Ġlayers": 3931, + "Ġtrack": 3932, + "Ġtox": 3933, + "Ġreplac": 3934, + "Ġadvant": 3935, + "izon": 3936, + "Ġrecorded": 3937, + "Ġstart": 3938, + "Ġrank": 3939, + "ser": 3940, + "ĠGene": 3941, + "aussian": 3942, + "ingu": 3943, + "Ġconstraints": 3944, + "flow": 3945, + "Ġmig": 3946, + "PL": 3947, + "Ġincor": 3948, + "appro": 3949, + "Ġfast": 3950, + "Ġmuscle": 3951, + "Ġhome": 3952, + "eq": 3953, + "ĠÏĪ": 3954, + "Ġstrongly": 3955, + "ĠEurope": 3956, + "Ġsubjects": 3957, + "Ġobjects": 3958, + "test": 3959, + "tered": 3960, + "ĠWhile": 3961, + "Ġsymmetry": 3962, + "Ġquantif": 3963, + "``": 3964, + "Ġbreak": 3965, + "ĠExperim": 3966, + "Ġmixt": 3967, + "<<": 3968, + "ĠChina": 3969, + "ĠIdentif": 3970, + "Ġaffected": 3971, + "Ġsecondary": 3972, + "Ġinequ": 3973, + "incl": 3974, + "EG": 3975, + "FT": 3976, + "Ġfailure": 3977, + "ectiv": 3978, + "Ġkm": 3979, + "Ġsampling": 3980, + "Ġexpansion": 3981, + "Ġpractice": 3982, + "uations": 3983, + "ognitive": 3984, + "Ġdiet": 3985, + "Ġtemperatures": 3986, + "Ġcontrols": 3987, + "Ġchosen": 3988, + "Ġgenerally": 3989, + "ancer": 3990, + "Ġdegrad": 3991, + "uli": 3992, + "sm": 3993, + "otherapy": 3994, + "Ġtowards": 3995, + "ĠProperties": 3996, + "Ġclusters": 3997, + "Ġdelay": 3998, + "Ġhep": 3999, + "PA": 4000, + "ĠStudy": 4001, + "antitative": 4002, + "Ġclassical": 4003, + "ĠZh": 4004, + "ĠΩ": 4005, + "ĠBo": 4006, + "Ġseed": 4007, + "ĠStruct": 4008, + "Ġtrend": 4009, + "iological": 4010, + "Ġconfirmed": 4011, + "Ġdistributed": 4012, + "bial": 4013, + "Ġname": 4014, + "CN": 4015, + "valence": 4016, + "erior": 4017, + "iven": 4018, + "ned": 4019, + "Ġbehaviour": 4020, + "asks": 4021, + "gra": 4022, + "mark": 4023, + "Ġerrors": 4024, + "ĠRep": 4025, + "light": 4026, + "cript": 4027, + "If": 4028, + "Ġcandid": 4029, + "Ġdepends": 4030, + "ĠNational": 4031, + "Ġholds": 4032, + "Ġprotocol": 4033, + "ĠUnited": 4034, + "Ġinterface": 4035, + "Ġexpect": 4036, + "Ġïģ": 4037, + "ĠHIV": 4038, + "Ġroot": 4039, + "Ġscattering": 4040, + "words": 4041, + "Ġobservation": 4042, + "otop": 4043, + "Ġoccurs": 4044, + "ources": 4045, + "pite": 4046, + "ĠSte": 4047, + "Ġorth": 4048, + "Ġstain": 4049, + "Ġsteps": 4050, + "Ġcompare": 4051, + "Ġbasic": 4052, + "Ġinhibition": 4053, + "Ġsymptoms": 4054, + "ĠHealth": 4055, + "Ġpublished": 4056, + "fold": 4057, + "Ġtun": 4058, + "Ġvivo": 4059, + "Ġreconstr": 4060, + "ĠmRNA": 4061, + "icy": 4062, + "Ġhybrid": 4063, + "yr": 4064, + "Ġmixed": 4065, + "vis": 4066, + "ChI": 4067, + "Ġmedical": 4068, + "Ġfrag": 4069, + "Ġanimals": 4070, + "Ġimportance": 4071, + "Ġengine": 4072, + "ĠCT": 4073, + "Ġpairs": 4074, + "Ġbal": 4075, + "ĠEar": 4076, + "hers": 4077, + "Ġsynd": 4078, + "Ġarchitect": 4079, + "Ġidentification": 4080, + "Ġstrategies": 4081, + "Ġregulation": 4082, + "ĠLa": 4083, + "ror": 4084, + "Ġfluores": 4085, + "urity": 4086, + "Ġconcept": 4087, + "Ġattention": 4088, + "Ġtransformation": 4089, + "ucle": 4090, + "ĠResearch": 4091, + "Ġsimpl": 4092, + "Ġculture": 4093, + "aring": 4094, + "ifically": 4095, + "pir": 4096, + "ze": 4097, + "PT": 4098, + "mosp": 4099, + "Ġswit": 4100, + "Ġnor": 4101, + "Ġenhance": 4102, + "Ġenvironmental": 4103, + "rary": 4104, + "ĠMicro": 4105, + "Ġwide": 4106, + "opath": 4107, + "auge": 4108, + "zeta": 4109, + "Ġste": 4110, + "ĠEl": 4111, + "Ġwords": 4112, + "Ġnuclear": 4113, + "Ġlanguage": 4114, + "Ġdetails": 4115, + "opar": 4116, + "ĠRed": 4117, + "water": 4118, + "Ġcategor": 4119, + "Ġfile": 4120, + "Ġcover": 4121, + "Ġachieve": 4122, + "á": 4123, + "umm": 4124, + "Ġlig": 4125, + "Ġsurvey": 4126, + "Ġextended": 4127, + "lab": 4128, + "ĠInc": 4129, + "Ġdispers": 4130, + "Ġrecomm": 4131, + "ĠBased": 4132, + "Ġabsence": 4133, + "Ġconstruction": 4134, + "Ġpoor": 4135, + "Ġvoltage": 4136, + "Ġcellular": 4137, + "Ġmortality": 4138, + "Ġshowing": 4139, + "Ġprolif": 4140, + "mp": 4141, + "Ġneurons": 4142, + "Ġsupported": 4143, + "Ġprevent": 4144, + "eli": 4145, + "oxy": 4146, + "ica": 4147, + "Ġfully": 4148, + "Ġenough": 4149, + "otimes": 4150, + "ĠMR": 4151, + "Ġbul": 4152, + "Ġphenomen": 4153, + "FA": 4154, + "Ġdecision": 4155, + "Ġdual": 4156, + "Ġdecay": 4157, + "Ġown": 4158, + "Ġuses": 4159, + "Ġchalleng": 4160, + "Ġaddress": 4161, + "OC": 4162, + "tivation": 4163, + "Ġmill": 4164, + "Ġmodes": 4165, + "atus": 4166, + "iction": 4167, + "Ġabsorption": 4168, + "Ġepit": 4169, + "Ġconstra": 4170, + "Ġagreement": 4171, + "ĠAf": 4172, + "Ġbias": 4173, + "uded": 4174, + "Ġparts": 4175, + "Ġvan": 4176, + "Ġcolon": 4177, + "Ġexternal": 4178, + "Ġtheoretical": 4179, + "asi": 4180, + "Ġles": 4181, + "abilities": 4182, + "LA": 4183, + "ttps": 4184, + "Ġinstead": 4185, + "Ġmembers": 4186, + "++": 4187, + "Ġrecently": 4188, + "Ġprepared": 4189, + "Ġarticle": 4190, + "day": 4191, + "Ġextract": 4192, + "Ġâİ": 4193, + "Ġpathways": 4194, + "ÏĦ": 4195, + "mid": 4196, + "orage": 4197, + "Ġcommunication": 4198, + "Ġaccel": 4199, + "Ġunits": 4200, + "itis": 4201, + "ynthesis": 4202, + "Ġamplitude": 4203, + "rie": 4204, + "ultaneous": 4205, + "ĠLear": 4206, + "ecause": 4207, + "do": 4208, + "eff": 4209, + "Ġexplicit": 4210, + "Ġcriteria": 4211, + "bre": 4212, + "Ġexec": 4213, + "Ġmechanical": 4214, + "eros": 4215, + "ĠConcl": 4216, + "ĠExt": 4217, + "Ġclasses": 4218, + "Ġlonger": 4219, + "Ġcalculations": 4220, + "eutic": 4221, + "ociated": 4222, + "ardi": 4223, + "Ġcourse": 4224, + "Ġpartial": 4225, + "Ġsensor": 4226, + "Ïĥ": 4227, + "Ġoperators": 4228, + "ĠAmerican": 4229, + "ĠmM": 4230, + "Ġvacc": 4231, + "occ": 4232, + "icon": 4233, + "Ġoutcome": 4234, + "Ġanalog": 4235, + "Ġthickness": 4236, + "Ġreach": 4237, + "Ġassumed": 4238, + "ender": 4239, + "Ġmale": 4240, + "SE": 4241, + "Ġintra": 4242, + "Ġimplementation": 4243, + "emia": 4244, + "Ġenhanced": 4245, + "bility": 4246, + "Ġeasily": 4247, + "ump": 4248, + "Ġcarcin": 4249, + "osa": 4250, + "Ġcorresponds": 4251, + "neg": 4252, + "Ġmagnitude": 4253, + "const": 4254, + "Ġlatter": 4255, + "Ġrepresented": 4256, + "Ġsed": 4257, + "Ġparticularly": 4258, + "Ġwritten": 4259, + "part": 4260, + "Ġoil": 4261, + "berg": 4262, + "ĠBar": 4263, + "Ġdys": 4264, + "ĠSome": 4265, + "ĠMar": 4266, + "Ġalternative": 4267, + "ĠGerm": 4268, + "Ġgenerate": 4269, + "Ġconstruct": 4270, + "ians": 4271, + "stream": 4272, + "Ġec": 4273, + "ochemical": 4274, + "ibration": 4275, + "operative": 4276, + "ister": 4277, + "Ġrobust": 4278, + "tre": 4279, + "Ġmodeling": 4280, + "oring": 4281, + "ese": 4282, + "ded": 4283, + "ideo": 4284, + "Ġhydrogen": 4285, + "uments": 4286, + "Ġdemonstrate": 4287, + "Ġcorrelated": 4288, + "Ġsystematic": 4289, + "Ġsurgery": 4290, + "Ġindicating": 4291, + "Ġhypothesis": 4292, + "year": 4293, + "mitted": 4294, + "Ġstars": 4295, + "Ġprofiles": 4296, + "Ġconsists": 4297, + "tri": 4298, + "Ġdependent": 4299, + "ishing": 4300, + "top": 4301, + "Ġheart": 4302, + "atically": 4303, + "Ġinjury": 4304, + "Ġquad": 4305, + "Ġweeks": 4306, + "uting": 4307, + "ĠTe": 4308, + "Ġidenti": 4309, + "Ġgradient": 4310, + "Ġcalculation": 4311, + "Ġur": 4312, + "RT": 4313, + "zation": 4314, + "Ġeduc": 4315, + "ening": 4316, + "PP": 4317, + "zed": 4318, + "ush": 4319, + "Ġcharacteristic": 4320, + "Ġstrains": 4321, + "eth": 4322, + "Ġdivers": 4323, + "âĪĪ": 4324, + "oids": 4325, + "olic": 4326, + "Ġinterpret": 4327, + "Key": 4328, + "Ġattack": 4329, + "pective": 4330, + "Ġlabor": 4331, + "Ġmetast": 4332, + "NF": 4333, + "Ġtissues": 4334, + "Ġradius": 4335, + "ĠEach": 4336, + "Ġcat": 4337, + "Ġdon": 4338, + "Ġelev": 4339, + "Ġassemb": 4340, + "rons": 4341, + "Ġarbit": 4342, + "Ġpanel": 4343, + "Ġgrid": 4344, + "Ġtable": 4345, + "roscopic": 4346, + "Ġcle": 4347, + "ĠIntern": 4348, + "obacter": 4349, + "Ġassumption": 4350, + "ĠCOVID": 4351, + "Ġbounded": 4352, + "Ġothers": 4353, + "Ġschool": 4354, + "Ġhospital": 4355, + "lected": 4356, + "ĠCu": 4357, + "ÃĹ": 4358, + "Ġcomplet": 4359, + "Ġwidth": 4360, + "Ġlinks": 4361, + "po": 4362, + "ollow": 4363, + "Ġnut": 4364, + "Ġappears": 4365, + "rown": 4366, + "aro": 4367, + "Ġusers": 4368, + "Ġclim": 4369, + "Ġslightly": 4370, + "Ġblue": 4371, + "rab": 4372, + "ĠSer": 4373, + "Ġfigure": 4374, + "ĠRad": 4375, + "Ġelectric": 4376, + "mm": 4377, + "ochastic": 4378, + "rief": 4379, + "Ġcollection": 4380, + "Ġstem": 4381, + "Ġgover": 4382, + "Ġbur": 4383, + "Ġtypical": 4384, + "sup": 4385, + "Ġaggreg": 4386, + "raz": 4387, + "ĉĉĉ": 4388, + "Ġstation": 4389, + "Ġarter": 4390, + "ively": 4391, + "itrogen": 4392, + "Ġconstit": 4393, + "empt": 4394, + "ĠEffect": 4395, + "Ġdescription": 4396, + "Ġscores": 4397, + "Ġmethyl": 4398, + "ĠOb": 4399, + "ĠStates": 4400, + "Ġsplit": 4401, + "ĠVari": 4402, + "ĠWang": 4403, + "Ġcere": 4404, + "ĠFran": 4405, + "Ġneeds": 4406, + "ĠFour": 4407, + "Ġproject": 4408, + "Ġdevices": 4409, + "Ġintegral": 4410, + "ĠEs": 4411, + "ymmetric": 4412, + "Ġmess": 4413, + "Ġplays": 4414, + "ĠLearning": 4415, + "Ġoverl": 4416, + "Here": 4417, + "ignment": 4418, + "Ġdeliver": 4419, + "apan": 4420, + "CE": 4421, + "Ġgauge": 4422, + "ĠJoh": 4423, + "----------------": 4424, + "Ġunderlying": 4425, + "Ġthin": 4426, + "Ġassessed": 4427, + "Ġdiffusion": 4428, + "Ġheight": 4429, + "ĠSw": 4430, + "Ġdark": 4431, + "print": 4432, + "range": 4433, + "ĠCI": 4434, + "ises": 4435, + "lier": 4436, + "rant": 4437, + "omorphism": 4438, + "Ġcompact": 4439, + "ips": 4440, + "ĠName": 4441, + "Ġtechnology": 4442, + "agen": 4443, + "Ġconfiguration": 4444, + "Ġduration": 4445, + "ĠClass": 4446, + "Ġput": 4447, + "Ġmaking": 4448, + "Ġasympt": 4449, + "aid": 4450, + "Ġcoh": 4451, + "Ġcomplexity": 4452, + "Ġsections": 4453, + "ĠMD": 4454, + "ĠĠĠĠĠĠĠĠĠ": 4455, + "Ġrad": 4456, + "Ġsubstrate": 4457, + "dd": 4458, + "Ġann": 4459, + "Ġorganic": 4460, + "Ġtaking": 4461, + "Ġincludes": 4462, + "Ġkine": 4463, + "ares": 4464, + "Ġrow": 4465, + "ategory": 4466, + "Ġmitochond": 4467, + "UT": 4468, + "Ġsyndrome": 4469, + "ĠProb": 4470, + "retion": 4471, + "Ġfluct": 4472, + "ĠDis": 4473, + "Ġtransl": 4474, + "plas": 4475, + "Ġpsych": 4476, + "Ġsurfaces": 4477, + "Ġdetailed": 4478, + "amilton": 4479, + "Ġhold": 4480, + "ĠâĬĹ": 4481, + "ĠCN": 4482, + "Ġdil": 4483, + "ĠOver": 4484, + "atform": 4485, + "Ġvertical": 4486, + "Ġcomputation": 4487, + "Ġpure": 4488, + "Ġmakes": 4489, + "Ġexisting": 4490, + "Ġexamples": 4491, + "SO": 4492, + "orders": 4493, + "Ġmix": 4494, + "Ġincorpor": 4495, + "Ġrequ": 4496, + "antic": 4497, + "DNA": 4498, + "δ": 4499, + "Ġcloud": 4500, + "ĠTechn": 4501, + "Ġïĥ": 4502, + "ements": 4503, + "Ġbaseline": 4504, + "stein": 4505, + "Ġbelong": 4506, + "Ġtrials": 4507, + "Ġhorizon": 4508, + "Ġphosphor": 4509, + "Ġans": 4510, + "dix": 4511, + "roid": 4512, + "Ġapply": 4513, + "ued": 4514, + "ernel": 4515, + "Ġfemale": 4516, + "icacy": 4517, + "Ġvectors": 4518, + "Ġmatrices": 4519, + "atric": 4520, + "ĠMc": 4521, + "Ġpy": 4522, + "Ġchlor": 4523, + "len": 4524, + "Ġclearly": 4525, + "static": 4526, + "ref": 4527, + "ĠSouth": 4528, + "Ġmedia": 4529, + "ĠShe": 4530, + "ĠBay": 4531, + "Ġagents": 4532, + "By": 4533, + "Ġdifferentiation": 4534, + "istant": 4535, + "orphic": 4536, + "Ġvariety": 4537, + "Ġservice": 4538, + "Ġmapping": 4539, + "velength": 4540, + "Ġchannels": 4541, + "Ġcompute": 4542, + "Ġstream": 4543, + "uls": 4544, + "amide": 4545, + "oking": 4546, + "vit": 4547, + "Ġyields": 4548, + "omb": 4549, + "ĠGaussian": 4550, + "Ġpen": 4551, + "une": 4552, + "Ġexperience": 4553, + "band": 4554, + "ĠDo": 4555, + "mathsf": 4556, + "Ġallowed": 4557, + "Ar": 4558, + "RA": 4559, + "Ġbacterial": 4560, + "Ġmiss": 4561, + "Ġbacteria": 4562, + "Ġmomentum": 4563, + "Ġhours": 4564, + "uck": 4565, + "ĠProposition": 4566, + "bert": 4567, + "otrop": 4568, + "Ġvariance": 4569, + "Ġtrig": 4570, + "Ġshift": 4571, + "Ġequilibrium": 4572, + "bu": 4573, + "ING": 4574, + "Ġwhite": 4575, + "Ġkind": 4576, + "Ġjoint": 4577, + "Ġtemporal": 4578, + "ĠIV": 4579, + "ĠAfric": 4580, + "Ġsubject": 4581, + "ĠPo": 4582, + "head": 4583, + "idel": 4584, + "Ġantibody": 4585, + "ĠEffects": 4586, + "Ġspe": 4587, + "Ġsufficient": 4588, + "jected": 4589, + "rees": 4590, + "ĠTop": 4591, + "Ġmutations": 4592, + "isions": 4593, + "BC": 4594, + "Ġinduction": 4595, + "Ġinteresting": 4596, + "ella": 4597, + "can": 4598, + "Ġsusp": 4599, + "ĠGroup": 4600, + "Ġextracted": 4601, + "istically": 4602, + "coh": 4603, + "map": 4604, + "Ġaccurate": 4605, + "Ġtoo": 4606, + "Ġdimensions": 4607, + "tegr": 4608, + "Ġgreen": 4609, + "ĠRo": 4610, + "Ġwild": 4611, + "Ġloop": 4612, + "Ġmeta": 4613, + "Ġsubstit": 4614, + "osome": 4615, + "Ġsuggesting": 4616, + "Ġspecim": 4617, + "amental": 4618, + "iment": 4619, + "Ġij": 4620, + "Ġclaim": 4621, + "Ġauthor": 4622, + "Ġfilms": 4623, + "Ġcounter": 4624, + "Ġconventional": 4625, + "rin": 4626, + "otypes": 4627, + "Ġpast": 4628, + "Since": 4629, + "mediated": 4630, + "reatment": 4631, + "Ġextension": 4632, + "Ġbio": 4633, + "Ġsent": 4634, + "hal": 4635, + "Ġobjective": 4636, + "Ġarray": 4637, + "Ġsuitable": 4638, + "ĠBut": 4639, + "ĠHuman": 4640, + "organ": 4641, + "but": 4642, + "model": 4643, + "SI": 4644, + "Ġhealthy": 4645, + "Ġvac": 4646, + "Ġlate": 4647, + "Ġring": 4648, + "Ġlittle": 4649, + "MT": 4650, + "Ġsquare": 4651, + "Ġgeometry": 4652, + "ĠTHE": 4653, + "ĠSing": 4654, + "jug": 4655, + "Ġstudents": 4656, + ",,": 4657, + "Ġadult": 4658, + "Ġcharacterization": 4659, + "Ġatmosp": 4660, + "Ġmonitoring": 4661, + "ani": 4662, + "net": 4663, + "ĠPa": 4664, + "optosis": 4665, + "Ġcontin": 4666, + "ĠSol": 4667, + "Ġdatabase": 4668, + "import": 4669, + "mann": 4670, + "ĠProcess": 4671, + "ĠChen": 4672, + "Ġgap": 4673, + "Ġenzyme": 4674, + "OT": 4675, + "Ġsimultaneous": 4676, + "Ġexistence": 4677, + "BP": 4678, + "ĠJapan": 4679, + "ounts": 4680, + "Ġturb": 4681, + "Ġspaces": 4682, + "ĠWeight": 4683, + "ophil": 4684, + "Ġast": 4685, + "Ġwrite": 4686, + "Ġdiabetes": 4687, + "ĠCA": 4688, + "Ġneutral": 4689, + "Ġvariations": 4690, + "axon": 4691, + "Ġbegin": 4692, + "under": 4693, + "Ġextraction": 4694, + "ĠPati": 4695, + "Ġfron": 4696, + "efined": 4697, + "Ġacids": 4698, + "Ġservices": 4699, + "Ġsense": 4700, + "Ġagent": 4701, + "hens": 4702, + "electric": 4703, + "values": 4704, + "Ġimprovement": 4705, + "herent": 4706, + "actic": 4707, + "Ġacet": 4708, + "cdots": 4709, + "Ġamino": 4710, + "Ġroom": 4711, + "Ġexpress": 4712, + "Ġexcept": 4713, + "Ġold": 4714, + "plant": 4715, + "cepti": 4716, + "ĠPCR": 4717, + "ĠER": 4718, + "ĠBoth": 4719, + "vex": 4720, + "Ġadults": 4721, + "Ġpseud": 4722, + "Ġalle": 4723, + "Ġworks": 4724, + "Ġconsumption": 4725, + "ipher": 4726, + "cm": 4727, + "cast": 4728, + "Ġnanopar": 4729, + "Ïī": 4730, + "Ġecon": 4731, + "ynamics": 4732, + "Ġalter": 4733, + "Ġskin": 4734, + "Ġdiameter": 4735, + "GC": 4736, + "ĠSign": 4737, + "vial": 4738, + "Ġglucose": 4739, + "ĠNorth": 4740, + "otox": 4741, + "Ġprote": 4742, + "dx": 4743, + "ĠCr": 4744, + "Ġfract": 4745, + "Ġinside": 4746, + "Ġstatic": 4747, + "wid": 4748, + "Ġstorage": 4749, + "ĠAL": 4750, + "ĠMark": 4751, + "ĠAT": 4752, + "Ġsensitive": 4753, + "Ġads": 4754, + "Ġedges": 4755, + "ana": 4756, + "Re": 4757, + "Ġsummar": 4758, + "ĠAND": 4759, + "Ġremaining": 4760, + "ditionally": 4761, + "Ġmid": 4762, + "ĠTheory": 4763, + "MC": 4764, + "Ġflex": 4765, + "oly": 4766, + "Ġdegradation": 4767, + "Ġintr": 4768, + "ota": 4769, + "isms": 4770, + "Ġampl": 4771, + "ĠAre": 4772, + "Ġworking": 4773, + "Ġdiversity": 4774, + "Ġtensor": 4775, + "Ġbinary": 4776, + "\"\"\"": 4777, + "vals": 4778, + "Ġhem": 4779, + "ML": 4780, + "Ġμg": 4781, + "neq": 4782, + "ensities": 4783, + "Ġtakes": 4784, + "Ġcharg": 4785, + "Ġintervention": 4786, + "Ġalb": 4787, + "Ġqual": 4788, + "Ġmentioned": 4789, + "Ġones": 4790, + "ĠAccording": 4791, + "illed": 4792, + "OH": 4793, + "Sup": 4794, + "Ġgalaxies": 4795, + "aily": 4796, + "Ġrule": 4797, + "Ġcognitive": 4798, + "hern": 4799, + "Ġrecognition": 4800, + "Ġbuffer": 4801, + "Ġmarg": 4802, + "ĠNi": 4803, + "ĠâĪļ": 4804, + "Ġclin": 4805, + "Ġintegration": 4806, + "Ġsin": 4807, + "ĠAlso": 4808, + "Ġmachine": 4809, + "wr": 4810, + "idity": 4811, + "Ġsubsequent": 4812, + "Fe": 4813, + "Ġnames": 4814, + "ather": 4815, + "ĠCy": 4816, + "Ġmetabolism": 4817, + "Ġreactions": 4818, + "Ġiter": 4819, + "Ġnoted": 4820, + "Ġcauses": 4821, + "ĠHamilton": 4822, + "go": 4823, + "Ġrare": 4824, + "VA": 4825, + "ĠMy": 4826, + "vol": 4827, + "asure": 4828, + "Ġsignificance": 4829, + "ĠNone": 4830, + "Ġvehic": 4831, + "SR": 4832, + "Ġvariability": 4833, + "ĠDevelop": 4834, + "aren": 4835, + "Ġpromot": 4836, + "ards": 4837, + "Ġcomputational": 4838, + "Ġshall": 4839, + "izations": 4840, + "ĠHydrogen": 4841, + "Ġproliferation": 4842, + "Ġcoupled": 4843, + "chron": 4844, + "Ġconvergence": 4845, + "Ġgast": 4846, + "Ġcalculate": 4847, + "raft": 4848, + "paration": 4849, + "heric": 4850, + "ĠPC": 4851, + "plate": 4852, + "ptions": 4853, + "ĠAlgorithm": 4854, + "Ġresulted": 4855, + "DE": 4856, + "Ġinvestigation": 4857, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 4858, + "olation": 4859, + "Ġtasks": 4860, + "Ġleg": 4861, + "iness": 4862, + "Ġemployed": 4863, + "On": 4864, + "Ġexperi": 4865, + "Ġtraject": 4866, + "GA": 4867, + "Ġpurpose": 4868, + "ĠNum": 4869, + "Ġcompletely": 4870, + "that": 4871, + "ĠOptim": 4872, + "Ġformal": 4873, + "eck": 4874, + "ĠProtein": 4875, + "Ġgoal": 4876, + "Ġthroughout": 4877, + "Ġconsidering": 4878, + "Ġreflect": 4879, + "treated": 4880, + "oration": 4881, + "ribution": 4882, + "Ġtherapeutic": 4883, + "Ġfinding": 4884, + "UN": 4885, + "Then": 4886, + "ilities": 4887, + "Ġunknown": 4888, + "overed": 4889, + "Ġvertex": 4890, + "Ġexchange": 4891, + "Ġdrugs": 4892, + "ĠCP": 4893, + "Ġinstr": 4894, + "Ġsymmetric": 4895, + "ĠDep": 4896, + "Ġconstructed": 4897, + "Ġprevalence": 4898, + "Ġdecreases": 4899, + "ĠmiR": 4900, + "Ġyet": 4901, + "Ġbox": 4902, + "graph": 4903, + "widehat": 4904, + "alian": 4905, + "ufact": 4906, + "LR": 4907, + "cription": 4908, + "Ġnp": 4909, + "ĠCharacter": 4910, + "Ġepid": 4911, + "ν": 4912, + "Ġstages": 4913, + "Ġsay": 4914, + "ĠDuring": 4915, + "atur": 4916, + "ientif": 4917, + "abric": 4918, + "ü": 4919, + "ament": 4920, + "inations": 4921, + "Ġsolar": 4922, + "Ġdiscrete": 4923, + "ĠEr": 4924, + "ĠGeneral": 4925, + "bal": 4926, + "ĠCent": 4927, + "uel": 4928, + "Ġmixture": 4929, + "Ġwidely": 4930, + "ĠSecond": 4931, + "Ġresources": 4932, + "ĠAppro": 4933, + "ĠIR": 4934, + "Ġstring": 4935, + "opro": 4936, + "Ġinner": 4937, + "ĠComplex": 4938, + "OP": 4939, + "Ġatoms": 4940, + "Ġphases": 4941, + "Ġdomains": 4942, + "ada": 4943, + "Ġcountries": 4944, + "acet": 4945, + "ociation": 4946, + "izer": 4947, + "Ġitself": 4948, + "Ġminimal": 4949, + "ĠControl": 4950, + "ttp": 4951, + "Ġbottom": 4952, + "ball": 4953, + "ĠMay": 4954, + "dev": 4955, + "now": 4956, + "ember": 4957, + "Ġpercentage": 4958, + "ĠOther": 4959, + "omas": 4960, + "Ġled": 4961, + "Res": 4962, + "ĠEng": 4963, + "kg": 4964, + "Ġfrequencies": 4965, + "kin": 4966, + "Ġincidence": 4967, + "Ġanimal": 4968, + "Ġadop": 4969, + "Ġidentity": 4970, + "ĠRT": 4971, + "Ġyoung": 4972, + "istent": 4973, + "weight": 4974, + "gu": 4975, + "Ġseason": 4976, + "Ġexplained": 4977, + "ĠUnder": 4978, + "iotic": 4979, + "well": 4980, + "Ġmetabolic": 4981, + "gical": 4982, + "±": 4983, + "Theorem": 4984, + "ades": 4985, + "plicated": 4986, + "Ġcontained": 4987, + "Ġsulf": 4988, + "Ġcool": 4989, + "Ġperson": 4990, + "Ïģ": 4991, + "Ġpix": 4992, + "ĠSal": 4993, + "link": 4994, + "ini": 4995, + "tual": 4996, + "SH": 4997, + "ged": 4998, + "ky": 4999, + "asts": 5000, + "ercise": 5001, + "ĠHar": 5002, + "Ġrelax": 5003, + "equiv": 5004, + "Ġyour": 5005, + "Ġunderg": 5006, + "Ġrecovery": 5007, + "Ġcomm": 5008, + "Ġdenotes": 5009, + "formed": 5010, + "aria": 5011, + "etic": 5012, + "Ġtumors": 5013, + "ĠHy": 5014, + "Ġmarkers": 5015, + "Ġplaced": 5016, + "olute": 5017, + "Ġwaves": 5018, + "Ġuncertainty": 5019, + "Ġcontribute": 5020, + "ĠHist": 5021, + "Ġaver": 5022, + "Ġfav": 5023, + "Ġpow": 5024, + "ĠSee": 5025, + "Ġteam": 5026, + "Ġscales": 5027, + "ientific": 5028, + "ierarch": 5029, + "Ġearlier": 5030, + "Ġsatisfies": 5031, + "Ġcrystal": 5032, + "Ġpregn": 5033, + "Ġobserve": 5034, + "Ġonline": 5035, + "Ġcontributions": 5036, + "ogram": 5037, + "ĠMa": 5038, + "Ġfrac": 5039, + "Ġspread": 5040, + "Ġonce": 5041, + "det": 5042, + "Ġrespond": 5043, + "Ġplatform": 5044, + "Ġinflammatory": 5045, + "utive": 5046, + "ĠSumm": 5047, + "place": 5048, + "Ġions": 5049, + "Ġwindow": 5050, + "axis": 5051, + "estinal": 5052, + "Ġdepending": 5053, + "Ġseparation": 5054, + "Ġforward": 5055, + "ĠTi": 5056, + "Ġglass": 5057, + "Ġaccept": 5058, + "Ġfeedback": 5059, + "Ġonto": 5060, + "ME": 5061, + "merc": 5062, + "unctional": 5063, + "Ġapoptosis": 5064, + "ĠProperty": 5065, + "Ġintegrated": 5066, + "Ġorb": 5067, + "Ġdeviation": 5068, + "Ġantibodies": 5069, + "Ġremoved": 5070, + "Ġlipid": 5071, + "armac": 5072, + "Ġarbitrary": 5073, + "agger": 5074, + "Ġembry": 5075, + "Ġgrain": 5076, + "Ġdrop": 5077, + "Ġstarting": 5078, + "Ġrelationships": 5079, + "ĠÏĩ": 5080, + "SF": 5081, + "Ġsimply": 5082, + "Ġfacilit": 5083, + "Ġzone": 5084, + "ils": 5085, + "Psi": 5086, + "Ġinequality": 5087, + "Keywords": 5088, + "Ġtoler": 5089, + "edge": 5090, + "Ġeasy": 5091, + "Ġalpha": 5092, + "Ġperf": 5093, + "width": 5094, + "init": 5095, + "Ġimplemented": 5096, + "CF": 5097, + "osity": 5098, + "ocyte": 5099, + "Ġproportion": 5100, + "rest": 5101, + "ĠSuper": 5102, + "Ġpref": 5103, + "Ġword": 5104, + "ev": 5105, + "Ġextent": 5106, + "Ġinjection": 5107, + "alled": 5108, + "ĠAnti": 5109, + "Ġbeta": 5110, + "ĠJan": 5111, + "ĠGa": 5112, + "ĠZhang": 5113, + "Ġiron": 5114, + "Ġquantitative": 5115, + "roc": 5116, + "Ġfall": 5117, + "Ġregarding": 5118, + "Ġfix": 5119, + "Ġdatasets": 5120, + "Ġtend": 5121, + "Ġscalar": 5122, + "Ġresidual": 5123, + "Ġratios": 5124, + "ĠΦ": 5125, + "king": 5126, + "Ġinflammation": 5127, + "Ġsingular": 5128, + "ĠPark": 5129, + "omatic": 5130, + "unctions": 5131, + "Ġwar": 5132, + "ÍĴ": 5133, + "hemat": 5134, + "Ġface": 5135, + "ĠHu": 5136, + "Ġfundamental": 5137, + "Ġwavelength": 5138, + "eling": 5139, + "ĠSuch": 5140, + "RNAs": 5141, + "ct": 5142, + "Ġiden": 5143, + "cean": 5144, + "new": 5145, + "Type": 5146, + "ĠFormula": 5147, + "Ġmedic": 5148, + "ussion": 5149, + "Ġdistingu": 5150, + "Ġresonance": 5151, + "ATION": 5152, + "inear": 5153, + "Ġhyd": 5154, + "ln": 5155, + "âĨĴ": 5156, + "ĠUp": 5157, + "Ġactual": 5158, + "Ġadapt": 5159, + "hene": 5160, + "Ġmotor": 5161, + "list": 5162, + "abit": 5163, + "Ind": 5164, + "otal": 5165, + "Ġneighbor": 5166, + "ĠPT": 5167, + "gener": 5168, + "Ġpossibility": 5169, + "ergies": 5170, + "Ġseems": 5171, + "ĠUS": 5172, + "Ġimm": 5173, + "Ġtypically": 5174, + "Ġsimulated": 5175, + "ĠSystems": 5176, + "ectiveness": 5177, + "rying": 5178, + "Ġkinase": 5179, + "Ġdecomposition": 5180, + "ateral": 5181, + "Ġrotation": 5182, + "pendix": 5183, + "enn": 5184, + "att": 5185, + "vate": 5186, + "Ġtargets": 5187, + "Ġsituation": 5188, + "Ġinvolve": 5189, + "Ġcreated": 5190, + "hesized": 5191, + "Ġalone": 5192, + "ci": 5193, + "ĠmL": 5194, + "Ġdivided": 5195, + "Ġbulk": 5196, + "oin": 5197, + "HC": 5198, + "Ġarm": 5199, + "LO": 5200, + "ills": 5201, + "Ġmedian": 5202, + "ham": 5203, + "imer": 5204, + "flu": 5205, + "Ġfiber": 5206, + "ĠSU": 5207, + "file": 5208, + "tivated": 5209, + "Ġradio": 5210, + "ĠNames": 5211, + "pe": 5212, + "Ġoste": 5213, + "Ġelim": 5214, + "Ġsuscepti": 5215, + "rehens": 5216, + "Ġdiscussion": 5217, + "ĠSep": 5218, + "Ġarchitecture": 5219, + "Ġdest": 5220, + "typ": 5221, + "rame": 5222, + "Ġpartition": 5223, + "Ġoccurred": 5224, + "Ġsizes": 5225, + "cles": 5226, + "Ġsched": 5227, + "Molecular": 5228, + "Ġκ": 5229, + "Ġinvas": 5230, + "cup": 5231, + "PCR": 5232, + "ĠSMILES": 5233, + "tially": 5234, + "oxide": 5235, + "ĠEd": 5236, + "Ġmanufact": 5237, + "ĠMaterial": 5238, + "Ġflat": 5239, + "Ġmutation": 5240, + "Ġintroduce": 5241, + "bound": 5242, + "Ġdisorders": 5243, + "regulated": 5244, + "ĠMor": 5245, + "Ġfalse": 5246, + "inger": 5247, + "ĠTR": 5248, + "Ġextrem": 5249, + "war": 5250, + "Ġsymbol": 5251, + "Ġanomal": 5252, + "ĠAR": 5253, + "Ġissues": 5254, + "Ġcoordinates": 5255, + "Ġreceptors": 5256, + "Ġprogression": 5257, + "ĠFl": 5258, + "ublic": 5259, + "Ġelectronic": 5260, + "Ġaspects": 5261, + "Ġdocument": 5262, + "flo": 5263, + "ĠPred": 5264, + "Ġgraphs": 5265, + "Ġtraditional": 5266, + "DM": 5267, + "Ġsafety": 5268, + "ĠDr": 5269, + "ĠSequ": 5270, + "Ġcomposite": 5271, + "ĠÎĽ": 5272, + "Ġresponsible": 5273, + "Ġgran": 5274, + "Ġintermediate": 5275, + "odium": 5276, + "posite": 5277, + "phase": 5278, + "dt": 5279, + "Ġweek": 5280, + "Ġdos": 5281, + "Ġstabil": 5282, + "LC": 5283, + "ĠKey": 5284, + "Ġvertices": 5285, + "Ġcomputer": 5286, + "ĠCanonical": 5287, + "Ġinvariant": 5288, + "emark": 5289, + "benz": 5290, + "Ġice": 5291, + "tile": 5292, + "zy": 5293, + "ĠOut": 5294, + "Ġmovement": 5295, + "Ġshif": 5296, + "leep": 5297, + "Ġdaily": 5298, + "Ġpositions": 5299, + "Ġhim": 5300, + "Ġcreate": 5301, + "Our": 5302, + "Ġresearc": 5303, + "Ġprogn": 5304, + "duct": 5305, + "Ġscreening": 5306, + "Ġchoose": 5307, + "process": 5308, + "mal": 5309, + "Ġlaboratory": 5310, + "Ġoperations": 5311, + "Ġtools": 5312, + "ologic": 5313, + "qquad": 5314, + "Ġcommonly": 5315, + "Ġvoid": 5316, + "Ġoccup": 5317, + "associated": 5318, + "Ġcorrelations": 5319, + "Ġcarcinoma": 5320, + "lin": 5321, + "Ġvideo": 5322, + "Ġheavy": 5323, + "Ġlargest": 5324, + "Ġmiddle": 5325, + "ĉĉĉĉ": 5326, + "ĠBas": 5327, + "asons": 5328, + "iding": 5329, + "Ġetc": 5330, + "ache": 5331, + "ĠEval": 5332, + "ira": 5333, + "romagnetic": 5334, + "Ġcovari": 5335, + "LI": 5336, + "Ġdele": 5337, + "Ġstra": 5338, + "amples": 5339, + "oder": 5340, + "Ġcategory": 5341, + "ĠInstit": 5342, + "Ġpolicy": 5343, + "Based": 5344, + "ibly": 5345, + "Ġdetermination": 5346, + "Ġrespir": 5347, + "otropic": 5348, + "Ġolder": 5349, + "ĠMal": 5350, + "Ġcytok": 5351, + "Ġdegrees": 5352, + "aut": 5353, + "illing": 5354, + "eting": 5355, + "Ġreduces": 5356, + "Ġideal": 5357, + "binding": 5358, + "ĠSpect": 5359, + "unit": 5360, + "Ġdiver": 5361, + "ĠWorld": 5362, + "Ġmarked": 5363, + "aly": 5364, + "Ġcomplexes": 5365, + "ĠSummary": 5366, + "Ġpropose": 5367, + "ĠAustr": 5368, + "Ġmaxim": 5369, + "Ġround": 5370, + "Ġinhibitor": 5371, + "Ġefficacy": 5372, + "actor": 5373, + "bur": 5374, + "Ġtransf": 5375, + "ĠGal": 5376, + "Ġproved": 5377, + "ĠDefined": 5378, + "At": 5379, + "Ġselect": 5380, + "Ġnanoparticles": 5381, + "Wh": 5382, + "ken": 5383, + "ĠSP": 5384, + "enge": 5385, + "Ġdelivery": 5386, + "Ġdisorder": 5387, + "ĠInChI": 5388, + "ĠComparison": 5389, + "ifying": 5390, + "ĠMechan": 5391, + "Ġconclude": 5392, + "Ġrepeated": 5393, + "ellow": 5394, + "ĠÃĢ": 5395, + "CI": 5396, + "ĠHz": 5397, + "analysis": 5398, + "Tr": 5399, + "ÃŃ": 5400, + "elihood": 5401, + "Ġexpand": 5402, + "ĠDevelopment": 5403, + "ĠState": 5404, + "Ġtet": 5405, + "ffic": 5406, + "Ġparent": 5407, + "Ġscenario": 5408, + "rs": 5409, + "ĠWhat": 5410, + "âī": 5411, + "Ġstimulation": 5412, + "ĠObs": 5413, + "zero": 5414, + "Ġmanner": 5415, + "ashed": 5416, + "ĠLog": 5417, + "Ġoxide": 5418, + "phosph": 5419, + "Ġmigration": 5420, + "Ġsubgroup": 5421, + "rosis": 5422, + "ipp": 5423, + "DR": 5424, + "dec": 5425, + "osomal": 5426, + "Ġsegment": 5427, + "ogenous": 5428, + "FP": 5429, + "hand": 5430, + "ĠSurface": 5431, + "itz": 5432, + "Ġcrystall": 5433, + "this": 5434, + "Ġbuilding": 5435, + "tag": 5436, + "Ġreducing": 5437, + "Ġuns": 5438, + "Ġrecomb": 5439, + "Ġcam": 5440, + "Ġlimits": 5441, + "ocardi": 5442, + "&&": 5443, + "Ġseparate": 5444, + "Ġsupplement": 5445, + "kele": 5446, + "Ġgrad": 5447, + "Ġissue": 5448, + "ĠQuantum": 5449, + "Ġcurrently": 5450, + "Ġquite": 5451, + "EP": 5452, + "Ġrules": 5453, + "Ġweights": 5454, + "uary": 5455, + "illi": 5456, + "Ġbecame": 5457, + "ó": 5458, + "Ġnormalized": 5459, + "ĠNetworks": 5460, + "erved": 5461, + "Ġstatistics": 5462, + "ĠTime": 5463, + "ĠUV": 5464, + "Ġcav": 5465, + "used": 5466, + "Ġfish": 5467, + "Ġmajority": 5468, + "ĠPe": 5469, + "Ġcohort": 5470, + "Ġsemi": 5471, + "Ġgame": 5472, + "monary": 5473, + "MM": 5474, + "oded": 5475, + "Ġvent": 5476, + "Ġauto": 5477, + "Ġabundance": 5478, + "nov": 5479, + "Ġasymptotic": 5480, + "Ġtreatments": 5481, + "uly": 5482, + "Ġconstraint": 5483, + "Ġbey": 5484, + "ĠSO": 5485, + "Ġstd": 5486, + "Ġdeveloping": 5487, + "ĠNot": 5488, + "Lemma": 5489, + "Ġapparent": 5490, + "Ġcircuit": 5491, + "From": 5492, + "ĠEuropean": 5493, + "Ġsolve": 5494, + "ĠÍij": 5495, + "ux": 5496, + "Ġbeyond": 5497, + "ept": 5498, + "Ġappe": 5499, + "requency": 5500, + "Ġvacu": 5501, + "ĠIndeed": 5502, + "ĠChemical": 5503, + "ĠUndefined": 5504, + "Note": 5505, + "Ġnull": 5506, + "Ġinverse": 5507, + "Ġnamely": 5508, + "Ġshear": 5509, + "mL": 5510, + "All": 5511, + "Rec": 5512, + "Ġgeneralized": 5513, + "ranes": 5514, + "ĠTest": 5515, + "iling": 5516, + "Ġfluorescence": 5517, + "ĠΣ": 5518, + "Ġindepend": 5519, + "diff": 5520, + "Ġproviding": 5521, + "phenyl": 5522, + "hing": 5523, + "Ġviral": 5524, + "ĠBecause": 5525, + "Ġintrac": 5526, + "ĠHig": 5527, + "Ġwant": 5528, + "Ġprinciple": 5529, + "anol": 5530, + "Ġha": 5531, + "ovascular": 5532, + "Ġformer": 5533, + "Ġestablish": 5534, + "Ġadvantage": 5535, + "III": 5536, + "Ġsequencing": 5537, + "Ġprocedures": 5538, + "tra": 5539, + "index": 5540, + "fe": 5541, + "Ġpi": 5542, + "Ġobvious": 5543, + "Ġregime": 5544, + "sur": 5545, + "Ġpresents": 5546, + "Ġdisplac": 5547, + "Ġdecl": 5548, + "ĠAppendix": 5549, + "Ġinteract": 5550, + "lands": 5551, + "inate": 5552, + "omorphic": 5553, + "Ġlowest": 5554, + "Ġartif": 5555, + "Ġinvolving": 5556, + "Ġcommerc": 5557, + "Ġdop": 5558, + "Ġconform": 5559, + "ĠIg": 5560, + "rolog": 5561, + "vised": 5562, + "Ġflo": 5563, + "Ġcardiac": 5564, + "pts": 5565, + "rig": 5566, + "Ġensure": 5567, + "Ġaccumulation": 5568, + "Ġentropy": 5569, + "Ġidea": 5570, + "perature": 5571, + "Ġquestions": 5572, + "ĠPR": 5573, + "Ġstatistically": 5574, + "dagger": 5575, + "Ġnitrogen": 5576, + "scr": 5577, + "ĠDiscussion": 5578, + "Ġreports": 5579, + "Ġpulse": 5580, + "Ġrequirements": 5581, + "Ġcomparing": 5582, + "quired": 5583, + "layer": 5584, + "Ġspectroscopy": 5585, + "vironments": 5586, + "Ġscaling": 5587, + "Ġexposed": 5588, + "MB": 5589, + "ξ": 5590, + "Ġhole": 5591, + "Ġá": 5592, + "Ġsimilarity": 5593, + "Ġvariants": 5594, + "body": 5595, + "Ġkeep": 5596, + "ĠCancer": 5597, + "edi": 5598, + "osomes": 5599, + "Ç«": 5600, + "Ad": 5601, + "âĪŀ": 5602, + "monic": 5603, + "ging": 5604, + "split": 5605, + "know": 5606, + "Ġrough": 5607, + "hematical": 5608, + "vision": 5609, + "Ġded": 5610, + "Ġcycles": 5611, + "Ġfamil": 5612, + "Ġadministration": 5613, + "etal": 5614, + "Ġcoron": 5615, + "Ġinfections": 5616, + "Ġmacroph": 5617, + "atics": 5618, + "Ġpredictions": 5619, + "isher": 5620, + "erent": 5621, + "reted": 5622, + "include": 5623, + "Ġclimate": 5624, + "sec": 5625, + "========": 5626, + "ĠMS": 5627, + "Ġcompe": 5628, + "ratic": 5629, + "lig": 5630, + "poses": 5631, + "Ġpolarization": 5632, + "llip": 5633, + "derived": 5634, + "Ġreleased": 5635, + "Ġconnection": 5636, + "lic": 5637, + "Ġcoli": 5638, + "Ġoutside": 5639, + "Ġabsolute": 5640, + "esian": 5641, + "ĠEnd": 5642, + "ĠOf": 5643, + "Ġidentical": 5644, + "Ġmodule": 5645, + "Ġmitochondrial": 5646, + "Ġadvanced": 5647, + "ingly": 5648, + "formance": 5649, + "Ġtoward": 5650, + "uding": 5651, + "ek": 5652, + "Ġmeaning": 5653, + "crib": 5654, + "ulator": 5655, + "FN": 5656, + "key": 5657, + "cons": 5658, + "Ġapplying": 5659, + "ishes": 5660, + "Ġmamm": 5661, + "Ġderivatives": 5662, + "Ġorientation": 5663, + "Ġstochastic": 5664, + "ĠAug": 5665, + "Ġrenal": 5666, + "ĠGreen": 5667, + "Ġcomplement": 5668, + "obl": 5669, + "pirical": 5670, + "orts": 5671, + "BM": 5672, + "Ġexcess": 5673, + "Ġmorphology": 5674, + "Ġsound": 5675, + "ifier": 5676, + "Ġimplications": 5677, + "ĠDesign": 5678, + "approx": 5679, + "prop": 5680, + "Ġcandidate": 5681, + "Ġdepos": 5682, + "Ġequip": 5683, + "ustain": 5684, + "inese": 5685, + "etry": 5686, + "Ġpotentially": 5687, + "Ġstraight": 5688, + "Ġcruc": 5689, + "iology": 5690, + "Ġkernel": 5691, + "Ġalcoh": 5692, + "idden": 5693, + "return": 5694, + "Ġcorrection": 5695, + "rot": 5696, + "Ġmicroscopy": 5697, + "Ġfoot": 5698, + "GL": 5699, + "ĠCells": 5700, + "irth": 5701, + "yg": 5702, + "ĠPath": 5703, + "outhern": 5704, + "ĠLong": 5705, + "Ġrevers": 5706, + "ε": 5707, + "arse": 5708, + "Ġcereb": 5709, + "isted": 5710, + "Ġpuls": 5711, + "Ġdisk": 5712, + "itud": 5713, + "Ġdu": 5714, + "Ġangular": 5715, + "chem": 5716, + "length": 5717, + "Ġexactly": 5718, + "roke": 5719, + "uth": 5720, + "Ġcond": 5721, + "insic": 5722, + "Ġrise": 5723, + "take": 5724, + "Ġtopological": 5725, + "Ġremark": 5726, + "ollary": 5727, + "Ġcer": 5728, + "TE": 5729, + "nment": 5730, + "Ġbuilt": 5731, + "Ġfre": 5732, + "Ġenergies": 5733, + "ecting": 5734, + "ĠTem": 5735, + "rared": 5736, + "ĠNow": 5737, + "charge": 5738, + "Ġlocations": 5739, + "Ġbalance": 5740, + "Ġla": 5741, + "Ġreached": 5742, + "lammatory": 5743, + "Ġfabric": 5744, + "ifications": 5745, + "Ġdiagnostic": 5746, + "Ġmutant": 5747, + "ĠNO": 5748, + "HD": 5749, + "ĠAB": 5750, + "Ġdiscrim": 5751, + "Ġprecip": 5752, + "ĠThree": 5753, + "Ġinser": 5754, + "Ġinfected": 5755, + "Ġconstants": 5756, + "Ω": 5757, + "negative": 5758, + "Ġconfidence": 5759, + "ĠPatients": 5760, + "ollowing": 5761, + "ads": 5762, + "Ġhypert": 5763, + "ĠInternational": 5764, + "Def": 5765, + "ariate": 5766, + "Ġintervals": 5767, + "Ġexercise": 5768, + "Ġeducation": 5769, + "Ġremoval": 5770, + "thern": 5771, + "ster": 5772, + "Ġinteger": 5773, + "ĠPA": 5774, + "Ġkid": 5775, + "Ġcategories": 5776, + "ĠGiven": 5777, + "Ġvascular": 5778, + "herence": 5779, + "mathscr": 5780, + "ĠRet": 5781, + "Ġinsulin": 5782, + "ticip": 5783, + "ĠCF": 5784, + "Ġlook": 5785, + "ymmetry": 5786, + "Ġforces": 5787, + "ĠPhysical": 5788, + "LS": 5789, + "care": 5790, + "Ġhouse": 5791, + "Ġinduce": 5792, + "Ġbelie": 5793, + "ria": 5794, + "ĠAssum": 5795, + "Ġcomputing": 5796, + "Ġbus": 5797, + "âĪİ": 5798, + "Ġpractical": 5799, + "train": 5800, + "TT": 5801, + "Ġplastic": 5802, + "ĠNor": 5803, + "Ġfeas": 5804, + "ĠHamiltonian": 5805, + "Ġtail": 5806, + "ĠZn": 5807, + "Ġinterpretation": 5808, + "ducing": 5809, + "Is": 5810, + "Ġexamine": 5811, + "ulates": 5812, + "Ġmatch": 5813, + "ĠÄ": 5814, + "ives": 5815, + "ameters": 5816, + "ĠμM": 5817, + "Ġexhibit": 5818, + "Ġnit": 5819, + "oto": 5820, + "ĠClinical": 5821, + "ervation": 5822, + "ĠAdditionally": 5823, + "arant": 5824, + "Ġelastic": 5825, + "DA": 5826, + "otopic": 5827, + "Ġactivated": 5828, + "Ġter": 5829, + "Ġconsequence": 5830, + "Ġendot": 5831, + "ophag": 5832, + "Ġcomparable": 5833, + "Ġdominant": 5834, + "η": 5835, + "Ġvalidation": 5836, + "Im": 5837, + "ĠÅ": 5838, + "Ġleaf": 5839, + "Ġfung": 5840, + "taining": 5841, + "Ġunivers": 5842, + "Ġphyl": 5843, + "Ġlibr": 5844, + "Ġextra": 5845, + "Ġprint": 5846, + "mediately": 5847, + "Ġmaximal": 5848, + "idae": 5849, + "Ġoral": 5850, + "bin": 5851, + "Ġpeptide": 5852, + "ĠMax": 5853, + "arp": 5854, + "Ġconclusion": 5855, + "Ġsatisfy": 5856, + "Ġanalyze": 5857, + "ois": 5858, + "Ġinfer": 5859, + "Ġdraw": 5860, + "Ġdepression": 5861, + "Ġmetall": 5862, + "Ġposterior": 5863, + "Ġpeaks": 5864, + "sol": 5865, + "Ġhorizontal": 5866, + "Ġlateral": 5867, + "ĠOR": 5868, + "NN": 5869, + "Ġemo": 5870, + "PV": 5871, + "TA": 5872, + "Ġincubated": 5873, + "Ġretrie": 5874, + "Ġhumans": 5875, + "Ġri": 5876, + "Ġsoci": 5877, + "onia": 5878, + "Ġinterven": 5879, + "Ġvarying": 5880, + "Ġsti": 5881, + "ĠImmun": 5882, + "Ġonset": 5883, + "Ġleaves": 5884, + "Ġotherwise": 5885, + "Ġblocks": 5886, + "Ġassigned": 5887, + "SCs": 5888, + "Ġbios": 5889, + "Ġmixing": 5890, + "ara": 5891, + "li": 5892, + "Ġdeformation": 5893, + "Ġcosts": 5894, + "Ġperipher": 5895, + "ĠTra": 5896, + "Ġatomic": 5897, + "Ġrandomly": 5898, + "Ġargument": 5899, + "Ġitems": 5900, + "Ġsuff": 5901, + "Ġprobably": 5902, + "ners": 5903, + "Ġinhibitors": 5904, + "Ġbeh": 5905, + "ĠDeep": 5906, + "Ġpig": 5907, + "ĠType": 5908, + "ĠMost": 5909, + "ura": 5910, + "itudinal": 5911, + "Ġderivative": 5912, + "Ġexplore": 5913, + "ĠInformation": 5914, + "Ġgrap": 5915, + "ĠÎĶ": 5916, + "Ġprogress": 5917, + "****************": 5918, + "Ġul": 5919, + "ARS": 5920, + "oral": 5921, + "ostic": 5922, + "Com": 5923, + "ĠExternal": 5924, + "ĠStatistical": 5925, + "ĠRam": 5926, + "ĠLo": 5927, + "Ġelectrical": 5928, + "long": 5929, + "Net": 5930, + "ENT": 5931, + "va": 5932, + "ä": 5933, + "urations": 5934, + "Ġdesired": 5935, + "iring": 5936, + "Ġphysics": 5937, + "Ġmasses": 5938, + "ki": 5939, + "Ġbands": 5940, + "Ġalk": 5941, + "ĠSimilarly": 5942, + "Ġsurround": 5943, + "Ġconvex": 5944, + "oster": 5945, + "Ġlinked": 5946, + "Ġfocused": 5947, + "Ġhot": 5948, + "Ġmatching": 5949, + "Ġoxidation": 5950, + "Ġanten": 5951, + "miss": 5952, + "Ġmental": 5953, + "ille": 5954, + "iciency": 5955, + "ĠLiu": 5956, + "Ġprobe": 5957, + "ĠEstim": 5958, + "Ġindices": 5959, + "che": 5960, + "ĠRob": 5961, + "Ġconv": 5962, + "ĠVer": 5963, + "apse": 5964, + "Si": 5965, + "phal": 5966, + "Ġlesions": 5967, + "Ġmolecule": 5968, + "Ġadi": 5969, + "Ġdate": 5970, + "Ġcomposed": 5971, + "Ġaud": 5972, + "structure": 5973, + "oton": 5974, + "infor": 5975, + "Ġclustering": 5976, + "acent": 5977, + "star": 5978, + "PO": 5979, + "ĠChinese": 5980, + "Ġspecifically": 5981, + "erential": 5982, + "Ġcapture": 5983, + "ĠLow": 5984, + "Ġfine": 5985, + "Ġfemales": 5986, + "ĠHow": 5987, + "Ġaer": 5988, + "vector": 5989, + "portun": 5990, + "forms": 5991, + "zo": 5992, + "Ġprecision": 5993, + "ypt": 5994, + "Ġminutes": 5995, + "κ": 5996, + "Ġoxidative": 5997, + "conn": 5998, + "ensus": 5999, + "Ġtrace": 6000, + "Ġconjug": 6001, + "Ġhighlight": 6002, + "ss": 6003, + "ĠExperimental": 6004, + "ĠThat": 6005, + "artment": 6006, + "MO": 6007, + "''": 6008, + "ometer": 6009, + "Ġstop": 6010, + "Ġrib": 6011, + "Ġouter": 6012, + "rh": 6013, + "ript": 6014, + "Ġfluctuations": 6015, + "obs": 6016, + "non": 6017, + "Ġquark": 6018, + "Ġð": 6019, + "ĠMac": 6020, + "Ġperiods": 6021, + "rolled": 6022, + "AV": 6023, + "ĠOc": 6024, + "ĠImage": 6025, + "ĠBel": 6026, + "Ġpropagation": 6027, + "ĠDon": 6028, + "www": 6029, + "glish": 6030, + "Ġexhibited": 6031, + "ogeneity": 6032, + "ĠBack": 6033, + "Ġactions": 6034, + "ski": 6035, + "ĠAmong": 6036, + "Ġbrief": 6037, + "riers": 6038, + "ĠNF": 6039, + "positive": 6040, + "sequently": 6041, + "ulence": 6042, + "Ġenvironments": 6043, + "Ġcurv": 6044, + "omics": 6045, + "Ġbit": 6046, + "Ġgel": 6047, + "Ġrepresentations": 6048, + "Ġaway": 6049, + "ĠField": 6050, + "obic": 6051, + "CG": 6052, + "Ġcomprehens": 6053, + "Ġhierarch": 6054, + "Ġinduces": 6055, + "BD": 6056, + "Ġhapp": 6057, + "Ġeight": 6058, + "Ġgravity": 6059, + "Ġadaptive": 6060, + "BL": 6061, + "genic": 6062, + "Ġinstruc": 6063, + "Ġanalytical": 6064, + "ĠOx": 6065, + "ĠCON": 6066, + "Ġsurgical": 6067, + "Ġdip": 6068, + "ato": 6069, + "Ġrandomized": 6070, + "Ġroles": 6071, + "dep": 6072, + "ĠâĪĩ": 6073, + "chang": 6074, + "Ġdispersion": 6075, + "Ġseparated": 6076, + "ĠOrgan": 6077, + "ĠVi": 6078, + "ĠJohn": 6079, + "Ġannot": 6080, + "Ġresource": 6081, + "energy": 6082, + "relation": 6083, + "mean": 6084, + "ĠBen": 6085, + "Ġconfirm": 6086, + "With": 6087, + "Ġinfinite": 6088, + "ĠScience": 6089, + "Ġsuccessfully": 6090, + "Ġlocalization": 6091, + "mode": 6092, + "https": 6093, + "gebras": 6094, + "idelines": 6095, + "Ġeffectiveness": 6096, + "hyd": 6097, + "Ġsaid": 6098, + "ico": 6099, + "Ġtransitions": 6100, + "eding": 6101, + "Ġprograms": 6102, + "Ġmobile": 6103, + "Ġimmediately": 6104, + "ectivity": 6105, + "ĠTherm": 6106, + "ogenetic": 6107, + "Ġseven": 6108, + "Ġemph": 6109, + "GE": 6110, + "neum": 6111, + "Ġfusion": 6112, + "limits": 6113, + "Ġcalcium": 6114, + "raf": 6115, + "minus": 6116, + "Ġtrap": 6117, + "Ġspecimens": 6118, + "ancing": 6119, + "ĠMarch": 6120, + "Ġten": 6121, + "Ġfamilies": 6122, + "ĠHD": 6123, + "isons": 6124, + "Ġpreparation": 6125, + "hold": 6126, + "ether": 6127, + "ĠVol": 6128, + "ĠDise": 6129, + "Ġrunning": 6130, + "Ġqualit": 6131, + "Ġeffectively": 6132, + "fficiently": 6133, + "BI": 6134, + "Ġdenoted": 6135, + "ĠEquation": 6136, + "Ġdemand": 6137, + "itory": 6138, + "aching": 6139, + "Ġsodium": 6140, + "Ġreproduc": 6141, + "cho": 6142, + "Ġbil": 6143, + "Pi": 6144, + "umb": 6145, + "Ġreconstruction": 6146, + "forward": 6147, + "One": 6148, + "Ġconversion": 6149, + "Ġformulation": 6150, + "Ġnearly": 6151, + "ĠLag": 6152, + "Str": 6153, + "terior": 6154, + "Ġoperating": 6155, + "andom": 6156, + "Ġmoving": 6157, + "ĠReview": 6158, + "////": 6159, + "nai": 6160, + "pp": 6161, + "otide": 6162, + "label": 6163, + "ococc": 6164, + "Ġnever": 6165, + "aker": 6166, + "Ġdigital": 6167, + "Bl": 6168, + "Un": 6169, + "Ġmember": 6170, + "sel": 6171, + "Ġpotenti": 6172, + "Ġcopy": 6173, + "Ġelectrons": 6174, + "chlor": 6175, + "annel": 6176, + "ylind": 6177, + "Ġmis": 6178, + "ĠSet": 6179, + "Ġnutri": 6180, + "Ġdescribes": 6181, + "Ġassumptions": 6182, + "Ġvirtual": 6183, + "Ġcoordinate": 6184, + "Ġvor": 6185, + "ĠArab": 6186, + "ĠImp": 6187, + "Ġdeposition": 6188, + "Ġinstit": 6189, + "Ġrepresentative": 6190, + "everal": 6191, + "Ġmillion": 6192, + "ĠMA": 6193, + "Ġmales": 6194, + "Ġcrucial": 6195, + "Ġcold": 6196, + "Ġloading": 6197, + "Ġtranslation": 6198, + "Ġstead": 6199, + "rays": 6200, + "Ġchallenge": 6201, + "activity": 6202, + "idal": 6203, + "uff": 6204, + "Ġseem": 6205, + "Ġnational": 6206, + "Ġfa": 6207, + "Ġminor": 6208, + "Ġundergo": 6209, + "cr": 6210, + "Ġcapt": 6211, + "ele": 6212, + "uple": 6213, + "ĠMg": 6214, + "lege": 6215, + "GR": 6216, + "Ġrig": 6217, + "Ġarri": 6218, + "Ġdetector": 6219, + "Ġstrict": 6220, + "Ġadhes": 6221, + "Ġsea": 6222, + "theless": 6223, + "Ġsleep": 6224, + "ĠCommun": 6225, + "Ġantioxid": 6226, + "Ġmarker": 6227, + "Ġflows": 6228, + "ancre": 6229, + "ĠJanuary": 6230, + "input": 6231, + "UP": 6232, + "Ġstored": 6233, + "ading": 6234, + "itively": 6235, + "Ġslope": 6236, + "Ġshell": 6237, + "Ġelevated": 6238, + "ilk": 6239, + "Ġfrequently": 6240, + "Ġball": 6241, + "urban": 6242, + "Ġml": 6243, + "usive": 6244, + "ĠAnt": 6245, + "amino": 6246, + "Sim": 6247, + "Ġphysiological": 6248, + "regulation": 6249, + "esity": 6250, + "Ġexplan": 6251, + "Ġaden": 6252, + "reme": 6253, + "Ġdiffer": 6254, + "Ġmodification": 6255, + "Ġirradi": 6256, + "He": 6257, + "acial": 6258, + "Ġsuppress": 6259, + "quis": 6260, + "Ġdry": 6261, + "erated": 6262, + "Ġprojection": 6263, + "Ġpool": 6264, + "plete": 6265, + "Ġdirections": 6266, + "Ġchanged": 6267, + "ĠIts": 6268, + "Ġster": 6269, + "Ġradial": 6270, + "Ġgr": 6271, + "Ġperiodic": 6272, + "Ġbin": 6273, + "Ġpip": 6274, + "men": 6275, + "then": 6276, + "pc": 6277, + "amily": 6278, + "ĠDM": 6279, + "Ġsediment": 6280, + "mi": 6281, + "Ġclosely": 6282, + "Ġrepair": 6283, + "Ġrespiratory": 6284, + "Ġhorm": 6285, + "Ans": 6286, + "dr": 6287, + "ls": 6288, + "Ġhomogeneous": 6289, + "etric": 6290, + "DS": 6291, + "Ġresidues": 6292, + "ĠValue": 6293, + "Fs": 6294, + "Ġwhy": 6295, + "Sp": 6296, + "Ġca": 6297, + "Ġnarrow": 6298, + "gent": 6299, + "Ġbr": 6300, + "Ġquasi": 6301, + "Ġpict": 6302, + "mo": 6303, + "Ġatom": 6304, + "Ġhabit": 6305, + "Ġlimitations": 6306, + "conduc": 6307, + "Ġshock": 6308, + "ceptor": 6309, + "ĠDetection": 6310, + "Sh": 6311, + "ube": 6312, + "Ġellip": 6313, + "UR": 6314, + "Ġstaining": 6315, + "Ġrapidly": 6316, + "ĠBur": 6317, + "ĠBro": 6318, + "Ġuptake": 6319, + "Ġchallenges": 6320, + "SN": 6321, + "Ġanis": 6322, + "Ġbounds": 6323, + "step": 6324, + "omeric": 6325, + "tention": 6326, + "ĠEvaluation": 6327, + "Ġrecommend": 6328, + "Me": 6329, + "Ġmoderate": 6330, + "elled": 6331, + "Ġtit": 6332, + "ĠYang": 6333, + "Ġpharmac": 6334, + "inflammatory": 6335, + "ĠJune": 6336, + "Ġsensors": 6337, + "aired": 6338, + "Ġapproximate": 6339, + "SV": 6340, + "Ġbund": 6341, + "rc": 6342, + "oman": 6343, + "Ġvisible": 6344, + "Ġmeasuring": 6345, + "ogonal": 6346, + "ĠFourier": 6347, + "Ġtheories": 6348, + "Ġprofession": 6349, + "tained": 6350, + "atas": 6351, + "ĠInterest": 6352, + "param": 6353, + "ĠStructure": 6354, + "Ġliving": 6355, + "Data": 6356, + "ĠSM": 6357, + "Ġnet": 6358, + "Ġsimultaneously": 6359, + "continu": 6360, + "Ġshor": 6361, + "########": 6362, + "Ġdecreasing": 6363, + "Ġreferred": 6364, + "gg": 6365, + "Thus": 6366, + "Ġdro": 6367, + "pril": 6368, + "ĠPers": 6369, + "Ġencoding": 6370, + "Ġarc": 6371, + "Ġregulatory": 6372, + "Ġtrained": 6373, + "cepts": 6374, + "Ġrout": 6375, + "lys": 6376, + "Par": 6377, + "ĠUl": 6378, + "ĠGraph": 6379, + "âĪĤ": 6380, + "Ġirre": 6381, + "oidal": 6382, + "Ġexceed": 6383, + "Ġmostly": 6384, + "ĠPat": 6385, + "aternal": 6386, + "Ġer": 6387, + "Ġcoverage": 6388, + "FS": 6389, + "ĠRot": 6390, + "Ġclassified": 6391, + "Ġexcitation": 6392, + "Ġconductivity": 6393, + "Ġcommercial": 6394, + "ĠDel": 6395, + "ĠPolar": 6396, + "HR": 6397, + "Ġtraffic": 6398, + "zing": 6399, + "Ġsettings": 6400, + "Ġinclusion": 6401, + "Answer": 6402, + "Ġvit": 6403, + "vitational": 6404, + "Ġbind": 6405, + "Ġoc": 6406, + "ĠWestern": 6407, + "Ġprosp": 6408, + "Ġnorth": 6409, + "itch": 6410, + "ĠRiver": 6411, + "Ġvehicle": 6412, + "Ġlikelihood": 6413, + "LD": 6414, + "Ġinsp": 6415, + "âĪĨ": 6416, + "Ġleuk": 6417, + "ĠBre": 6418, + "Ġsynthetic": 6419, + "ĠGermany": 6420, + "ĠTheir": 6421, + "target": 6422, + "ĠEnglish": 6423, + "Ġnotation": 6424, + "ĠATP": 6425, + "ĠModels": 6426, + "Ġabnormal": 6427, + "ĠConclusions": 6428, + "Ġoccurrence": 6429, + "Ġmicrobi": 6430, + "ĠWar": 6431, + "tember": 6432, + "Ġlocally": 6433, + "born": 6434, + "Ġbarrier": 6435, + "Ġexpressions": 6436, + "oval": 6437, + "Ġflav": 6438, + "emble": 6439, + "Ġdynamical": 6440, + "Ġphoton": 6441, + "apped": 6442, + "Ġglut": 6443, + "Ġkinetic": 6444, + "Ġalcohol": 6445, + "Ġtransplant": 6446, + "LP": 6447, + "Ġdefault": 6448, + "Ġopportun": 6449, + "args": 6450, + "ĠDav": 6451, + "Ġfront": 6452, + "hom": 6453, + "Ġways": 6454, + "ĠAssociation": 6455, + "Ġkidney": 6456, + "Ġproportional": 6457, + "When": 6458, + "Ġepithelial": 6459, + "Ġfresh": 6460, + "Ġrecall": 6461, + "Ġenzymes": 6462, + "br": 6463, + "Ġmalign": 6464, + "textrm": 6465, + "ĠUse": 6466, + "Now": 6467, + "ĠLie": 6468, + "Ġimpair": 6469, + "Ġguarant": 6470, + "Ġinver": 6471, + "Ġtranscript": 6472, + "Ġsustain": 6473, + "Ġactually": 6474, + "alities": 6475, + "ĠMic": 6476, + "ĠIC": 6477, + "ĠMeasure": 6478, + "Ġ": 6479, + "Ġdensities": 6480, + "Ġgalaxy": 6481, + "Ġsufficiently": 6482, + "Ġorbit": 6483, + "ford": 6484, + "Ġpartially": 6485, + "ĠPy": 6486, + "Ġreverse": 6487, + "Ġsurve": 6488, + "ĠWork": 6489, + "Ġask": 6490, + "However": 6491, + "Ġsitu": 6492, + "Ġvacuum": 6493, + "tober": 6494, + "Ġspac": 6495, + "anth": 6496, + "Or": 6497, + "ags": 6498, + "Ġbig": 6499, + "herical": 6500, + "erge": 6501, + "ellite": 6502, + "Ġinvolves": 6503, + "ĠVis": 6504, + "Ġsummary": 6505, + "ĠSupplementary": 6506, + "ĠColl": 6507, + "Ġadjacent": 6508, + "ontaneous": 6509, + "abs": 6510, + "Ġresearchers": 6511, + "ka": 6512, + "Ġintern": 6513, + "Ġmonth": 6514, + "ĠNeural": 6515, + "apor": 6516, + "ĠNan": 6517, + "Ġstri": 6518, + "EE": 6519, + "Ġconsisting": 6520, + "Ġupdate": 6521, + "Ġphoto": 6522, + "Val": 6523, + "sens": 6524, + "Ġveget": 6525, + "BR": 6526, + "Ġcoinc": 6527, + "ĠJuly": 6528, + "tility": 6529, + "ĠExpression": 6530, + "Ġtopology": 6531, + "Ġgrowing": 6532, + "aptic": 6533, + "uced": 6534, + "Ġperipheral": 6535, + "enes": 6536, + "Ġplots": 6537, + "Ġexplo": 6538, + "Ġwor": 6539, + "ba": 6540, + "atitis": 6541, + "ief": 6542, + "wave": 6543, + "Ġprotection": 6544, + "Ġdefects": 6545, + "Ġadsorption": 6546, + "Ġshared": 6547, + "Ġstellar": 6548, + "ĠBa": 6549, + "ĠEnergy": 6550, + "queous": 6551, + "ĠAugust": 6552, + "Ġlys": 6553, + "Ġplus": 6554, + "irel": 6555, + "ĠGP": 6556, + "ĠNeu": 6557, + "dist": 6558, + "gers": 6559, + "ifer": 6560, + "isp": 6561, + "Ġstrat": 6562, + "ione": 6563, + "ĠMaterials": 6564, + "Ġln": 6565, + "Ġpulmonary": 6566, + "ened": 6567, + "plan": 6568, + "Mod": 6569, + "Ġorganization": 6570, + "Ġrelaxation": 6571, + "Ġcortex": 6572, + "Ġmodulation": 6573, + "ogl": 6574, + "shift": 6575, + "Ġsecurity": 6576, + "Ġfatty": 6577, + "Ġms": 6578, + "local": 6579, + "ergic": 6580, + "Ġinterference": 6581, + "inson": 6582, + "cf": 6583, + "Ġreasons": 6584, + "pred": 6585, + "Ġinterventions": 6586, + "Ġjo": 6587, + "ĠID": 6588, + "ĠArea": 6589, + "ĠHa": 6590, + "uits": 6591, + "output": 6592, + "Le": 6593, + "ycl": 6594, + "inted": 6595, + "Ġnano": 6596, + "NC": 6597, + "ĠCap": 6598, + "Ġchanging": 6599, + "Ġcust": 6600, + "Ġappeared": 6601, + "Ġgrown": 6602, + "ĠUK": 6603, + "Ġradical": 6604, + "ĠPot": 6605, + "ĠProgram": 6606, + "ĠSR": 6607, + "Ġshap": 6608, + "oscop": 6609, + "ĠChang": 6610, + "Ġquantity": 6611, + "ĠTaxon": 6612, + "idation": 6613, + "Ġadding": 6614, + "ĠLee": 6615, + "Ġamounts": 6616, + "Ġdespite": 6617, + "Ġremained": 6618, + "Ġscenarios": 6619, + "lets": 6620, + "oming": 6621, + "Ġcurvature": 6622, + "Ġdimensional": 6623, + "Ġpromising": 6624, + "ĠFil": 6625, + "string": 6626, + "Ġattributed": 6627, + "ymer": 6628, + "Ġneighb": 6629, + "Ġinputs": 6630, + "Ġmagnet": 6631, + "Ġtrees": 6632, + "Ġenter": 6633, + "ruit": 6634, + "stable": 6635, + "toplas": 6636, + "Ġmessage": 6637, + "rophic": 6638, + "Ġisolates": 6639, + "tz": 6640, + "Ġdisplayed": 6641, + "HA": 6642, + "ocl": 6643, + "Ġderive": 6644, + "Ġsynchron": 6645, + "QU": 6646, + "Ãŀ": 6647, + "Ġexamination": 6648, + "Ġdeb": 6649, + "Ġdefin": 6650, + "Ġfault": 6651, + "Ġsteady": 6652, + "Ġphenotype": 6653, + "Ġperspective": 6654, + "Ġstatement": 6655, + "df": 6656, + "void": 6657, + "Ġpromote": 6658, + "illary": 6659, + "ĠEth": 6660, + "Ġwalk": 6661, + "Ġrepresenting": 6662, + "Ġgenomic": 6663, + "ĠGr": 6664, + "shape": 6665, + "ĠPet": 6666, + "ĠLocal": 6667, + "plicity": 6668, + "ĠProblem": 6669, + "GS": 6670, + "Ġcompleted": 6671, + "inking": 6672, + "Ġreads": 6673, + "Ġinde": 6674, + "ceived": 6675, + "ĠPL": 6676, + "ĠMean": 6677, + "ĠSchool": 6678, + "Ġbiomark": 6679, + "ireless": 6680, + "cut": 6681, + "osing": 6682, + "nel": 6683, + "ĠApril": 6684, + "ĠBal": 6685, + "Ġadopted": 6686, + "Ġcomplications": 6687, + "Ġassembly": 6688, + "fort": 6689, + "har": 6690, + "Ġadoles": 6691, + "Ġanswer": 6692, + "Ġcommunities": 6693, + "ĠInstitute": 6694, + "Ġvariant": 6695, + "Finally": 6696, + "mitte": 6697, + "Ġrestricted": 6698, + "Ġmanip": 6699, + "aters": 6700, + "EX": 6701, + "Ġdust": 6702, + "Ġsupply": 6703, + "Ġperme": 6704, + "Ġreliable": 6705, + "ĠResp": 6706, + "Ġsubt": 6707, + "oks": 6708, + "Ġpoll": 6709, + "Ġcanc": 6710, + "ĠUnit": 6711, + "Ġendothelial": 6712, + "dy": 6713, + "ĠBlack": 6714, + "Ġempirical": 6715, + "Ġport": 6716, + "opy": 6717, + "Ġinitially": 6718, + "Ġcondens": 6719, + "Ġeye": 6720, + "Ġlisted": 6721, + "urrence": 6722, + "Ġreplaced": 6723, + "Ġselective": 6724, + "Ġdistances": 6725, + "Ġparas": 6726, + "ĠPost": 6727, + "ĠSeptember": 6728, + "Ġmissing": 6729, + "verex": 6730, + "Er": 6731, + "Ġthought": 6732, + "thal": 6733, + "Ġchromat": 6734, + "Ġbenefit": 6735, + "rames": 6736, + "ĠSuppose": 6737, + "Ġsubs": 6738, + "Ġangi": 6739, + "ori": 6740, + "Ġreplic": 6741, + "Ġschemes": 6742, + "pre": 6743, + "plane": 6744, + "Ġsouth": 6745, + "ager": 6746, + "Ġbeginning": 6747, + "vents": 6748, + "onent": 6749, + "iples": 6750, + "ĠHer": 6751, + "Ġspectrom": 6752, + "Ġdense": 6753, + "Ġtook": 6754, + "iverse": 6755, + "Ġdisturb": 6756, + "pass": 6757, + "Ġillustrated": 6758, + "Ġreveals": 6759, + "ama": 6760, + "Ġreflec": 6761, + "Ġallowing": 6762, + "Ġexponential": 6763, + "oustic": 6764, + "subseteq": 6765, + "Ġsn": 6766, + "Ġurban": 6767, + "Ġextend": 6768, + "Ġassays": 6769, + "rice": 6770, + "CoV": 6771, + "quisition": 6772, + "rine": 6773, + "ĠIntegr": 6774, + "fil": 6775, + "VD": 6776, + "Ġfibro": 6777, + "Ġcompens": 6778, + "ĠImpro": 6779, + "ĠĠĠĠĠĠĠĠĠĠ": 6780, + "ĠGR": 6781, + "ÏĪ": 6782, + "Ġbasal": 6783, + "Ġolig": 6784, + "HT": 6785, + "Ġvess": 6786, + "uzzy": 6787, + "Ġpossibly": 6788, + "Ġtolerance": 6789, + "Theta": 6790, + "Ġviol": 6791, + "uclear": 6792, + "ĠLim": 6793, + "gel": 6794, + "Ġmetrics": 6795, + "ĠMus": 6796, + "amination": 6797, + "Ġelectrode": 6798, + "Ġpersonal": 6799, + "Ġcooling": 6800, + "Ġacquired": 6801, + "ĠFunction": 6802, + "ows": 6803, + "olester": 6804, + "DP": 6805, + "Ġreliability": 6806, + "Ġmuc": 6807, + "ĠOctober": 6808, + "Ġgold": 6809, + "ca": 6810, + "Ġcul": 6811, + "fit": 6812, + "Ġlem": 6813, + "Ġexcit": 6814, + "Ġnucleus": 6815, + "iation": 6816, + "Ġpregnancy": 6817, + "Ġsynthesized": 6818, + "hemistry": 6819, + "Ġmembranes": 6820, + "vert": 6821, + "ĠKim": 6822, + "tenance": 6823, + "Ġquantities": 6824, + "Ġeconomic": 6825, + "Ġbenefits": 6826, + "Ġcylind": 6827, + "pler": 6828, + "ĠLarge": 6829, + "Ġengineering": 6830, + "ĠEp": 6831, + "Ġcoating": 6832, + "ativ": 6833, + "Ġconduct": 6834, + "Ġabsorb": 6835, + "ĠDecember": 6836, + "Ġopposite": 6837, + "ĠGlobal": 6838, + "Ġlif": 6839, + "ĠDue": 6840, + "Ġintake": 6841, + "odynamic": 6842, + "TM": 6843, + "Ġfed": 6844, + "Ġspecified": 6845, + "Ġgeometric": 6846, + "Ġrespective": 6847, + "Ġbirth": 6848, + "ĠCompound": 6849, + "Ġstarted": 6850, + "Ġmother": 6851, + "arr": 6852, + "Ġprimarily": 6853, + "Ġparen": 6854, + "Ġtube": 6855, + "Ġinters": 6856, + "Ġgraphene": 6857, + "itial": 6858, + "ously": 6859, + "Ġcardiovascular": 6860, + "ĠeV": 6861, + "Ġheating": 6862, + "Ġmathematical": 6863, + "Ġindependently": 6864, + "BA": 6865, + "Ġaffects": 6866, + "umor": 6867, + "ĠMP": 6868, + "ĠDem": 6869, + "ĠWest": 6870, + "ĠDom": 6871, + "itter": 6872, + "Ġdisrup": 6873, + "oped": 6874, + "Ġphenomenon": 6875, + "Ġlumin": 6876, + "Ac": 6877, + "Ġprefer": 6878, + "omers": 6879, + "Ġgender": 6880, + "ĠGL": 6881, + "FC": 6882, + "Ġindeed": 6883, + "Ġrational": 6884, + "ĠSC": 6885, + "Ġprincipal": 6886, + "Ġperfect": 6887, + "Ġintroduction": 6888, + "tes": 6889, + "Ġpiec": 6890, + "Ġcity": 6891, + "Ġpopular": 6892, + "Ġcoding": 6893, + "cler": 6894, + "ague": 6895, + "ĠHR": 6896, + "Ġtracking": 6897, + "ker": 6898, + "Ġphosphorylation": 6899, + "Ġpaths": 6900, + "Ġsolving": 6901, + "Ġdy": 6902, + "Ġplayed": 6903, + "Ġprecise": 6904, + "ĠSl": 6905, + "ĠSem": 6906, + "Ġgenerating": 6907, + "ĠSun": 6908, + "Ġcriterion": 6909, + "Ġbranch": 6910, + "Ġζ": 6911, + "tish": 6912, + "Se": 6913, + "Ġantigen": 6914, + "Ġcalibration": 6915, + "Es": 6916, + "ĠItal": 6917, + "Ġmassive": 6918, + "En": 6919, + "No": 6920, + "YP": 6921, + "ya": 6922, + "Ġsatisfying": 6923, + "Ġquick": 6924, + "HO": 6925, + "Ġbehaviors": 6926, + "icrobial": 6927, + "Ġamb": 6928, + "Ġproton": 6929, + "SL": 6930, + "Ġusual": 6931, + "rows": 6932, + "ench": 6933, + "UC": 6934, + "Ġweighted": 6935, + "Ġrecords": 6936, + "ĠAC": 6937, + "GT": 6938, + "inn": 6939, + "Ġeq": 6940, + "ĠWil": 6941, + "yroid": 6942, + "Ġsetup": 6943, + "IA": 6944, + "press": 6945, + "isely": 6946, + "Ġentry": 6947, + "%%": 6948, + "ĠSil": 6949, + "east": 6950, + "ĠEvolution": 6951, + "ĠRandom": 6952, + "Ġcavity": 6953, + "Ġnamed": 6954, + "knowled": 6955, + "mber": 6956, + "uestion": 6957, + "ĠâĪ©": 6958, + "gi": 6959, + "Ġdetermining": 6960, + "tin": 6961, + "Ġgenus": 6962, + "Ġtoxicity": 6963, + "ocyt": 6964, + "Ġperturbation": 6965, + "rought": 6966, + "ĠBri": 6967, + "Ġcarb": 6968, + "ĠGra": 6969, + "ĠFlu": 6970, + "uns": 6971, + "Ġdriven": 6972, + "Ġbatch": 6973, + "rif": 6974, + "Pl": 6975, + "Ġdisplacement": 6976, + "ĠCL": 6977, + "Ġdepic": 6978, + "Ġpredictive": 6979, + "Int": 6980, + "hydroxy": 6981, + "tid": 6982, + "dri": 6983, + "Ġpancre": 6984, + "Ġdiagonal": 6985, + "Ġseverity": 6986, + "Ġlongitudinal": 6987, + "ĠED": 6988, + "atible": 6989, + "dir": 6990, + "ĠAnother": 6991, + "ĠHel": 6992, + "van": 6993, + "Ġpneum": 6994, + "Ġspecificity": 6995, + "squ": 6996, + "Ġign": 6997, + "Ġbed": 6998, + "ĠWT": 6999, + "awa": 7000, + "ester": 7001, + "Ġkg": 7002, + "Ġcompression": 7003, + "evertheless": 7004, + "Ġmask": 7005, + "-----------": 7006, + "Ġtens": 7007, + "rowth": 7008, + "ĠGo": 7009, + "Ġfaster": 7010, + "Ġcanonical": 7011, + "Ġdetermin": 7012, + "ustrial": 7013, + "ĠEarth": 7014, + "while": 7015, + "ournal": 7016, + "Ġcountry": 7017, + "Ġferm": 7018, + "rist": 7019, + "Ġproxim": 7020, + "Ġmicrobial": 7021, + "Ġextensive": 7022, + "Ġcham": 7023, + "Ġ§": 7024, + "such": 7025, + "went": 7026, + "Ġlar": 7027, + "Using": 7028, + "ĠPM": 7029, + "Ġoffset": 7030, + "ĠPI": 7031, + "ĠBayesian": 7032, + "HS": 7033, + "ĠAfrica": 7034, + "Ġsusceptibility": 7035, + "ĠâĬĤ": 7036, + "ococcus": 7037, + "ĠDir": 7038, + "Ġbos": 7039, + "Ġdysfunction": 7040, + "ovember": 7041, + "Ġunderst": 7042, + "Ġlargely": 7043, + "ĠCM": 7044, + "Ġmaintained": 7045, + "Ġpossess": 7046, + "Ġexcluded": 7047, + "ensis": 7048, + "ĠDC": 7049, + "opsis": 7050, + "Ġtorch": 7051, + "idine": 7052, + "Ġforest": 7053, + "ĠExact": 7054, + "ĠStudies": 7055, + "iffiff": 7056, + "ĠCam": 7057, + "angular": 7058, + "Ġremove": 7059, + "oir": 7060, + "ava": 7061, + "ida": 7062, + "Ġmant": 7063, + "Log": 7064, + "Ġranging": 7065, + "rog": 7066, + "Ġchains": 7067, + "ĠÇ«": 7068, + "ĠCase": 7069, + "ĠAP": 7070, + "points": 7071, + "Ġtargeting": 7072, + "Ġscience": 7073, + "Ġepis": 7074, + "ĠSoci": 7075, + "Ġphysic": 7076, + "Ġpromoter": 7077, + "ĠEarly": 7078, + "estic": 7079, + "tives": 7080, + "Ġassuming": 7081, + "ĠMi": 7082, + "Ġlemma": 7083, + "Ġconfigurations": 7084, + "alia": 7085, + "Ġpay": 7086, + "rino": 7087, + "eb": 7088, + "Ġvaried": 7089, + "ounted": 7090, + "Ġinterview": 7091, + "ĠGeV": 7092, + "OM": 7093, + "ognition": 7094, + "Ġenhancement": 7095, + "ĠMach": 7096, + "plies": 7097, + "Ob": 7098, + "setminus": 7099, + "Ġintrinsic": 7100, + "Ġcomparisons": 7101, + "bold": 7102, + "xiety": 7103, + "Ġstroke": 7104, + "GB": 7105, + "ancial": 7106, + "stead": 7107, + "Ġrock": 7108, + "thon": 7109, + "ĠCurrent": 7110, + "cat": 7111, + "Ġguidelines": 7112, + "cycl": 7113, + "Ġintracellular": 7114, + "oney": 7115, + "ko": 7116, + "Ġdirected": 7117, + "ripts": 7118, + "Ġtravel": 7119, + "Ġlens": 7120, + "idi": 7121, + "ĠAssess": 7122, + "Ġdx": 7123, + "ĠPos": 7124, + "Ġmethodology": 7125, + "Ġpredom": 7126, + "defined": 7127, + "ĠPop": 7128, + "Ġgovernment": 7129, + "ellig": 7130, + "phyl": 7131, + "oli": 7132, + "ropical": 7133, + "Ġembedded": 7134, + "edom": 7135, + "cribed": 7136, + "ĠDisease": 7137, + "Ġmediated": 7138, + "Ġcircular": 7139, + "ĠTopological": 7140, + "Ġearth": 7141, + "ritis": 7142, + "gal": 7143, + "mass": 7144, + "Ġcomprehensive": 7145, + "ĠAir": 7146, + "Ġnerve": 7147, + "Ġimplant": 7148, + "Ġextremely": 7149, + "ĠSE": 7150, + "Ġmarket": 7151, + "Ġconserved": 7152, + "embrane": 7153, + "Ġschedul": 7154, + "Ġruns": 7155, + "Ph": 7156, + "Ġtechnical": 7157, + "TL": 7158, + "Ġregional": 7159, + "Ġgerm": 7160, + "ĠProt": 7161, + "Ġbright": 7162, + "Ġartery": 7163, + "Ġmacrophages": 7164, + "mittee": 7165, + "ĠSingle": 7166, + "Ġcome": 7167, + "wa": 7168, + "acchar": 7169, + "plet": 7170, + "Ġsensing": 7171, + "rosp": 7172, + "atom": 7173, + "Ġcompr": 7174, + "ĠLu": 7175, + "Ġavailability": 7176, + "prot": 7177, + "Ġfitting": 7178, + "selves": 7179, + "ĠPrim": 7180, + "rew": 7181, + "Ġwaste": 7182, + "ĠKing": 7183, + "pot": 7184, + "Ġinstrument": 7185, + "ĠYork": 7186, + "AF": 7187, + "antial": 7188, + "standing": 7189, + "Ġplanning": 7190, + "uster": 7191, + "ĠâĨ": 7192, + "NT": 7193, + "icular": 7194, + "Ġmelan": 7195, + "Ġexcell": 7196, + "iller": 7197, + "ĠLD": 7198, + "info": 7199, + "Ġshare": 7200, + "vas": 7201, + "Ġlum": 7202, + "Ġaqueous": 7203, + "Ġquery": 7204, + "Ġmag": 7205, + "ulture": 7206, + "ĠBer": 7207, + "Ġoffer": 7208, + "ĠNMR": 7209, + "aceae": 7210, + "Ġmodern": 7211, + "Ġcircum": 7212, + "Ġcultures": 7213, + "Ġdog": 7214, + "Ġcir": 7215, + "Ġpoli": 7216, + "Ġchemotherapy": 7217, + "Ġplates": 7218, + "Ġrestriction": 7219, + "stack": 7220, + "ĠFlow": 7221, + "ĠBu": 7222, + "ĠCenter": 7223, + "Ġproceed": 7224, + "timicrobial": 7225, + "she": 7226, + "Ġthereby": 7227, + "Ġknock": 7228, + "Ġdiverse": 7229, + "ustry": 7230, + "Ġstated": 7231, + "ĠHol": 7232, + "More": 7233, + "Ġconservation": 7234, + "Ġprevention": 7235, + "norm": 7236, + "Ġpal": 7237, + "ĠCalc": 7238, + "Ġclean": 7239, + "ĠPlas": 7240, + "```": 7241, + "perp": 7242, + "prod": 7243, + "Ġâī¡": 7244, + "porter": 7245, + "Ġtransient": 7246, + "asp": 7247, + "Ġtargeted": 7248, + "ĠPri": 7249, + "Supplementary": 7250, + "ĠTreatment": 7251, + "zen": 7252, + "ĠMart": 7253, + "ĠFerm": 7254, + "uscript": 7255, + "ĠSynthesis": 7256, + "Ġcombinations": 7257, + "ULL": 7258, + "Ġweb": 7259, + "Ġthrom": 7260, + "Ġexplicitly": 7261, + "anks": 7262, + "Ġadaptation": 7263, + "ĠSequence": 7264, + "Ġacts": 7265, + "Ġranges": 7266, + "fs": 7267, + "bru": 7268, + "Ġsystemic": 7269, + "Ġsteel": 7270, + "Ġprivate": 7271, + "Ġobesity": 7272, + "ĠPart": 7273, + "mented": 7274, + "break": 7275, + "ERT": 7276, + "Ġfibers": 7277, + "Ġiso": 7278, + "Ġtransverse": 7279, + "CTION": 7280, + "ĠRi": 7281, + "itin": 7282, + "ĠRepresent": 7283, + "ophys": 7284, + "Ġcoast": 7285, + "Ġalignment": 7286, + "ACT": 7287, + "esides": 7288, + "open": 7289, + "gly": 7290, + "Ġsalt": 7291, + "unced": 7292, + "iaz": 7293, + "Ġcosm": 7294, + "Ġangles": 7295, + "ĠâĢł": 7296, + "ĠIdentification": 7297, + "hex": 7298, + "ĠHall": 7299, + "Ġhepat": 7300, + "Ġsegments": 7301, + "ĠPhase": 7302, + "ĠLand": 7303, + "forming": 7304, + "hbox": 7305, + "ications": 7306, + "Ġsubsequently": 7307, + "ĠCur": 7308, + "Ġlabels": 7309, + "vidence": 7310, + "uality": 7311, + "Ġheld": 7312, + "emann": 7313, + "Ġcamera": 7314, + "cing": 7315, + "ubic": 7316, + "ĠSARS": 7317, + "ulatory": 7318, + "keletal": 7319, + "ĠInflu": 7320, + "ĠIndia": 7321, + "amic": 7322, + "Ġsand": 7323, + "Ġcomes": 7324, + "Ġassociations": 7325, + "Ġcharged": 7326, + "Ġsper": 7327, + "oprotein": 7328, + "iii": 7329, + "odal": 7330, + "Ġboundaries": 7331, + "tization": 7332, + "ĠHeavy": 7333, + "ĠReal": 7334, + "ĠAF": 7335, + "Ġcontroller": 7336, + "Ġantioxidant": 7337, + "Ġbars": 7338, + "Ġwet": 7339, + "ener": 7340, + "ĠComplexity": 7341, + "Ġstack": 7342, + "Therefore": 7343, + "Ġreplication": 7344, + "Ġappearance": 7345, + "Ġtrajectory": 7346, + "Ġunderstood": 7347, + "Ġdot": 7348, + "Ġimag": 7349, + "Ġscanning": 7350, + "Ti": 7351, + "ruct": 7352, + "ĠLy": 7353, + "Ġspontaneous": 7354, + "lat": 7355, + "omon": 7356, + "Ġroots": 7357, + "Ġlive": 7358, + "Ġfinally": 7359, + "¿½": 7360, + "Ġapproved": 7361, + "ĠApplications": 7362, + "ĠPan": 7363, + "Ġlost": 7364, + "Ġsatisfied": 7365, + "Ġgamma": 7366, + "ional": 7367, + "Ġimproving": 7368, + "Ġmanifold": 7369, + "Ġcodes": 7370, + "bb": 7371, + "ĠNovember": 7372, + "Ġrich": 7373, + "NP": 7374, + "ĠEle": 7375, + "SB": 7376, + "Ġdeal": 7377, + "Ġoptions": 7378, + "Ġcultured": 7379, + "Ġvul": 7380, + ">>": 7381, + "arithm": 7382, + "oys": 7383, + "These": 7384, + "ĠDeterm": 7385, + "Ġquadratic": 7386, + "ĠComb": 7387, + "isson": 7388, + "ĠPerformance": 7389, + "Ġexception": 7390, + "Ġnuclei": 7391, + "Ġadverse": 7392, + "ket": 7393, + "ĠPal": 7394, + "ĠMany": 7395, + "Ġdiffraction": 7396, + "Ġtransmit": 7397, + "Ġphosphate": 7398, + "olesterol": 7399, + "Ġquestionnai": 7400, + "ĠSea": 7401, + "bruary": 7402, + "Ġmodelling": 7403, + "ĠDR": 7404, + "olin": 7405, + "chmark": 7406, + "Ġprecisely": 7407, + "gans": 7408, + "vin": 7409, + "ridge": 7410, + "ĠIncre": 7411, + "Ġneuronal": 7412, + "ĠâīĪ": 7413, + "Ġexcellent": 7414, + "etary": 7415, + "Ġoverlap": 7416, + "Ġstronger": 7417, + "Ġfracture": 7418, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 7419, + "Ġclinic": 7420, + "ĠList": 7421, + "Ġhistor": 7422, + "generation": 7423, + "riched": 7424, + "illus": 7425, + "ĠÃħ": 7426, + "ĠRole": 7427, + "Ġlabeled": 7428, + "Ġorthogonal": 7429, + "Ġischem": 7430, + "Ġinstability": 7431, + "loop": 7432, + "Ġplotted": 7433, + "ĠProcessing": 7434, + "ĠTa": 7435, + "ĠConclusion": 7436, + "Ġmagne": 7437, + "Ġuniversal": 7438, + "Ġjet": 7439, + "Ġregim": 7440, + "float": 7441, + "Ġcod": 7442, + "adj": 7443, + "boldmath": 7444, + "Ġarrang": 7445, + "Ġtrends": 7446, + "Ġprecipitation": 7447, + "frequency": 7448, + "Ġcontrad": 7449, + "Ġtransferred": 7450, + "Ġmaintenance": 7451, + "ÎĶ": 7452, + "np": 7453, + "istence": 7454, + "heres": 7455, + "lective": 7456, + "ĠSurvey": 7457, + "ĠÐ": 7458, + "Ġstand": 7459, + "Ġdiscovery": 7460, + "ains": 7461, + "versely": 7462, + "Ġnumerous": 7463, + "ylated": 7464, + "Ġembedding": 7465, + "Ġcollabor": 7466, + "ename": 7467, + "immun": 7468, + "Ġadjusted": 7469, + "ires": 7470, + "cur": 7471, + "Ġvaccine": 7472, + "Ġtraits": 7473, + "Ġmorphological": 7474, + "Ġprecurs": 7475, + "roscope": 7476, + "adi": 7477, + "ecutive": 7478, + "uan": 7479, + "Ġtract": 7480, + "ĠPres": 7481, + "Ġmyel": 7482, + "Ġadequ": 7483, + "Ġethanol": 7484, + "ih": 7485, + "Ġmeth": 7486, + "Ġcounts": 7487, + "Ġqualitative": 7488, + "Ġmusic": 7489, + "Ġreinfor": 7490, + "After": 7491, + "Ġacquisition": 7492, + "Ġhttps": 7493, + "alling": 7494, + "ita": 7495, + "icate": 7496, + "script": 7497, + "Ġoptimized": 7498, + "ĠHo": 7499, + "Ġmild": 7500, + "oplas": 7501, + "Ġoverex": 7502, + "ĠâΧ": 7503, + "Ġcollect": 7504, + "ĠMain": 7505, + "Ġextracellular": 7506, + "Ġanc": 7507, + "rawn": 7508, + "Ġexplored": 7509, + "Ġreserv": 7510, + "ĠApplication": 7511, + "case": 7512, + "Ġmarine": 7513, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠ": 7514, + "iled": 7515, + "Ġmesh": 7516, + "ĠMonte": 7517, + "clos": 7518, + "Ġperforming": 7519, + "Ag": 7520, + "regular": 7521, + "Ġcatal": 7522, + "Ġpotentials": 7523, + "antly": 7524, + "URE": 7525, + "Ġaccomp": 7526, + "Ġreasonable": 7527, + "Ġpresentation": 7528, + "abolic": 7529, + "ĠOnly": 7530, + "anned": 7531, + "Ġsubstantial": 7532, + "Ġdietary": 7533, + "Ġsubstrates": 7534, + "apter": 7535, + "Ġintestinal": 7536, + "Ġproduces": 7537, + "Proposition": 7538, + "rogen": 7539, + "ĠStat": 7540, + "burg": 7541, + "rench": 7542, + "textbf": 7543, + "ystems": 7544, + "atable": 7545, + "ĠVir": 7546, + "Ġsolved": 7547, + "icense": 7548, + "Ġsong": 7549, + "Ġextreme": 7550, + "pty": 7551, + "ĠCity": 7552, + "vered": 7553, + "ĠMRI": 7554, + "Ġtwice": 7555, + "ĠMn": 7556, + "Ġmerg": 7557, + "activation": 7558, + "Ġng": 7559, + "Ġodd": 7560, + "Ġattrac": 7561, + "Ġattempt": 7562, + "Ġseparately": 7563, + "Ġrobot": 7564, + "ĠMultiple": 7565, + "Ġscientific": 7566, + "ĠPP": 7567, + "Ġmineral": 7568, + "Ġprotocols": 7569, + "Ġsuperior": 7570, + "ocamp": 7571, + "boxyl": 7572, + "Ġuniformly": 7573, + "ĠSeveral": 7574, + "Ġmol": 7575, + "Cor": 7576, + "underline": 7577, + "Ġinfluenced": 7578, + "Ġcurren": 7579, + "using": 7580, + "race": 7581, + "ĠNevertheless": 7582, + "Ġaccom": 7583, + "Ġgravitational": 7584, + "Ġindirect": 7585, + "Ġcapable": 7586, + "Ġanalysed": 7587, + "Ġdischarge": 7588, + "Ġves": 7589, + "Ġligand": 7590, + "lik": 7591, + "Ġsi": 7592, + "Ġaged": 7593, + "Ġcrystals": 7594, + "Ġspeech": 7595, + "Ġcopper": 7596, + "ĠSan": 7597, + "ĠArm": 7598, + "Ġmanuscript": 7599, + "Ġsecretion": 7600, + "wedge": 7601, + "·": 7602, + "Ġraw": 7603, + "Ġaimed": 7604, + "Ġevolutionary": 7605, + "Ġconsequences": 7606, + "Ġitem": 7607, + "Ġwestern": 7608, + "Ġsolvent": 7609, + "Ġstimuli": 7610, + "Ġrequirement": 7611, + "http": 7612, + "efore": 7613, + "ĠAtl": 7614, + "Ġatmospheric": 7615, + "Ġpackage": 7616, + "Ġmyocardi": 7617, + "Ġdashed": 7618, + "Ġverify": 7619, + "ativistic": 7620, + "Ġtom": 7621, + "avirus": 7622, + "aken": 7623, + "ĠNumer": 7624, + "Ġadvantages": 7625, + "FR": 7626, + "ĠSelf": 7627, + "rected": 7628, + "config": 7629, + "Ġiteration": 7630, + "Ġeigenvalues": 7631, + "Ġprobabilities": 7632, + "FIG": 7633, + "ĠWater": 7634, + "ĠAu": 7635, + "Ġgave": 7636, + "Ġvar": 7637, + "ricular": 7638, + "opathy": 7639, + "Ġrh": 7640, + "ordance": 7641, + "Ġwin": 7642, + "ĠScale": 7643, + "Ġannual": 7644, + "ataset": 7645, + "Ġpel": 7646, + "ĠâĪª": 7647, + "ĠCC": 7648, + "itors": 7649, + "Ġlith": 7650, + "Ġchromosome": 7651, + "Ġfuel": 7652, + "Ġmultiv": 7653, + "Ġmanufacture": 7654, + "la": 7655, + "ĠSa": 7656, + "umes": 7657, + "igm": 7658, + "Ġnanoc": 7659, + "EGF": 7660, + "Ġsignature": 7661, + "NS": 7662, + "Ġmeet": 7663, + "Ġfair": 7664, + "meth": 7665, + "Ġlocalized": 7666, + "ĠCentral": 7667, + "deg": 7668, + "Ġsurrounding": 7669, + "Ġnone": 7670, + "ĠMO": 7671, + "ĠInterestingly": 7672, + "Ġmultic": 7673, + "ĠKe": 7674, + "Ġinhibited": 7675, + "ĠCare": 7676, + "ĠOpen": 7677, + "Ġglob": 7678, + "EA": 7679, + "ĠFound": 7680, + "Ġpixel": 7681, + "oke": 7682, + "RD": 7683, + "loc": 7684, + "tious": 7685, + "Ġdistinguish": 7686, + "Ġanterior": 7687, + "urch": 7688, + "Ġjud": 7689, + "ĠPower": 7690, + "Ġswitch": 7691, + "ĠSyn": 7692, + "Ġinvolvement": 7693, + "ucl": 7694, + "Ġlibrary": 7695, + "ĠConst": 7696, + "Ġspherical": 7697, + "ĠTNF": 7698, + "Ġaltered": 7699, + "vance": 7700, + "transfer": 7701, + "Ms": 7702, + "ĠOper": 7703, + "inement": 7704, + "seq": 7705, + "Cons": 7706, + "hole": 7707, + "ĠPhot": 7708, + "Ġgut": 7709, + "acterial": 7710, + "ĠIP": 7711, + "unt": 7712, + "Ġnom": 7713, + "has": 7714, + "ĠFebruary": 7715, + "Ġprostate": 7716, + "ĠML": 7717, + "high": 7718, + "ĠBackground": 7719, + "ulent": 7720, + "Ġocean": 7721, + "after": 7722, + "ĠOff": 7723, + "loss": 7724, + "Ġfavor": 7725, + "Ġworkers": 7726, + "Ġhidden": 7727, + "Ġextracts": 7728, + "razil": 7729, + "sign": 7730, + "None": 7731, + "Ġcolumns": 7732, + "Ġfractions": 7733, + "Ġcovered": 7734, + "ĠServ": 7735, + "Ġinform": 7736, + "bed": 7737, + "Ġattem": 7738, + "raining": 7739, + "Ġneutron": 7740, + "Ġrice": 7741, + "Ġmotif": 7742, + "Ġartificial": 7743, + "Ġinhibitory": 7744, + "Ġdt": 7745, + "AGE": 7746, + "Ġsampled": 7747, + "Ġbatter": 7748, + "Ġsubjected": 7749, + "Ġgeneric": 7750, + "ĠNH": 7751, + "Ġcontinue": 7752, + "utional": 7753, + "Ġaug": 7754, + "ius": 7755, + "Ġexecution": 7756, + "ĠWilli": 7757, + "ĠDespite": 7758, + "AMI": 7759, + "Ġcontents": 7760, + "ĠSens": 7761, + "ogens": 7762, + "Col": 7763, + "Ġfo": 7764, + "Ġaddi": 7765, + "uated": 7766, + "Ġrecommended": 7767, + "ĠSW": 7768, + "Ġarch": 7769, + "ĠYes": 7770, + "Ġhol": 7771, + "aturally": 7772, + "titive": 7773, + "Ġche": 7774, + "Ġsector": 7775, + "ĠDefinition": 7776, + "Ġconcepts": 7777, + "orous": 7778, + "small": 7779, + "erson": 7780, + "inator": 7781, + "ĠMT": 7782, + "Ġhypertension": 7783, + "cks": 7784, + "Ġnative": 7785, + "Ġtax": 7786, + "ryl": 7787, + "Ġreactive": 7788, + "rb": 7789, + "ducible": 7790, + "omm": 7791, + "Ġdiagnosed": 7792, + "Ġdriving": 7793, + "Ġbiomass": 7794, + "uate": 7795, + "Ġpil": 7796, + "called": 7797, + "Ġserve": 7798, + "Ġinterfer": 7799, + "ippocamp": 7800, + "Ġalgebraic": 7801, + "Ġbegan": 7802, + "Ġpicture": 7803, + "independent": 7804, + "Ġutilized": 7805, + "going": 7806, + "ora": 7807, + "nm": 7808, + "Ġdownstream": 7809, + "Ġorbital": 7810, + "ountain": 7811, + "ĠHis": 7812, + "Ġresol": 7813, + "Ġcorrections": 7814, + "onym": 7815, + "scripts": 7816, + "Ġsilicon": 7817, + "Ġcum": 7818, + "ĠTri": 7819, + "Ġpeptides": 7820, + "Ġreceiving": 7821, + "Ġstationary": 7822, + "ĠμL": 7823, + "clerosis": 7824, + "Ġmodules": 7825, + "ema": 7826, + "ĠAfrican": 7827, + "struction": 7828, + "Ġfarm": 7829, + "Ġlearn": 7830, + "node": 7831, + "®": 7832, + "Ġsuperconduc": 7833, + "ĠLinear": 7834, + "Ġtechnologies": 7835, + "Ġnecessarily": 7836, + "Ġcoronary": 7837, + "ĠEast": 7838, + "Ġframes": 7839, + "Ġsegmentation": 7840, + "Vs": 7841, + "Ġbehavioral": 7842, + "Îĵ": 7843, + "Ġlogic": 7844, + "Ġaccompan": 7845, + "tified": 7846, + "hanol": 7847, + "ĠInhib": 7848, + "ilation": 7849, + "ander": 7850, + "Ġeffort": 7851, + "ĠDen": 7852, + "DI": 7853, + "optim": 7854, + "terminal": 7855, + "Ġmobility": 7856, + "Ġconsideration": 7857, + "OVA": 7858, + "Ġparad": 7859, + "oxo": 7860, + "Ġdeficiency": 7861, + "ultural": 7862, + "Ġvalidity": 7863, + "Ġorders": 7864, + "Ġlocus": 7865, + "Ġarth": 7866, + "emat": 7867, + "Ġfeeding": 7868, + "Ġprogramming": 7869, + "Ġtemplate": 7870, + "elian": 7871, + "Ġoption": 7872, + "ĠFollowing": 7873, + "Ġenable": 7874, + "Ġassign": 7875, + "Ġformul": 7876, + "pu": 7877, + "Ġatmosphere": 7878, + "slant": 7879, + "ĠRuss": 7880, + "ĠEvidence": 7881, + "Ġsimilarly": 7882, + "Ġcamp": 7883, + "Ġwound": 7884, + "ĠCharacterization": 7885, + "ĠPBS": 7886, + "ees": 7887, + "ĠDirect": 7888, + "ĠSL": 7889, + "Ġfruit": 7890, + "Ġgate": 7891, + "ito": 7892, + "Chem": 7893, + "Ġcollision": 7894, + "ortic": 7895, + "Ġpolymorphism": 7896, + "enza": 7897, + "what": 7898, + "Ġexperimentally": 7899, + "Ġultra": 7900, + "ez": 7901, + "Ġnerv": 7902, + "Ġessentially": 7903, + "ĠAustralia": 7904, + "ĠStandard": 7905, + "Ġmedicine": 7906, + "adian": 7907, + "ĠHiggs": 7908, + "uge": 7909, + "Ġsupports": 7910, + "uma": 7911, + "Ġcomplicated": 7912, + "date": 7913, + "ophagy": 7914, + "ĠMarkov": 7915, + "Ġoccurring": 7916, + "oplus": 7917, + "Pub": 7918, + "prob": 7919, + "urable": 7920, + "Ġkept": 7921, + "Ġisolation": 7922, + "Ġevol": 7923, + "iliary": 7924, + "Ġregist": 7925, + "Ġholes": 7926, + "Ġclar": 7927, + "ipar": 7928, + "Ġenrich": 7929, + "Ġroute": 7930, + "ayers": 7931, + "ediatric": 7932, + "Ġpolynomials": 7933, + "Ġtrivial": 7934, + "ĠSam": 7935, + "variant": 7936, + "Ġfreedom": 7937, + "poss": 7938, + "Ġinference": 7939, + "ola": 7940, + "Ġinterpreted": 7941, + "Ca": 7942, + "emory": 7943, + "Ġcentury": 7944, + "ĠRem": 7945, + "ĠWu": 7946, + "Ġsuppression": 7947, + "Ġgenerator": 7948, + "ĠHom": 7949, + "Ġviscos": 7950, + "Ġpseudo": 7951, + "ĠChild": 7952, + "ĠSA": 7953, + "iber": 7954, + "Ġequivalence": 7955, + "ifies": 7956, + "ĠConsider": 7957, + "oline": 7958, + "âī¤": 7959, + "Ġdeple": 7960, + "Ġaveraged": 7961, + "Ġsouthern": 7962, + "Ġordered": 7963, + "ĠBrown": 7964, + "Ġmethylation": 7965, + "ĠAdap": 7966, + "Ġmaternal": 7967, + "onded": 7968, + "ĠBehavi": 7969, + "Ġidentifiers": 7970, + "Ġprocessed": 7971, + "GG": 7972, + "VI": 7973, + "Ġcha": 7974, + "unk": 7975, + "ĠFunctional": 7976, + "Ġhydroph": 7977, + "Ġfinancial": 7978, + "econd": 7979, + "ĠΨ": 7980, + "Ġemphas": 7981, + "Ġdefect": 7982, + "mar": 7983, + "Ġnorthern": 7984, + "core": 7985, + "Ġadhesion": 7986, + "Ġtele": 7987, + "Ġwarm": 7988, + "rifug": 7989, + "rangian": 7990, + "resolution": 7991, + "Ġhex": 7992, + "hbar": 7993, + "Ġharmonic": 7994, + "Ġcontrac": 7995, + "Ġreading": 7996, + "Ġefforts": 7997, + "ĠOl": 7998, + "Ġanxiety": 7999, + "bul": 8000, + "TC": 8001, + "ipid": 8002, + "Remark": 8003, + "Ġforming": 8004, + "ilbert": 8005, + "amond": 8006, + "Ġanalytic": 8007, + "orec": 8008, + "cha": 8009, + "ĠConsequently": 8010, + "ĠSu": 8011, + "forall": 8012, + "ĠÃŀ": 8013, + "Ġaspect": 8014, + "Ġinsights": 8015, + "ativity": 8016, + "iotics": 8017, + "heimer": 8018, + "ĠLabor": 8019, + "Ġaware": 8020, + "ĠBritish": 8021, + "chemical": 8022, + "Ġâĭ": 8023, + "clusion": 8024, + "ĠMich": 8025, + "Ġgrade": 8026, + "ĠSEM": 8027, + "ĠCirc": 8028, + "heses": 8029, + "WL": 8030, + "Ġenabl": 8031, + "Ġdend": 8032, + "Ġindustry": 8033, + "Ġimproves": 8034, + "tet": 8035, + "Ġtel": 8036, + "Ġwashed": 8037, + "Ġshorter": 8038, + "Ġincident": 8039, + "ĠActivity": 8040, + "Ġdoses": 8041, + "ĠBrazil": 8042, + "Ġtransformations": 8043, + "Ġformat": 8044, + "ĠProof": 8045, + "Ġlen": 8046, + "ulative": 8047, + "Ġcyclic": 8048, + "Ġrecruit": 8049, + "ptr": 8050, + "TH": 8051, + "Ġreceive": 8052, + "ĠNext": 8053, + "ĠExp": 8054, + "iant": 8055, + "instein": 8056, + "Set": 8057, + "rene": 8058, + "Ġgeomet": 8059, + "Ġconsiderable": 8060, + "So": 8061, + "ught": 8062, + "Ġpapers": 8063, + "ĠCS": 8064, + "za": 8065, + "Ġisomorphism": 8066, + "hou": 8067, + "Ġmutants": 8068, + "Ġportion": 8069, + "Ġþ": 8070, + "Ġcontinuum": 8071, + "Cu": 8072, + "ĠComputed": 8073, + "Ġcombining": 8074, + "ova": 8075, + "ĠNP": 8076, + "Ġcrack": 8077, + "Ġsometimes": 8078, + "Ġcontinued": 8079, + "Definition": 8080, + "arcin": 8081, + "ĠCd": 8082, + "ĠMedical": 8083, + "iences": 8084, + "ĠCross": 8085, + "Ġtranscriptional": 8086, + "ĠZe": 8087, + "std": 8088, + "iforn": 8089, + "Ġfailed": 8090, + "Ġidentifying": 8091, + "Ġmir": 8092, + "Ġmetastasis": 8093, + "OF": 8094, + "nn": 8095, + "ĠCID": 8096, + "Ġoscillations": 8097, + "ancies": 8098, + "write": 8099, + "Ġbandwidth": 8100, + "Ġtrade": 8101, + "Ġaging": 8102, + "ĠModeling": 8103, + "Ġassert": 8104, + "Ġcurrents": 8105, + "Ġfire": 8106, + "ubiqu": 8107, + "Ġalbum": 8108, + "Ġfrequent": 8109, + "Name": 8110, + "Ġpurch": 8111, + "Ġplayer": 8112, + "ĠEsc": 8113, + "Ġnotion": 8114, + "Ġinternational": 8115, + "ulum": 8116, + "oic": 8117, + "Ġincubation": 8118, + "Ġphenomena": 8119, + "Ġserver": 8120, + "uter": 8121, + "Ġven": 8122, + "quin": 8123, + "Ġhypox": 8124, + "ĠRF": 8125, + "iton": 8126, + "Error": 8127, + "Ġhemat": 8128, + "Ġthemselves": 8129, + "Ġperp": 8130, + "idual": 8131, + "Ġpurposes": 8132, + "mes": 8133, + "wing": 8134, + "rov": 8135, + "Ġemiss": 8136, + "Ġexperienced": 8137, + "ques": 8138, + "ĠLC": 8139, + "ĠRecent": 8140, + "book": 8141, + "Ġalkal": 8142, + "idx": 8143, + "hyth": 8144, + "Ġconcrete": 8145, + "Ġswitching": 8146, + "Ġexplanation": 8147, + "irds": 8148, + "Ġsigns": 8149, + "Ġobj": 8150, + "Ġcytokines": 8151, + "ubble": 8152, + "adder": 8153, + "Ġuncertainties": 8154, + "Ġpromotes": 8155, + "Ġcompl": 8156, + "Ġscan": 8157, + "Ġprime": 8158, + "PH": 8159, + "Ġheterogeneous": 8160, + "ĠYou": 8161, + "Although": 8162, + "Ġserious": 8163, + "Ġdrive": 8164, + "Ġheterogeneity": 8165, + "rystall": 8166, + "Ġod": 8167, + "Ġconvolution": 8168, + "ĠâĬĨ": 8169, + "ĠSpace": 8170, + "Ġgastric": 8171, + "ĠStre": 8172, + "ĠPV": 8173, + "base": 8174, + "Met": 8175, + "Ġlosses": 8176, + "Ġcytotox": 8177, + "Ġcontrolling": 8178, + "lease": 8179, + "Ġregulated": 8180, + "ĠEngine": 8181, + "ĠHospital": 8182, + "Br": 8183, + "onom": 8184, + "hyde": 8185, + "stage": 8186, + "Ġgiving": 8187, + "ĠPen": 8188, + "ĠSociety": 8189, + "driven": 8190, + "iang": 8191, + "Ġmodifications": 8192, + "BV": 8193, + "Ġacceleration": 8194, + "Ġmilk": 8195, + "onomic": 8196, + "Ġthink": 8197, + "oglob": 8198, + "Ġfeasible": 8199, + "nam": 8200, + "Ġreflection": 8201, + "ĠPoly": 8202, + "Ġsummarized": 8203, + "FL": 8204, + "Ġrect": 8205, + "Ġpredominant": 8206, + "Ġblot": 8207, + "dehyde": 8208, + "Ġtransformed": 8209, + "Ġfacilitate": 8210, + "ĠCarlo": 8211, + "Ġgreatly": 8212, + "ĠSocial": 8213, + "Ġparents": 8214, + "bigg": 8215, + "rospective": 8216, + "Ġprognosis": 8217, + "Ġcharacterize": 8218, + "Ġconnectivity": 8219, + "Ġtrajectories": 8220, + "ĠSH": 8221, + "Ġlies": 8222, + "Ġcandidates": 8223, + "romy": 8224, + "Ġsor": 8225, + "ĠIns": 8226, + "Ġthor": 8227, + "Ġmetals": 8228, + "ĠSV": 8229, + "Ġtiming": 8230, + "Ġutility": 8231, + "Ġnewly": 8232, + "ĠIFN": 8233, + "Ġaffecting": 8234, + "cement": 8235, + "ĠMel": 8236, + "ĠÌģ": 8237, + "types": 8238, + "lysis": 8239, + "ercul": 8240, + "Ġdistor": 8241, + "actors": 8242, + "psy": 8243, + "Ġbook": 8244, + "ĠEven": 8245, + "temperature": 8246, + "Ġinvasion": 8247, + "Ġrecognized": 8248, + "factor": 8249, + "Ne": 8250, + "Ġintersection": 8251, + "Ġcortical": 8252, + "ng": 8253, + "Ġdeploy": 8254, + "Ġamplitudes": 8255, + "Ġda": 8256, + "ĠGC": 8257, + "Ġchallenging": 8258, + "Ġprelim": 8259, + "GM": 8260, + "Acc": 8261, + "Ġfourth": 8262, + "alc": 8263, + "ĠPS": 8264, + "ĠGenetic": 8265, + "lock": 8266, + "error": 8267, + "skip": 8268, + "sime": 8269, + "Ġana": 8270, + "simeq": 8271, + "Ġcerebral": 8272, + "ĠEX": 8273, + "aved": 8274, + "rophy": 8275, + "idopsis": 8276, + "Ġbehind": 8277, + "Ġenables": 8278, + "Ġindustrial": 8279, + "ĠPac": 8280, + "Ġdefinitions": 8281, + "Ġcatalytic": 8282, + "Ġdissip": 8283, + "ervical": 8284, + "Ġcommut": 8285, + "Ġrepeat": 8286, + "Ġchiral": 8287, + "Ġpron": 8288, + "pol": 8289, + "Ġgoing": 8290, + "Ġmicroscope": 8291, + "Ġhealthcare": 8292, + "ĠClassification": 8293, + "titude": 8294, + "ĠFermi": 8295, + "Ġhttp": 8296, + "arest": 8297, + "Ġsupporting": 8298, + "Ġwood": 8299, + "night": 8300, + "Ġkinetics": 8301, + "Ġsubsets": 8302, + "Ġsubunit": 8303, + "ĠCanada": 8304, + "aton": 8305, + "Ġaccurately": 8306, + "Ġresistant": 8307, + "Ġï̽": 8308, + "riction": 8309, + "Ġchamber": 8310, + "igue": 8311, + "ĠPhil": 8312, + "Ġrecover": 8313, + "cs": 8314, + "Ġsphere": 8315, + "ĠSpecifically": 8316, + "Ġanne": 8317, + "Ġinitiation": 8318, + "ĠTH": 8319, + "Ġbud": 8320, + "ordered": 8321, + "Ġdielectric": 8322, + "ĠCollege": 8323, + "Ġproducing": 8324, + "Ġantenna": 8325, + "Bs": 8326, + "ĠFrench": 8327, + "OX": 8328, + "ĠAmerica": 8329, + "ĠâĢĶ": 8330, + "ounting": 8331, + "fully": 8332, + "Ġserved": 8333, + "Ġresidue": 8334, + "Ġarguments": 8335, + "Ġpand": 8336, + "Ġcompany": 8337, + "Ġconditional": 8338, + "mia": 8339, + "ĠQCD": 8340, + "Ġviscosity": 8341, + "Ġprospective": 8342, + "asonal": 8343, + "Ġdominated": 8344, + "Ġpenet": 8345, + "opo": 8346, + "Ġnine": 8347, + "ĠIll": 8348, + "ĠVisual": 8349, + "Ġfiles": 8350, + "Ġyeast": 8351, + "Ġthank": 8352, + "GN": 8353, + "real": 8354, + "Ġverified": 8355, + "ĠIndian": 8356, + "Ġstiff": 8357, + "rological": 8358, + "Ġdram": 8359, + "Ġtight": 8360, + "ĠGerman": 8361, + "ĠTechnology": 8362, + "ĠApproach": 8363, + "romatic": 8364, + "Ġacoustic": 8365, + "tian": 8366, + "osin": 8367, + "ĠDepartment": 8368, + "otropy": 8369, + "Ġempty": 8370, + "trivial": 8371, + "ofil": 8372, + "Ġalgebras": 8373, + "texts": 8374, + "Ġwebs": 8375, + "Ġpore": 8376, + "Ġpacket": 8377, + "Time": 8378, + "img": 8379, + "ony": 8380, + "ritic": 8381, + "Ġvelocities": 8382, + "ĠDynamics": 8383, + "Ġcancers": 8384, + "Ġtrunc": 8385, + "ĠFormation": 8386, + "ĠDonor": 8387, + "ĠMit": 8388, + "IST": 8389, + "Ġconcluded": 8390, + "Ġantag": 8391, + "ĠSoft": 8392, + "append": 8393, + "Ġfragments": 8394, + "ĠProf": 8395, + "Ġfluor": 8396, + "ĠJac": 8397, + "ĠSn": 8398, + "Ġlept": 8399, + "Ġsplitting": 8400, + "Ġsexual": 8401, + "ĠFore": 8402, + "ĠGener": 8403, + "Ġneighborhood": 8404, + "Ġbenchmark": 8405, + "ĠRA": 8406, + "Ġdivision": 8407, + "ifornia": 8408, + "True": 8409, + "Ġfuzzy": 8410, + "Ġtro": 8411, + "cents": 8412, + "Ġconstitu": 8413, + "atial": 8414, + "astern": 8415, + "ĠTim": 8416, + "Ġperception": 8417, + "Ġsubstanti": 8418, + "Ġmacro": 8419, + "Ġoutl": 8420, + "ĠObserv": 8421, + "prising": 8422, + "oked": 8423, + "orectal": 8424, + "ĠCho": 8425, + "ĠDifferent": 8426, + "Ġinvestigations": 8427, + "Ġconsistency": 8428, + "ients": 8429, + "ĠFOR": 8430, + "ASS": 8431, + "ĠVan": 8432, + "Ġsituations": 8433, + "ĠBR": 8434, + "Ġinfrared": 8435, + "ymal": 8436, + "Ġpixels": 8437, + "Ġcarrier": 8438, + "sen": 8439, + "INT": 8440, + "Ġefficiently": 8441, + "DT": 8442, + "ĠExpl": 8443, + "ionic": 8444, + "Ġnaturally": 8445, + "Ġpropos": 8446, + "Ġguide": 8447, + "Ġconclusions": 8448, + "oon": 8449, + "Ġgrant": 8450, + "Ġinstances": 8451, + "Ġreviewed": 8452, + "Ġelectromagnetic": 8453, + "Ġthreat": 8454, + "edia": 8455, + "ĠOptimization": 8456, + "ĠBio": 8457, + "Ġtrigger": 8458, + "icient": 8459, + "otypic": 8460, + "Ġstret": 8461, + "Ġantic": 8462, + "Ġtoxic": 8463, + "Ġspinal": 8464, + "UPAC": 8465, + "Ġoverview": 8466, + "otion": 8467, + "Ġstraightforward": 8468, + "Ġpositively": 8469, + "aste": 8470, + "Ġreferences": 8471, + "ulose": 8472, + "ĠGre": 8473, + "Ġantagon": 8474, + "Ġshifts": 8475, + "Ġdrawn": 8476, + "ĠWhite": 8477, + "Ġfractional": 8478, + "Ġbundle": 8479, + "Ġexhibits": 8480, + "Ġreservoir": 8481, + "ĠAlex": 8482, + "Ġaggregation": 8483, + "Ġcircle": 8484, + "Ġpractices": 8485, + "ĠCoval": 8486, + "ĠDistribution": 8487, + "Ġtang": 8488, + "ĠMut": 8489, + "Ġregulate": 8490, + "osphere": 8491, + "iro": 8492, + "AMINO": 8493, + "vest": 8494, + "Ġphotos": 8495, + "Ġevident": 8496, + "Ġbusiness": 8497, + "control": 8498, + "Ġworth": 8499, + "ĠPoisson": 8500, + "ĠArabidopsis": 8501, + "ĠTarget": 8502, + "Ġregulates": 8503, + "ĠIr": 8504, + "ĠAdv": 8505, + "Ġensemble": 8506, + "pring": 8507, + "Ġprice": 8508, + "ĠFL": 8509, + "ĠImpact": 8510, + "Ġeventually": 8511, + "inating": 8512, + "Ġcentrifug": 8513, + "frame": 8514, + "Ġdiagrams": 8515, + "Ġtag": 8516, + "Ġtry": 8517, + "surface": 8518, + "ĠIdentifiers": 8519, + "rained": 8520, + "Ġsides": 8521, + "Ġinn": 8522, + "Ġflexible": 8523, + "Ġsatellite": 8524, + "Ġaffinity": 8525, + "Ġsummer": 8526, + "GP": 8527, + "amb": 8528, + "Ġaqu": 8529, + "String": 8530, + "treatment": 8531, + "ĠDynamic": 8532, + "mathop": 8533, + "Ġnotice": 8534, + "nes": 8535, + "rowave": 8536, + "vestig": 8537, + "Ġoutputs": 8538, + "Ġcoherent": 8539, + "Ġillustrate": 8540, + "Ġvalidated": 8541, + "ĠSchem": 8542, + "Ġasked": 8543, + "batch": 8544, + "Ġpurified": 8545, + "Ġminimize": 8546, + "ĠDE": 8547, + "UM": 8548, + "check": 8549, + "varian": 8550, + "ĠGold": 8551, + "ylene": 8552, + "IO": 8553, + "Ġcholesterol": 8554, + "PubChem": 8555, + "ĠKore": 8556, + "ĠCounty": 8557, + "Ġii": 8558, + "ĠMAP": 8559, + "ectomy": 8560, + "Ġsemantic": 8561, + "Ġcollagen": 8562, + "Ġperceived": 8563, + "ichia": 8564, + "Ġadministered": 8565, + "containing": 8566, + "rank": 8567, + "InChI": 8568, + "Ġirradiation": 8569, + "Ġlogarithm": 8570, + "Ġgames": 8571, + "Ġinjected": 8572, + "ĠMHz": 8573, + "Ġdors": 8574, + "Ġevaluating": 8575, + "ĠHyper": 8576, + "Ġchromatography": 8577, + "phen": 8578, + "ĠKar": 8579, + "Ġantimicrobial": 8580, + "riend": 8581, + "Ġdescribing": 8582, + "Ġwt": 8583, + "Ġhormone": 8584, + "AK": 8585, + "ĠIUPAC": 8586, + "Ga": 8587, + "Ġvitamin": 8588, + "Ġconnections": 8589, + "uous": 8590, + "ĠLine": 8591, + "Ġbeneficial": 8592, + "cases": 8593, + "icated": 8594, + "isks": 8595, + "parent": 8596, + "Id": 8597, + "eries": 8598, + "run": 8599, + "Ġmind": 8600, + "itt": 8601, + "sulf": 8602, + "zheimer": 8603, + "Ġinterf": 8604, + "Vert": 8605, + "Ġanth": 8606, + "ologous": 8607, + "ĠLife": 8608, + "Ġmur": 8609, + "Ġpermut": 8610, + "oting": 8611, + "Ġneutrino": 8612, + "Ġborn": 8613, + "pmatrix": 8614, + "ĠCalifornia": 8615, + "agent": 8616, + "Ġcollisions": 8617, + "ĠNS": 8618, + "Ġhippocamp": 8619, + "Ġpowder": 8620, + "Ġvaries": 8621, + "Ġepidem": 8622, + "ĠWeb": 8623, + "uler": 8624, + "Ġinterested": 8625, + "Ġdevelopmental": 8626, + "Ġlengths": 8627, + "Ġcolour": 8628, + "Ġquas": 8629, + "ĠRich": 8630, + "Eq": 8631, + "Ġinfants": 8632, + "ĠPH": 8633, + "ophila": 8634, + "Ġcausing": 8635, + "Ge": 8636, + "module": 8637, + "IB": 8638, + "Ġcontributed": 8639, + "rose": 8640, + "Ġcytoplas": 8641, + "--------------------------------": 8642, + "Ġroad": 8643, + "symmetric": 8644, + "Us": 8645, + "Ġweakly": 8646, + "tite": 8647, + "Ġdefines": 8648, + "ĠPE": 8649, + "Ġmetabolites": 8650, + "Ġlob": 8651, + "Ġterminal": 8652, + "Ġdemonstrates": 8653, + "ĠAcceptor": 8654, + "ĠClo": 8655, + "Ġinferred": 8656, + "Ġvill": 8657, + "First": 8658, + "Ġneglig": 8659, + "Ġwireless": 8660, + "Ab": 8661, + "particle": 8662, + "oisotopic": 8663, + "Ġexcited": 8664, + "PM": 8665, + "Ġconsecutive": 8666, + "ĠIsotype": 8667, + "Ġstimulus": 8668, + "ĠMC": 8669, + "timate": 8670, + "ĠCovalently": 8671, + "Bonded": 8672, + "Ġyellow": 8673, + "Ġalloy": 8674, + "density": 8675, + "Ġfilters": 8676, + "Ġamplification": 8677, + "Ġwon": 8678, + "ht": 8679, + "Ġimpacts": 8680, + "Ġstaff": 8681, + "ĠâĪĢ": 8682, + "ĠIsomeric": 8683, + "Ġsmoking": 8684, + "Qu": 8685, + "Ġcaptured": 8686, + "haps": 8687, + "ĠNULL": 8688, + "Ġriver": 8689, + "count": 8690, + "Ġmanifest": 8691, + "Ġdiabetic": 8692, + "Ġalterations": 8693, + "ĠRotatable": 8694, + "ĠPRO": 8695, + "ĠMonoisotopic": 8696, + "ĠïĤ": 8697, + "spect": 8698, + "Ġcatalyst": 8699, + "Ġmodeled": 8700, + "Ġpage": 8701, + "ĠROS": 8702, + "ĠCanonicalized": 8703, + "ĠTw": 8704, + "Ġaux": 8705, + "avage": 8706, + "ĠRaman": 8707, + "sto": 8708, + "perf": 8709, + "Ġreplacement": 8710, + "ĠEnvironment": 8711, + "Ġacting": 8712, + "pati": 8713, + "ificant": 8714, + "through": 8715, + "Ġsaturation": 8716, + "Ġtip": 8717, + "Ġrecurrence": 8718, + "ĠHistory": 8719, + "Ġprotective": 8720, + "Ġburden": 8721, + "ado": 8722, + "yes": 8723, + "inst": 8724, + "Ap": 8725, + "ĠSy": 8726, + "Ġphon": 8727, + "ĠâĪij": 8728, + "Ġgenotype": 8729, + "Ġcovariance": 8730, + "Ġquickly": 8731, + "ĠDu": 8732, + "Ġsug": 8733, + "Ġdecline": 8734, + "ĠTB": 8735, + "Ġstrictly": 8736, + "Ġmoist": 8737, + "undred": 8738, + "ĠCB": 8739, + "atile": 8740, + "ĠHF": 8741, + "Ġarticles": 8742, + "Ġps": 8743, + "ĠEnh": 8744, + "isting": 8745, + "Ġbiology": 8746, + "Ġbodies": 8747, + "ĠAk": 8748, + "ĠNumerical": 8749, + "ĠLagrangian": 8750, + "Ġdiscovered": 8751, + "Ġvic": 8752, + "opes": 8753, + "Ġfragment": 8754, + "Ġty": 8755, + "ismic": 8756, + "Ġhepatic": 8757, + "Ġenriched": 8758, + "pan": 8759, + "Ġinfluences": 8760, + "ĠLake": 8761, + "color": 8762, + "Ġenrichment": 8763, + "ochemistry": 8764, + "Ġunstable": 8765, + "ĠIgG": 8766, + "derly": 8767, + "Ġecos": 8768, + "Ġconcerning": 8769, + "ĠRisk": 8770, + "Ġmargin": 8771, + "Ġpathogenesis": 8772, + "Ġpump": 8773, + "Ġpreliminary": 8774, + "Ġtumour": 8775, + "Further": 8776, + "azole": 8777, + "Ġelectrodes": 8778, + "Ġdial": 8779, + "ubes": 8780, + "ĠNatural": 8781, + "ĠMul": 8782, + "ĠïĢŃ": 8783, + "Ġnic": 8784, + "Ġimped": 8785, + "only": 8786, + "Ġcomparative": 8787, + "rection": 8788, + "aki": 8789, + "Ġrend": 8790, + "Ġsparse": 8791, + "Ġindicator": 8792, + "location": 8793, + "tism": 8794, + "activated": 8795, + "ĠPb": 8796, + "eptide": 8797, + "Ġendogenous": 8798, + "Ġcenters": 8799, + "ao": 8800, + "sw": 8801, + "Ġconsensus": 8802, + "Ġattributes": 8803, + "Ġsafe": 8804, + "Ġbelieve": 8805, + "ovirus": 8806, + "Ġimmunity": 8807, + "Ġfitted": 8808, + "Ġcontributes": 8809, + "iable": 8810, + "Ġviruses": 8811, + "Ġinsight": 8812, + "ĠNovel": 8813, + "ĠAlzheimer": 8814, + "cepted": 8815, + "ĠPt": 8816, + "Ġcentre": 8817, + "nat": 8818, + "Ġbiosynthesis": 8819, + "mits": 8820, + "Ġchemistry": 8821, + "Ġjus": 8822, + "anish": 8823, + "Ġrefrac": 8824, + "ĠTor": 8825, + "Ġpanels": 8826, + "Ġimply": 8827, + "Ġmatched": 8828, + "usc": 8829, + "word": 8830, + "vae": 8831, + "ĠStar": 8832, + "syn": 8833, + "Mat": 8834, + "Ġapplicable": 8835, + "ĠPseud": 8836, + "ampions": 8837, + "ĠRen": 8838, + "Ġusage": 8839, + "ĠLight": 8840, + "prec": 8841, + "Ġfibrosis": 8842, + "Ġreconstruc": 8843, + "ĠON": 8844, + "ĠGHz": 8845, + "GD": 8846, + "algebra": 8847, + "iger": 8848, + "Ġdecisions": 8849, + "infected": 8850, + "knowledg": 8851, + "Ġexpressing": 8852, + "Ġmyocardial": 8853, + "ordination": 8854, + "Ġprognostic": 8855, + "Ġfibrobl": 8856, + "Ġacceler": 8857, + "ĠAssessment": 8858, + "Ġconstrained": 8859, + "Ġallele": 8860, + "ride": 8861, + "Ġrequest": 8862, + "abilistic": 8863, + "teb": 8864, + "Ġga": 8865, + "Ġrecovered": 8866, + "Ġpromin": 8867, + "urses": 8868, + "ĠHC": 8869, + "ĠMur": 8870, + "ĠEqs": 8871, + "Ġdefining": 8872, + "Ġmer": 8873, + "image": 8874, + "Ġorganisms": 8875, + "grad": 8876, + "Ġreflected": 8877, + "elastic": 8878, + "eties": 8879, + "dimethyl": 8880, + "ELO": 8881, + "random": 8882, + "ĠDiagn": 8883, + "erculosis": 8884, + "rob": 8885, + "Ġmoments": 8886, + "ĠEC": 8887, + "Ġexperiences": 8888, + "erving": 8889, + "ĠNC": 8890, + "Ġvortex": 8891, + "gre": 8892, + "structures": 8893, + "elt": 8894, + "Ġcarry": 8895, + "ĠThrough": 8896, + "Ġpreced": 8897, + "rastruct": 8898, + "itus": 8899, + "Ġpsychological": 8900, + "Ġlimiting": 8901, + "two": 8902, + "ĠBound": 8903, + "ĠCre": 8904, + "ĠSmith": 8905, + "Ġcast": 8906, + "Ġcompetition": 8907, + "sch": 8908, + "Ġcapability": 8909, + "achment": 8910, + "Ġinhibits": 8911, + "ð": 8912, + "ĠDifferential": 8913, + "Ġautomatically": 8914, + "Ġgest": 8915, + "Ġwaters": 8916, + "Ġuniqu": 8917, + "zer": 8918, + "Equ": 8919, + "Ġstudying": 8920, + "Ġdied": 8921, + "Ġos": 8922, + "Ġrecombination": 8923, + "uncil": 8924, + "Ġpathogen": 8925, + "GFR": 8926, + "UV": 8927, + "eneration": 8928, + "ĠSta": 8929, + "Ġinstant": 8930, + "Ġproven": 8931, + "Ġds": 8932, + "Ġdamp": 8933, + "Next": 8934, + "ĠYoung": 8935, + "Ġpowerful": 8936, + "Ġwriting": 8937, + "kl": 8938, + "Ġcareer": 8939, + "ĠCorollary": 8940, + "Ns": 8941, + "Ġ�": 8942, + "ĠMil": 8943, + "Ġburn": 8944, + "ticular": 8945, + "ondon": 8946, + "Pr": 8947, + "ĠLin": 8948, + "ĠJapanese": 8949, + "ĠLab": 8950, + "Ġstrip": 8951, + "protein": 8952, + "Ġhour": 8953, + "anglement": 8954, + "anguages": 8955, + "rd": 8956, + "parse": 8957, + "Ġemissions": 8958, + "Hence": 8959, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 8960, + "Ġjob": 8961, + "ĠAS": 8962, + "Ġaxial": 8963, + "ĠTur": 8964, + "carbon": 8965, + "MF": 8966, + "ĠNE": 8967, + "Ġarise": 8968, + "Ġlinearly": 8969, + "Ġprolong": 8970, + "Ġleak": 8971, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 8972, + "Ġmoved": 8973, + "orbidity": 8974, + "Ġprofessional": 8975, + "code": 8976, + "osine": 8977, + "Ġpolic": 8978, + "Ġbonds": 8979, + "mask": 8980, + "Ġconverted": 8981, + "ville": 8982, + "ectious": 8983, + "parallel": 8984, + "ĠHal": 8985, + "ĠTGF": 8986, + "mental": 8987, + "Ġreader": 8988, + "Ġstandards": 8989, + "ago": 8990, + "ĠEN": 8991, + "Ġstations": 8992, + "Ġnormalization": 8993, + "ĠÎĺ": 8994, + "chain": 8995, + "What": 8996, + "Ġtomography": 8997, + "Ġentries": 8998, + "blue": 8999, + "ĠPrevious": 9000, + "ias": 9001, + "Ġquestionnaire": 9002, + "Ġhaz": 9003, + "Ġhomology": 9004, + "very": 9005, + "Ġnucleotide": 9006, + "ĠGenome": 9007, + "Ġμl": 9008, + "Ġutilization": 9009, + "Ġpolymers": 9010, + "rote": 9011, + "Ġsmallest": 9012, + "calc": 9013, + "Ġspl": 9014, + "Ġtension": 9015, + "Ġdiscontinu": 9016, + "ala": 9017, + "hol": 9018, + "Ġdetermines": 9019, + "Ġproj": 9020, + "ĠOverall": 9021, + "Ġble": 9022, + "fo": 9023, + "Ġprinciples": 9024, + "Ġinteracting": 9025, + "Ġhardware": 9026, + "life": 9027, + "ails": 9028, + "Ġdifficulty": 9029, + "Ġchoices": 9030, + "Ġcard": 9031, + "Ġlact": 9032, + "Ġroll": 9033, + "Ġquantified": 9034, + "ĠScientific": 9035, + "Ġlandsc": 9036, + "aligned": 9037, + "Ġcomposites": 9038, + "herichia": 9039, + "Ġenvelop": 9040, + "itig": 9041, + "Ste": 9042, + "Ġcompet": 9043, + "Ġimpairment": 9044, + "Ġclosure": 9045, + "Ġreturned": 9046, + "Ġreceiver": 9047, + "Ġpeer": 9048, + "Ġconsent": 9049, + "Ġultras": 9050, + "Ġphotons": 9051, + "Ġsuppose": 9052, + "Ġpredicting": 9053, + "ĠâĬķ": 9054, + "Ġcompan": 9055, + "Ġnegligible": 9056, + "current": 9057, + "umber": 9058, + "Ġcompatible": 9059, + "iop": 9060, + "ĠStructural": 9061, + "Ref": 9062, + "Ġson": 9063, + "Ġequality": 9064, + "Ġconsisted": 9065, + "Ġvibr": 9066, + "oupling": 9067, + "vation": 9068, + "Ġovercome": 9069, + "super": 9070, + "lict": 9071, + "Ġpancreatic": 9072, + "Gs": 9073, + "aped": 9074, + "asal": 9075, + "wan": 9076, + "Ġlatent": 9077, + "Ġcovering": 9078, + "Ġlesion": 9079, + "iance": 9080, + "ĠFT": 9081, + "wood": 9082, + "jecture": 9083, + "ĠBC": 9084, + "linked": 9085, + "ĠLaw": 9086, + "Ġemit": 9087, + "Ġunclear": 9088, + "Ġprem": 9089, + "acted": 9090, + "polar": 9091, + "cre": 9092, + "Ġmodulus": 9093, + "ropath": 9094, + "Sub": 9095, + "ami": 9096, + "Ġpick": 9097, + "ERR": 9098, + "Ġmovements": 9099, + "Ni": 9100, + "Ġmechanics": 9101, + "odic": 9102, + "Ġgal": 9103, + "ĠManagement": 9104, + "host": 9105, + "ewise": 9106, + "ĠTotal": 9107, + "ĠInfluence": 9108, + "Ġubiqu": 9109, + "rophys": 9110, + "Ġcaps": 9111, + "Ġparticipant": 9112, + "Ġpolyp": 9113, + "td": 9114, + "Ġiterations": 9115, + "dominal": 9116, + "BB": 9117, + "Ġcharacters": 9118, + "Ġdeviations": 9119, + "resistant": 9120, + "Ġmalaria": 9121, + "Ġremote": 9122, + "hskip": 9123, + "Ġunderwent": 9124, + "util": 9125, + "block": 9126, + "uclide": 9127, + "Φ": 9128, + "electron": 9129, + "Ġsensory": 9130, + "ĠSimulation": 9131, + "Ġreward": 9132, + "Ġpandemic": 9133, + "Ġbor": 9134, + "ynthetic": 9135, + "Ġinvasive": 9136, + "RF": 9137, + "ĠSmall": 9138, + "ĠFisher": 9139, + "valent": 9140, + "ĠMI": 9141, + "rocytes": 9142, + "ĠTE": 9143, + "Ġstre": 9144, + "Ġperturbations": 9145, + "Ġsimplicity": 9146, + "ĠGrowth": 9147, + "ĠÎł": 9148, + "Ġinoc": 9149, + "arding": 9150, + "atum": 9151, + "multi": 9152, + "ĠDiv": 9153, + "anes": 9154, + "acillus": 9155, + "Ġlifetime": 9156, + "ĠHep": 9157, + "Ġaz": 9158, + "usp": 9159, + "ĠAssume": 9160, + "Ġbreaking": 9161, + "ĠAtt": 9162, + "ticipants": 9163, + "Ġluminosity": 9164, + "Ġdonor": 9165, + "params": 9166, + "ohyd": 9167, + "Ġprogen": 9168, + "ĠPO": 9169, + "GO": 9170, + "ĠLeg": 9171, + "Ġbiomarkers": 9172, + "Ġrural": 9173, + "Ġneon": 9174, + "gluc": 9175, + "ĠPB": 9176, + "Ġguid": 9177, + "Ġcervical": 9178, + "pace": 9179, + "Ġcord": 9180, + "umn": 9181, + "Ġsubspace": 9182, + "Ġattached": 9183, + "Ġdeposited": 9184, + "Ġindicators": 9185, + "ĠSF": 9186, + "quire": 9187, + "Ġdissolved": 9188, + "rite": 9189, + "ĠNA": 9190, + "Ġju": 9191, + "Ġaddressed": 9192, + "Ġsuppressed": 9193, + "Ġpneumonia": 9194, + "Ġsession": 9195, + "ĠChe": 9196, + "ĠFer": 9197, + "Ġaccordance": 9198, + "Des": 9199, + "Ġquar": 9200, + "Ġfitness": 9201, + "Ġviability": 9202, + "osh": 9203, + "Ġphylogenetic": 9204, + "ectin": 9205, + "pat": 9206, + "ĠFrance": 9207, + "Ġmessages": 9208, + "Ġloci": 9209, + "Ġconflict": 9210, + "Ġrelevance": 9211, + "Ġinstructions": 9212, + "Ġsomewhat": 9213, + "changed": 9214, + "Ġcorrectly": 9215, + "ozyg": 9216, + "avig": 9217, + "ĠLat": 9218, + "Ġovarian": 9219, + "ĠRemark": 9220, + "joint": 9221, + "aint": 9222, + "west": 9223, + "sample": 9224, + "Ġdivergence": 9225, + "Ġhair": 9226, + "agonal": 9227, + "Ġmim": 9228, + "Ġimmediate": 9229, + "ĠPort": 9230, + "Ġoffers": 9231, + "Ġdepicted": 9232, + "Ġhydrox": 9233, + "ĠTow": 9234, + "Ġemerging": 9235, + "oupled": 9236, + "Ġhundred": 9237, + "Ġadapted": 9238, + "eller": 9239, + "ĠRelations": 9240, + "ette": 9241, + "Ġgastro": 9242, + "Ġmorphism": 9243, + "Ġequipment": 9244, + "pop": 9245, + "unately": 9246, + "Ġtransplantation": 9247, + "ifiers": 9248, + "Ġelderly": 9249, + "onucle": 9250, + "Ġrefers": 9251, + "arial": 9252, + "ĠCommittee": 9253, + "Ġmalignant": 9254, + "omonas": 9255, + "Ġallocation": 9256, + "ogether": 9257, + "Ġnanot": 9258, + "plot": 9259, + "ĠMes": 9260, + "Ġplanar": 9261, + "ells": 9262, + "source": 9263, + "owski": 9264, + "Ġna": 9265, + "Ġclock": 9266, + "Ġambient": 9267, + "ocene": 9268, + "Ġfluorescent": 9269, + "Ġvalu": 9270, + "ĠMagnetic": 9271, + "Ġdepart": 9272, + "phosphate": 9273, + "Ġroughly": 9274, + "Ġneither": 9275, + "ĠAltern": 9276, + "Ġstay": 9277, + "Ġspot": 9278, + "ĠEnt": 9279, + "Ġseconds": 9280, + "hard": 9281, + "Ġrecurrent": 9282, + "Ġpatch": 9283, + "Ġlimitation": 9284, + "ĠDer": 9285, + "Ġsharp": 9286, + "Ġexpectation": 9287, + "ĠLore": 9288, + "dict": 9289, + "Reg": 9290, + "Ġneutroph": 9291, + "Ġnur": 9292, + "Ġstarts": 9293, + "ostasis": 9294, + "Ġorganized": 9295, + "ĠcDNA": 9296, + "orient": 9297, + "ĠExample": 9298, + "ĠFund": 9299, + "aylor": 9300, + "idering": 9301, + "Ġtriple": 9302, + "nic": 9303, + "Ġattacks": 9304, + "ĠDros": 9305, + "è": 9306, + "ĠEM": 9307, + "Ġoptimum": 9308, + "Ġpull": 9309, + "Ġce": 9310, + "eryth": 9311, + "Ġrating": 9312, + "Ġreproductive": 9313, + "Ġdecades": 9314, + "Ġreplace": 9315, + "List": 9316, + "ĠFast": 9317, + "Ġredshift": 9318, + "opsy": 9319, + "illa": 9320, + "double": 9321, + "tera": 9322, + "Ġgoals": 9323, + "ĠSk": 9324, + "INE": 9325, + "Ġbiochemical": 9326, + "uint": 9327, + "Ġfetal": 9328, + "ĠRiemann": 9329, + "uries": 9330, + "Ġpp": 9331, + "Ġsymbols": 9332, + "ĠKa": 9333, + "Di": 9334, + "ĠGalax": 9335, + "ĠCompared": 9336, + "Ġcasc": 9337, + "Ġbits": 9338, + "Ġscaff": 9339, + "Ġestimator": 9340, + "ĠAdditional": 9341, + "Ġimprovements": 9342, + "ectives": 9343, + "Ġhous": 9344, + "ĠMagn": 9345, + "Ġmultivariate": 9346, + "Ġagric": 9347, + "vo": 9348, + "utter": 9349, + "ĠAcknowledg": 9350, + "su": 9351, + "Ġammon": 9352, + "Ġaims": 9353, + "Ġzinc": 9354, + "Ġelong": 9355, + "ĠGO": 9356, + "Question": 9357, + "including": 9358, + "LogP": 9359, + "Ġintellig": 9360, + "Ġcone": 9361, + "ĠFoundation": 9362, + "Ġimpaired": 9363, + "Ġillness": 9364, + "ĠEscherichia": 9365, + "Ġabundant": 9366, + "scal": 9367, + "ensively": 9368, + "Ġnegatively": 9369, + "parameter": 9370, + "Ġpermeability": 9371, + "domain": 9372, + "rated": 9373, + "Ġepoch": 9374, + "Ġadolescents": 9375, + "Ġdefic": 9376, + "ĠEstimation": 9377, + "Ġroutine": 9378, + "Per": 9379, + "tol": 9380, + "Ġelliptic": 9381, + "ĠHE": 9382, + "oblast": 9383, + "Ġreaches": 9384, + "Ġfluxes": 9385, + "Ġsun": 9386, + "ĠAnaly": 9387, + "âĢľ": 9388, + "ĠXLogP": 9389, + "Ġfiltering": 9390, + "rian": 9391, + "ĠScal": 9392, + "Ġpin": 9393, + "ĠTiO": 9394, + "iments": 9395, + "Ġmarginal": 9396, + "Ġrecombinant": 9397, + "Ġencour": 9398, + "Ġalumin": 9399, + "Ġtf": 9400, + "atalytic": 9401, + "Ġobservational": 9402, + "Ġgeneralization": 9403, + "Ġ": 9404, + "Ġantibiotic": 9405, + "Ġgenerates": 9406, + "ĠdB": 9407, + "Spec": 9408, + "rically": 9409, + "Ġvaluable": 9410, + "Ġtopic": 9411, + "Ġtermin": 9412, + "Ġsemicon": 9413, + "Ġquantification": 9414, + "ubb": 9415, + "Ġkinem": 9416, + "erring": 9417, + "Ġaeros": 9418, + "pack": 9419, + "Ġfewer": 9420, + "Ġfatigue": 9421, + "Ġgoes": 9422, + "Ġnight": 9423, + "ĠUs": 9424, + "â̬": 9425, + "ĠPrinc": 9426, + "Ġspring": 9427, + "Ġconcerns": 9428, + "Ġsmart": 9429, + "Ġsecret": 9430, + "Ġmmol": 9431, + "Ġbelief": 9432, + "DC": 9433, + "Ġsubstantially": 9434, + "âĪĩ": 9435, + "Ġsubstitution": 9436, + "mapsto": 9437, + "sky": 9438, + "illance": 9439, + "Ġstudent": 9440, + "okine": 9441, + "Ġinterior": 9442, + "Ġeigenvalue": 9443, + "my": 9444, + "Ġcloser": 9445, + "erenti": 9446, + "Ġecological": 9447, + "ĠFigures": 9448, + "olytic": 9449, + "Ġarrays": 9450, + "ĠCas": 9451, + "Ġloops": 9452, + "Ġcorrected": 9453, + "Ġrhe": 9454, + "Ġinversion": 9455, + "Ġpreferred": 9456, + "umab": 9457, + "ĠDI": 9458, + "Ġadequate": 9459, + "irm": 9460, + "Ġimplicit": 9461, + "ship": 9462, + "Ġplayers": 9463, + "Ġdelayed": 9464, + "Ġwinter": 9465, + "Ġvulner": 9466, + "Ġshapes": 9467, + "Ġstained": 9468, + "ĠMajor": 9469, + "Ġhierarchical": 9470, + "ĠDig": 9471, + "ersion": 9472, + "ĠEfficient": 9473, + "Ġwalls": 9474, + "dfrac": 9475, + "Ġclassifier": 9476, + "Ġmonol": 9477, + "Ġupdated": 9478, + "Ġmature": 9479, + "ĠLI": 9480, + "earing": 9481, + "Ġfinger": 9482, + "ounter": 9483, + "ankton": 9484, + "While": 9485, + "Ġrealistic": 9486, + "ĠCamp": 9487, + "Ġfilled": 9488, + "Ġdead": 9489, + "ĠPacific": 9490, + "Ïĩ": 9491, + "ĠDavid": 9492, + "Ġadditive": 9493, + "enchymal": 9494, + "Ġobser": 9495, + "Ġstere": 9496, + "Ġultrasound": 9497, + "ĠPredic": 9498, + "Ġends": 9499, + "sectional": 9500, + "mas": 9501, + "omat": 9502, + "ivity": 9503, + "Ġhandle": 9504, + "Ġmetastatic": 9505, + "olet": 9506, + "ryp": 9507, + "ACE": 9508, + "Ġporous": 9509, + "Ġconcern": 9510, + "itored": 9511, + "Ġcircles": 9512, + "Ġemotional": 9513, + "gered": 9514, + "Ġfriction": 9515, + "first": 9516, + "ophy": 9517, + "escop": 9518, + "aded": 9519, + "Ġresolved": 9520, + "ERS": 9521, + "Ġpathogens": 9522, + "Ġgradually": 9523, + "ĠBrain": 9524, + "xf": 9525, + "anium": 9526, + "ael": 9527, + "New": 9528, + "Ġcytokine": 9529, + "ĠBP": 9530, + "Ġspecimen": 9531, + "olean": 9532, + "Ġtaxon": 9533, + "Ġsequential": 9534, + "κB": 9535, + "ademic": 9536, + "plings": 9537, + "~~": 9538, + "ermal": 9539, + "tree": 9540, + "Ġcausal": 9541, + "arian": 9542, + "Ġcrop": 9543, + "opol": 9544, + "channel": 9545, + "ĠMex": 9546, + "Ġclon": 9547, + "ĠRecently": 9548, + "ĠInvestig": 9549, + "Ġrecommendations": 9550, + "format": 9551, + "ĠMET": 9552, + "Ġsentence": 9553, + "Ġbp": 9554, + "ĠGW": 9555, + "Ġrecording": 9556, + "Ġple": 9557, + "totic": 9558, + "Ġ": 9559, + "Ġranged": 9560, + "ention": 9561, + "obacteria": 9562, + "ceptions": 9563, + "ĠImport": 9564, + "dynamic": 9565, + "porary": 9566, + "Given": 9567, + "Ġturbulence": 9568, + "Ġgram": 9569, + "Ġequally": 9570, + "cd": 9571, + "ĠOs": 9572, + "Ġturns": 9573, + "Ġdetecting": 9574, + "atio": 9575, + "generate": 9576, + "grade": 9577, + "Ġcirculation": 9578, + "Ġmanufacturer": 9579, + "La": 9580, + "ĠHilbert": 9581, + "Ts": 9582, + "integr": 9583, + "Ġbelongs": 9584, + "ĠInternet": 9585, + "angl": 9586, + "ĠâĬ¥": 9587, + "ĠDrosophila": 9588, + "uclidean": 9589, + "tan": 9590, + "Ġextends": 9591, + "Ġexpanded": 9592, + "illin": 9593, + "square": 9594, + "ysacchar": 9595, + "Ġquantify": 9596, + "Ġpulses": 9597, + "Ġvesic": 9598, + "ĠNK": 9599, + "orescence": 9600, + "ĠPhosph": 9601, + "Ġvision": 9602, + "ĠHuang": 9603, + "ĠResponse": 9604, + "house": 9605, + "ears": 9606, + "Ġeg": 9607, + "Ġaccepted": 9608, + "ĠTM": 9609, + "ametric": 9610, + "Ġpathological": 9611, + "Ġrecruitment": 9612, + "ATA": 9613, + "Ġfigures": 9614, + "ĠPress": 9615, + "Ġaligned": 9616, + "Ġpostoperative": 9617, + "ĠMeV": 9618, + "Ġconsiderably": 9619, + "Ġconformal": 9620, + "ĠIsland": 9621, + "number": 9622, + "Ġautomatic": 9623, + "Ġsplic": 9624, + "Ġcytos": 9625, + "Ġdescrip": 9626, + "ĠSant": 9627, + "lies": 9628, + "uity": 9629, + "itone": 9630, + "ECT": 9631, + "ĠBon": 9632, + "Ġdisapp": 9633, + "board": 9634, + "orrh": 9635, + "Ġcalculating": 9636, + "nee": 9637, + "ĠMeas": 9638, + "Ġgenomes": 9639, + "Ġphotoc": 9640, + "Ġreadily": 9641, + "ovine": 9642, + "ĠDev": 9643, + "Ġsatur": 9644, + "Ġkinds": 9645, + "ĠPK": 9646, + "Ġrod": 9647, + "Ġjunction": 9648, + "ĠHA": 9649, + "Ġdesigns": 9650, + "hn": 9651, + "Ġordering": 9652, + "Ġcosmological": 9653, + "Ġpilot": 9654, + "Ġcolorectal": 9655, + "ĠLondon": 9656, + "ĠDirac": 9657, + "Cont": 9658, + "ĠWind": 9659, + "ĠTre": 9660, + "idin": 9661, + "ĠïĢ«": 9662, + "iltration": 9663, + "Moreover": 9664, + "Ġretention": 9665, + "timately": 9666, + "hydrogen": 9667, + "del": 9668, + "bolic": 9669, + "ĠQuanti": 9670, + "period": 9671, + "Ġretrieval": 9672, + "atase": 9673, + "endicular": 9674, + "ulties": 9675, + "RS": 9676, + "NH": 9677, + "Ġinformed": 9678, + "Ġfiltered": 9679, + "membrane": 9680, + "Ġstiffness": 9681, + "ĠOcean": 9682, + "ĠSY": 9683, + "Ġlot": 9684, + "ĠFigs": 9685, + "Ġansw": 9686, + "ĠEngland": 9687, + "ĠAtlantic": 9688, + "processing": 9689, + "Ġdogs": 9690, + "Ġlie": 9691, + "Ġunion": 9692, + "ĠTan": 9693, + "Ġhalo": 9694, + "Ġcontinuously": 9695, + "Bu": 9696, + "AMP": 9697, + "ĠApp": 9698, + "Ġmoisture": 9699, + "Ġthyroid": 9700, + "Ġaccompanied": 9701, + "Ġfold": 9702, + "Ġoriginally": 9703, + "Ġspan": 9704, + "ĠFA": 9705, + "connected": 9706, + "Ġrecurs": 9707, + "vian": 9708, + "ĠEquations": 9709, + "ena": 9710, + "arcinoma": 9711, + "....": 9712, + "Ġdiscrep": 9713, + "UH": 9714, + "о": 9715, + "anger": 9716, + "Ġmonitored": 9717, + "Ġinfluenza": 9718, + "Ġsure": 9719, + "black": 9720, + "oe": 9721, + "Ġalloc": 9722, + "Ġhabitat": 9723, + "ophenyl": 9724, + "Ġventricular": 9725, + "Ġpolicies": 9726, + "amate": 9727, + "Ġreporting": 9728, + "Ġsoluble": 9729, + "================": 9730, + "Ġdipole": 9731, + "Ġirreducible": 9732, + "ĠPrec": 9733, + "acetyl": 9734, + "Ġthread": 9735, + "ĠApproxim": 9736, + "Ġmapped": 9737, + "ipro": 9738, + "Ġtropical": 9739, + "Sch": 9740, + "ĠANOVA": 9741, + "Ġlanguages": 9742, + "icine": 9743, + "ĠFamily": 9744, + "functions": 9745, + "EF": 9746, + "Ġnutrient": 9747, + "Ġanalyzing": 9748, + "inescence": 9749, + "Ġthromb": 9750, + "Ġkit": 9751, + "Ġmammalian": 9752, + "optotic": 9753, + "Ġequipped": 9754, + "ona": 9755, + "Ġque": 9756, + "Ġcame": 9757, + "Ġsimplified": 9758, + "Ġdecays": 9759, + "Ġpassive": 9760, + "Ġdeletion": 9761, + "Ġobtaining": 9762, + "Ġmixtures": 9763, + "Ġprimers": 9764, + "ĠPsy": 9765, + "osc": 9766, + "oment": 9767, + "Ġchloride": 9768, + "ĠPaul": 9769, + "start": 9770, + "intestinal": 9771, + "helium": 9772, + "arth": 9773, + "odot": 9774, + "Ġfits": 9775, + "Ġsquares": 9776, + "ĠCardi": 9777, + "aka": 9778, + "ributed": 9779, + "Ġinequalities": 9780, + "omething": 9781, + "hedral": 9782, + "ĠFuture": 9783, + "Ġgli": 9784, + "Ġmetallic": 9785, + "Ġfacilities": 9786, + "Ġobst": 9787, + "possible": 9788, + "Ġzones": 9789, + "ucid": 9790, + "Ġdrift": 9791, + "depend": 9792, + "valued": 9793, + "Ġnons": 9794, + "Ġworldwide": 9795, + "Ġtrust": 9796, + "Ġsole": 9797, + "ĠLevel": 9798, + "ĠSha": 9799, + "Ġregardless": 9800, + "Ġspectrometry": 9801, + "ductor": 9802, + "leuk": 9803, + "Ġskills": 9804, + "Ġincorporated": 9805, + "Ġlearned": 9806, + "Ġure": 9807, + "Ġextinc": 9808, + "ODU": 9809, + "Ġgrains": 9810, + "atern": 9811, + "ĠIndex": 9812, + "comput": 9813, + "ua": 9814, + "Ġcontamination": 9815, + "ĠAff": 9816, + "uning": 9817, + "Ġasymmetric": 9818, + "Ġopening": 9819, + "Ġbat": 9820, + "Ġagree": 9821, + "ITY": 9822, + "ĠChanges": 9823, + "organic": 9824, + "ĠRay": 9825, + "ĠHand": 9826, + "ni": 9827, + "inic": 9828, + "Ġrisks": 9829, + "Ġstock": 9830, + "Ġneck": 9831, + "Ġvolumes": 9832, + "ĠPrac": 9833, + "Ġincreasingly": 9834, + "Sc": 9835, + "oses": 9836, + "GFP": 9837, + "Ġassignment": 9838, + "ĠFed": 9839, + "ospit": 9840, + "Ġoverexpression": 9841, + "Ġmaster": 9842, + "Ġopt": 9843, + "iler": 9844, + "invariant": 9845, + "Ġconverges": 9846, + "Similar": 9847, + "ny": 9848, + "Ġstore": 9849, + "Ġelevation": 9850, + "Ġcoal": 9851, + "het": 9852, + "item": 9853, + "PLC": 9854, + "ohist": 9855, + "Gen": 9856, + "ĠChem": 9857, + "ĠCost": 9858, + "pair": 9859, + "Ġnumerically": 9860, + "Ġpreference": 9861, + "ĠNucle": 9862, + "ĠBD": 9863, + "TI": 9864, + "ĠHyp": 9865, + "roy": 9866, + "Te": 9867, + "ĠFin": 9868, + "Ġclaims": 9869, + "ibilities": 9870, + "Ġlarvae": 9871, + "ima": 9872, + "embly": 9873, + "Ġcit": 9874, + "LL": 9875, + "Ġsilica": 9876, + "ĠVI": 9877, + "Ġreaching": 9878, + "Of": 9879, + "ĠAustralian": 9880, + "tub": 9881, + "world": 9882, + "oni": 9883, + "ĠFP": 9884, + "Ġbriefly": 9885, + "ĠDescription": 9886, + "ζ": 9887, + "charg": 9888, + "Ġcis": 9889, + "ĠCat": 9890, + "Ġrecip": 9891, + "Ġemergency": 9892, + "Ġstrand": 9893, + "Ġrealized": 9894, + "posing": 9895, + "otope": 9896, + "Ġmaintaining": 9897, + "ĠChrist": 9898, + "Ġcreating": 9899, + "Ġembryos": 9900, + "Ġskeletal": 9901, + "Ġages": 9902, + "represent": 9903, + "Cr": 9904, + "Ġestimating": 9905, + "Ġrear": 9906, + "ĠYu": 9907, + "ĠPi": 9908, + "mg": 9909, + "Ġfloat": 9910, + "ĠRoy": 9911, + "pus": 9912, + "Ġchick": 9913, + "Ġmicrobiota": 9914, + "vasive": 9915, + "ĠBern": 9916, + "ĠPattern": 9917, + "lines": 9918, + "Ġflood": 9919, + "ĠLou": 9920, + "ilitary": 9921, + "rosion": 9922, + "Ġsurveys": 9923, + "FI": 9924, + "iae": 9925, + "Ġsearc": 9926, + "mol": 9927, + "Ġtitle": 9928, + "ĠMachine": 9929, + "Ġcircuits": 9930, + "ĠNumber": 9931, + "zi": 9932, + "ĠBMI": 9933, + "Ġautomated": 9934, + "plicate": 9935, + "ĠLPS": 9936, + "Ġelectrochemical": 9937, + "Ġwebsite": 9938, + "Ġanisotropy": 9939, + "Ġrings": 9940, + "Ġinnov": 9941, + "bits": 9942, + "win": 9943, + "ĠNAD": 9944, + "According": 9945, + "ĠConn": 9946, + "ureus": 9947, + "ĠFeature": 9948, + "ĠInstead": 9949, + "Comp": 9950, + "itudes": 9951, + "Mo": 9952, + "Ġscope": 9953, + "tification": 9954, + "ĠIS": 9955, + "ĠNeut": 9956, + "Ġregulating": 9957, + "coding": 9958, + "Ġrows": 9959, + "hl": 9960, + "ĠKn": 9961, + "istor": 9962, + "ampionship": 9963, + "Ġprominent": 9964, + "Ġrs": 9965, + "umatic": 9966, + "Am": 9967, + "Ġdifferentially": 9968, + "ugin": 9969, + "Ġadvance": 9970, + "phys": 9971, + "Ġsharing": 9972, + "Ġart": 9973, + "vacy": 9974, + "titions": 9975, + "Ġstyle": 9976, + "Figures": 9977, + "Ġglu": 9978, + "Ġvaccination": 9979, + "ĠOptical": 9980, + "fluid": 9981, + "ĠFre": 9982, + "Ġgradients": 9983, + "ophyl": 9984, + "ĠPubl": 9985, + "Ġaccretion": 9986, + "Ġâ̲â̲": 9987, + "ressing": 9988, + "Ġtransmitted": 9989, + "Ġnervous": 9990, + "umar": 9991, + "Ġreviews": 9992, + "Ġgenotypes": 9993, + "lower": 9994, + "ĠEV": 9995, + "Ġcontract": 9996, + "atibility": 9997, + "Ġchildhood": 9998, + "Ġonc": 9999, + "Ġbiofil": 10000, + "Ġautophagy": 10001, + "Ġadsorb": 10002, + "ĠSupport": 10003, + "Ġligands": 10004, + "power": 10005, + "rectional": 10006, + "ĠRap": 10007, + "similar": 10008, + "Ġinfarc": 10009, + "Ġelectroly": 10010, + "Ġincome": 10011, + "arity": 10012, + "ĠAv": 10013, + "eric": 10014, + "Ġclinically": 10015, + "unch": 10016, + "Ġattribute": 10017, + "Ġcommand": 10018, + "ributions": 10019, + "Ġglyc": 10020, + "Ġtranscripts": 10021, + "ograms": 10022, + "Ġassessing": 10023, + "FO": 10024, + "scriptstyle": 10025, + "ji": 10026, + "rick": 10027, + "environment": 10028, + "Ġlaws": 10029, + "Ġnormally": 10030, + "Ġdepletion": 10031, + "ĠRO": 10032, + "Ġencoded": 10033, + "hma": 10034, + "Ġbranches": 10035, + "Ġargs": 10036, + "ounger": 10037, + "orge": 10038, + "umps": 10039, + "Ġviewed": 10040, + "Ġultr": 10041, + "RR": 10042, + "ulsion": 10043, + "ĠHor": 10044, + "Ġfro": 10045, + "ĠMeasurement": 10046, + "xx": 10047, + "erman": 10048, + "ĠOnce": 10049, + "Ġoriented": 10050, + "ĠPoint": 10051, + "Ġtown": 10052, + "Ġformulas": 10053, + "SY": 10054, + "ĠAM": 10055, + "Ġconsiderations": 10056, + "ĠTC": 10057, + "ĠKit": 10058, + "Ġactin": 10059, + "Ġplasmid": 10060, + "Ġhistorical": 10061, + "Ġdye": 10062, + "Ġheur": 10063, + "ĠLeague": 10064, + "ĠMad": 10065, + "Ġgraft": 10066, + "Ġsilver": 10067, + "Over": 10068, + "ĠCos": 10069, + "ographical": 10070, + "Ġprecursor": 10071, + "rus": 10072, + "Ġregarded": 10073, + "ĠHam": 10074, + "functional": 10075, + "iveness": 10076, + "fficiency": 10077, + "igene": 10078, + "ocol": 10079, + "Ġcumulative": 10080, + "Ġseasonal": 10081, + "Ġmu": 10082, + "ĠBan": 10083, + "omycin": 10084, + "Ġbool": 10085, + "ĠMag": 10086, + "ĠAnal": 10087, + "entia": 10088, + "aign": 10089, + "Ġfootball": 10090, + "acting": 10091, + "Ġreturns": 10092, + "ĠTom": 10093, + "shaped": 10094, + "itance": 10095, + "ĠExperiment": 10096, + "ĠOS": 10097, + "Ġabsent": 10098, + "ranial": 10099, + "Ġtherapies": 10100, + "Op": 10101, + "ounced": 10102, + "ATE": 10103, + "Value": 10104, + "green": 10105, + "Ġvegetation": 10106, + "Ds": 10107, + "Ġincom": 10108, + "ç": 10109, + "Ġmarrow": 10110, + "ĠCouncil": 10111, + "Ġinvest": 10112, + "Ġclub": 10113, + "Trans": 10114, + "device": 10115, + "Ġvibration": 10116, + "ĠXu": 10117, + "////////": 10118, + "ĠHen": 10119, + "vier": 10120, + "Ġanalogous": 10121, + "Ġdelta": 10122, + "Ġsaline": 10123, + "Ġrequiring": 10124, + "Ġneuron": 10125, + "oo": 10126, + "ĠQuality": 10127, + "Ġteac": 10128, + "ĠEc": 10129, + "Li": 10130, + "Ġpublication": 10131, + "ĠPhysics": 10132, + "Ġppm": 10133, + "thase": 10134, + "Ġcreation": 10135, + "ĠAge": 10136, + "Ġbelonging": 10137, + "Ġionic": 10138, + "ĠSI": 10139, + "uating": 10140, + "endif": 10141, + "ĠCour": 10142, + "а": 10143, + "Ġdots": 10144, + "Ġeast": 10145, + "arcom": 10146, + "Ġâĩ": 10147, + "Ġrights": 10148, + "essions": 10149, + "Ġversions": 10150, + "ĠFree": 10151, + "ĠStress": 10152, + "Ġsediments": 10153, + "Ġmitig": 10154, + "Ġbow": 10155, + "ĠAct": 10156, + "ĠCarbon": 10157, + "there": 10158, + "teen": 10159, + "Ġphenotypes": 10160, + "Ġnearest": 10161, + "ĠPotential": 10162, + "Ġdeform": 10163, + "Ġreflects": 10164, + "Ġpartners": 10165, + "Ġanest": 10166, + "Ġadvers": 10167, + "ĠFactor": 10168, + "Ġconvenient": 10169, + "ulos": 10170, + "ĠPur": 10171, + "ĠMer": 10172, + "Ġflag": 10173, + "Ġtriang": 10174, + "Ġseeds": 10175, + "Ġfif": 10176, + "obil": 10177, + "ĠCK": 10178, + "mentioned": 10179, + "Ġvapor": 10180, + "ogue": 10181, + "Ġpredictor": 10182, + "Out": 10183, + "Ġcompletion": 10184, + "ĠSeg": 10185, + "Ġdiffuse": 10186, + "Ġraised": 10187, + "Ġcoordination": 10188, + "Ġsynaptic": 10189, + "ĠBor": 10190, + "ĠBol": 10191, + "Ġpolymerase": 10192, + "Ġwheat": 10193, + "Ġinsertion": 10194, + "Ġesc": 10195, + "ĠWal": 10196, + "Ġdistal": 10197, + "transferase": 10198, + "Ġinterfaces": 10199, + "Ġinsu": 10200, + "Ġpoorly": 10201, + "Ġaureus": 10202, + "Ġbenz": 10203, + "Ġuniverse": 10204, + "ĠInteraction": 10205, + "ĠFrame": 10206, + "ĠImaging": 10207, + "Ġexploration": 10208, + "ĠEngineering": 10209, + "ĠBesides": 10210, + "tia": 10211, + "Ġenum": 10212, + "anine": 10213, + "Ġtot": 10214, + "ĠEduc": 10215, + "Ġderivation": 10216, + "Array": 10217, + "yloid": 10218, + "ĠArch": 10219, + "isen": 10220, + "acity": 10221, + "akers": 10222, + "Ġsheet": 10223, + "ĠEst": 10224, + "Ġwear": 10225, + "Ġeryth": 10226, + "ECK": 10227, + "hematics": 10228, + "Ġarterial": 10229, + "criptstyle": 10230, + "scriptscriptstyle": 10231, + "echanical": 10232, + "Ġparticipation": 10233, + "cher": 10234, + "urance": 10235, + "ĠFR": 10236, + "ĠCV": 10237, + "Ġcomplementary": 10238, + "aine": 10239, + "empty": 10240, + "Ġdiges": 10241, + "Ġexponent": 10242, + "Ġsimulate": 10243, + "UE": 10244, + "Ġantibiotics": 10245, + "ĠUnivers": 10246, + "Ġpathology": 10247, + "thermal": 10248, + "pa": 10249, + "Ġstresses": 10250, + "ĠLaboratory": 10251, + "Node": 10252, + "Ġleave": 10253, + "ashing": 10254, + "Ġdiscre": 10255, + "Ġsuspension": 10256, + "reek": 10257, + "Ġscheduling": 10258, + "ĠDA": 10259, + "aryn": 10260, + "ĠNaCl": 10261, + "strain": 10262, + "STR": 10263, + "ĠCong": 10264, + "olf": 10265, + "Ġcalibr": 10266, + "ĠOptimal": 10267, + "Ġó": 10268, + "Gl": 10269, + "ĠRh": 10270, + "Ġdifficulties": 10271, + "Ġvessels": 10272, + "Ġasymmetry": 10273, + "Ġcoherence": 10274, + "ĠTaxonomy": 10275, + "Ġped": 10276, + "ĠHouse": 10277, + "titudes": 10278, + "ĠFar": 10279, + "OY": 10280, + "Ġconcentrated": 10281, + "Ġsignalling": 10282, + "Ġfungal": 10283, + "Ġconsistently": 10284, + "Ġenhances": 10285, + "Ġforecast": 10286, + "Ġcubic": 10287, + "ĠEP": 10288, + "Ġparticipate": 10289, + "ĠPlant": 10290, + "risk": 10291, + "And": 10292, + "adic": 10293, + "oflu": 10294, + "Ġsperm": 10295, + "ĠChris": 10296, + "ND": 10297, + "colon": 10298, + "Ġfaces": 10299, + "Ġtuberculosis": 10300, + "rystal": 10301, + "floor": 10302, + "ups": 10303, + "Ġgray": 10304, + "ĠPublic": 10305, + "tensor": 10306, + "Ġrigid": 10307, + "Ġeastern": 10308, + "ĠItaly": 10309, + "Ġsignatures": 10310, + "Ġshallow": 10311, + "ón": 10312, + "ĠCe": 10313, + "Ġprojects": 10314, + "Ġrouting": 10315, + "Ġpredicts": 10316, + "ĠFeatures": 10317, + "ĠDistrict": 10318, + "Ġcarrying": 10319, + "ĉĠĠĠĠ": 10320, + "ĠTO": 10321, + "HM": 10322, + "dings": 10323, + "Ġrenormal": 10324, + "Ġbring": 10325, + "pin": 10326, + "aled": 10327, + "Ġclouds": 10328, + "names": 10329, + "oxin": 10330, + "Ġperpendicular": 10331, + "WT": 10332, + "ership": 10333, + "Ġrecon": 10334, + "Ġworked": 10335, + "ĠâĢ«": 10336, + "rastructure": 10337, + "Ġpointed": 10338, + "EV": 10339, + "ĠTaylor": 10340, + "Ġhepatitis": 10341, + "Ġorbits": 10342, + "ĠFactors": 10343, + "cellular": 10344, + "Ġfocal": 10345, + "Ġboost": 10346, + "Ġmicrowave": 10347, + "ĠProject": 10348, + "BF": 10349, + "Ġpolitical": 10350, + "Ġsupplemented": 10351, + "Ġillustrates": 10352, + "Ġideas": 10353, + "ĠDrug": 10354, + "obile": 10355, + "ĠHO": 10356, + "Ġrobustness": 10357, + "rosine": 10358, + "ĠNormal": 10359, + "Ġstimulated": 10360, + "Ġimpedance": 10361, + "fortunately": 10362, + "zyme": 10363, + "Ġbarriers": 10364, + "actory": 10365, + "learly": 10366, + "Ġpreprint": 10367, + "sensitive": 10368, + "Ġturbulent": 10369, + "thing": 10370, + "Ġboard": 10371, + "Ġpit": 10372, + "Ġintegrity": 10373, + "Ġrotating": 10374, + "uda": 10375, + "Ġventi": 10376, + "ĠSNPs": 10377, + "Ġcorrespondence": 10378, + "Ġvisualization": 10379, + "avail": 10380, + "Ġbeams": 10381, + "ĠContinu": 10382, + "Ġpersistent": 10383, + "Ġbath": 10384, + "ĠmiRNAs": 10385, + "Ġcustom": 10386, + "Ġordinary": 10387, + "Ġgenerators": 10388, + "Ġbridge": 10389, + "Ġdomin": 10390, + "amy": 10391, + "Ġlooking": 10392, + "table": 10393, + "False": 10394, + "Ġsoils": 10395, + "Ġmatches": 10396, + "Ġprogressive": 10397, + "states": 10398, + "ĠShort": 10399, + "Ġcores": 10400, + "Ġintroducing": 10401, + "Ġarrest": 10402, + "Ġtexture": 10403, + "Ġdorsal": 10404, + "Ġdrain": 10405, + "izoph": 10406, + "ĠQue": 10407, + "ñ": 10408, + "disc": 10409, + "Index": 10410, + "Ġextensively": 10411, + "Ġplasticity": 10412, + "Ġreally": 10413, + "ĠError": 10414, + "Ġsugges": 10415, + "Ġconsequently": 10416, + "Ġperforms": 10417, + "likely": 10418, + "ivered": 10419, + "Ġthermodynamic": 10420, + "Ġker": 10421, + "Ġacetate": 10422, + "Ġgets": 10423, + "leqslant": 10424, + "Ġpredictors": 10425, + "ĠSwed": 10426, + "nan": 10427, + "heter": 10428, + "Ġanomaly": 10429, + "Ġoperational": 10430, + "Ġretrospective": 10431, + "Ġtends": 10432, + "aden": 10433, + "Ġborder": 10434, + "Ġmethanol": 10435, + "ĠEnter": 10436, + "Ġcollapse": 10437, + "Ġpurchased": 10438, + "Da": 10439, + "ĠHT": 10440, + "Ġfulf": 10441, + "Ġcrust": 10442, + "stone": 10443, + "Ġpenal": 10444, + "Ġtunn": 10445, + "ĠTemperature": 10446, + "Ġpotent": 10447, + "lecule": 10448, + "Ġcovers": 10449, + "Ġbattery": 10450, + "Ġbeg": 10451, + "Ġorgans": 10452, + "ĠThomas": 10453, + "Ġsolub": 10454, + "ocrine": 10455, + "ĠSpin": 10456, + "Ġinterests": 10457, + "doc": 10458, + "Ġundergoing": 10459, + "ui": 10460, + "Ġinherent": 10461, + "Ġintegrals": 10462, + "irable": 10463, + "ashi": 10464, + "Ġregeneration": 10465, + "Ġinflation": 10466, + "manif": 10467, + "ĠRecognition": 10468, + "Ġdisplays": 10469, + "Another": 10470, + "Ġcontamin": 10471, + "junction": 10472, + "Ġcopies": 10473, + "MRI": 10474, + "Ġvehicles": 10475, + "Get": 10476, + "Ġperhaps": 10477, + "Ġwest": 10478, + "Ġintensive": 10479, + "Ġsomething": 10480, + "Ġhypoxia": 10481, + "Ġcouplings": 10482, + "Ġfeasibility": 10483, + "azine": 10484, + "unic": 10485, + "iner": 10486, + "ĠIT": 10487, + "Ġdistrict": 10488, + "ĠJames": 10489, + "eval": 10490, + "Ġplacebo": 10491, + "aque": 10492, + "Ġelucid": 10493, + "ĠJacob": 10494, + "Ġcounting": 10495, + "Ġflexibility": 10496, + "Ġperman": 10497, + "Ġadvances": 10498, + "ulph": 10499, + "Ġentanglement": 10500, + "Ġintegers": 10501, + "Ġfocusing": 10502, + "kov": 10503, + "Ġhospit": 10504, + "Ġapplies": 10505, + "Ġcot": 10506, + "Sm": 10507, + "assium": 10508, + "Ġdocumented": 10509, + "Ġloaded": 10510, + "Ġrely": 10511, + "Ġinfectious": 10512, + "Ġprobes": 10513, + "Ġhighlighted": 10514, + "Ġpediatric": 10515, + "Ġweather": 10516, + "Ġmanual": 10517, + "Ġcation": 10518, + "Ġinterpolation": 10519, + "ĠStep": 10520, + "ĠKal": 10521, + "DH": 10522, + "db": 10523, + "izophren": 10524, + "ader": 10525, + "carb": 10526, + "Ġagon": 10527, + "orphous": 10528, + "tors": 10529, + "atz": 10530, + "Ġbif": 10531, + "Ġcharges": 10532, + "ĠAgain": 10533, + "Ġbron": 10534, + "ĠGover": 10535, + "Ġmining": 10536, + "aver": 10537, + "Ġearthqu": 10538, + "Ġviews": 10539, + "Ġscene": 10540, + "parameters": 10541, + "Ġbroken": 10542, + "Test": 10543, + "ĠSum": 10544, + "ĠProm": 10545, + "ÎĽ": 10546, + "Ġcutoff": 10547, + "Ġbirds": 10548, + "Ġarising": 10549, + "ĠAI": 10550, + "ĠCE": 10551, + "Ġpronounced": 10552, + "aspase": 10553, + "Ġintended": 10554, + "Ġaffine": 10555, + "Ġurine": 10556, + "Ġbelieved": 10557, + "ĠPrimary": 10558, + "ĠConf": 10559, + "Ġabdominal": 10560, + "spin": 10561, + "uniform": 10562, + "ĠStochastic": 10563, + "ĠProv": 10564, + "ĠmiRNA": 10565, + "ĠBell": 10566, + "BO": 10567, + "ĠSoftware": 10568, + "ĠTs": 10569, + "utri": 10570, + "icking": 10571, + "ien": 10572, + "Ġmicros": 10573, + "ĠNR": 10574, + "Ġleukemia": 10575, + "Ġsupernat": 10576, + "family": 10577, + "Ġalloys": 10578, + "ĠPET": 10579, + "ĠAbs": 10580, + "ĠGA": 10581, + "ĠQuantitative": 10582, + "Lo": 10583, + "Ġisland": 10584, + "second": 10585, + "pectives": 10586, + "Ġlatency": 10587, + "angi": 10588, + "Ġflight": 10589, + "ĠEuclidean": 10590, + "emy": 10591, + "ĠBlood": 10592, + "leukin": 10593, + "LT": 10594, + "enh": 10595, + "Ġswe": 10596, + "Ġunitary": 10597, + "ĠRepublic": 10598, + "Ġstructured": 10599, + "ĠSen": 10600, + "Mn": 10601, + "centric": 10602, + "Ġtransgenic": 10603, + "Ġhelpful": 10604, + "pyx": 10605, + "Ġhomeostasis": 10606, + "Na": 10607, + "Ġpassed": 10608, + "Ġeyes": 10609, + "Ġabstract": 10610, + "ulse": 10611, + "Ġmirror": 10612, + "Ġregulator": 10613, + "Ġmurine": 10614, + "loaded": 10615, + "Ġmodular": 10616, + "Ġlandscape": 10617, + "icks": 10618, + "Ġsnow": 10619, + "Ġbovine": 10620, + "elli": 10621, + "Ġdatabases": 10622, + "Ġoutbreak": 10623, + "larg": 10624, + "ĠRun": 10625, + "BE": 10626, + "Ġsurprising": 10627, + "Ġacceptable": 10628, + "Ġrotational": 10629, + "pg": 10630, + "FE": 10631, + "wik": 10632, + "Ġyounger": 10633, + "ashion": 10634, + "Ġmicroscopic": 10635, + "regation": 10636, + "Ġfibr": 10637, + "ĠPlan": 10638, + "Ġhapl": 10639, + "Ġmanifolds": 10640, + "Ġoutper": 10641, + "Ġchoosing": 10642, + "eper": 10643, + "ĠkeV": 10644, + "ĠTyp": 10645, + "pread": 10646, + "ntz": 10647, + "ĠReport": 10648, + "ĠMatrix": 10649, + "Ġintu": 10650, + "Ġproperly": 10651, + "ogly": 10652, + "oscopic": 10653, + "ĠAMP": 10654, + "ĠBM": 10655, + "Ġelementary": 10656, + "keleton": 10657, + "Ġsynthase": 10658, + "Ġionization": 10659, + "bes": 10660, + "ophage": 10661, + "duces": 10662, + "acco": 10663, + "Ġprotect": 10664, + "ĠCoul": 10665, + "Ġspent": 10666, + "Ġmand": 10667, + "Ġhind": 10668, + "fluor": 10669, + "ĠGood": 10670, + "Ġdoing": 10671, + "Object": 10672, + "ducts": 10673, + "oyl": 10674, + "chiatric": 10675, + "Ġov": 10676, + "cel": 10677, + "Ġbases": 10678, + "Ġmitochondria": 10679, + "pted": 10680, + "artz": 10681, + "Ġbrown": 10682, + "Ġequals": 10683, + "tible": 10684, + "Ġopportunity": 10685, + "azol": 10686, + "Ġofficial": 10687, + "ailed": 10688, + "Ġurinary": 10689, + "ĠHan": 10690, + "Be": 10691, + "result": 10692, + "units": 10693, + "Ġbad": 10694, + "ĠString": 10695, + "izable": 10696, + "condition": 10697, + "ĠElectron": 10698, + "immune": 10699, + "ĠME": 10700, + "hao": 10701, + "Σ": 10702, + "ĠMAT": 10703, + "Ġadopt": 10704, + "Ġelic": 10705, + "Ġshr": 10706, + "Ġproximal": 10707, + "FD": 10708, + "ĠSS": 10709, + "Ġentirely": 10710, + "esium": 10711, + "ĠEEG": 10712, + "Ġpaired": 10713, + "ĠTP": 10714, + "ĠDO": 10715, + "NAL": 10716, + "idespread": 10717, + "Ġmoves": 10718, + "site": 10719, + "Ġrain": 10720, + "Ġlap": 10721, + "ĠFu": 10722, + "ĠMeta": 10723, + "ircraft": 10724, + "Ġmagnetization": 10725, + "operation": 10726, + "Ġprost": 10727, + "Step": 10728, + "Ġsubgroups": 10729, + "ĠSouthern": 10730, + "Ġathe": 10731, + "luor": 10732, + "ĠTaxonomic": 10733, + "ĠEinstein": 10734, + "Ġrace": 10735, + "ĠKen": 10736, + "Ġattempts": 10737, + "Ġcosmic": 10738, + "ĠDop": 10739, + "Ġfixation": 10740, + "Ġremoving": 10741, + "BT": 10742, + "Ġlimb": 10743, + "Ġalign": 10744, + "Ġdried": 10745, + "du": 10746, + "Ġputative": 10747, + "uccess": 10748, + "pert": 10749, + "Ġslowly": 10750, + "also": 10751, + "olip": 10752, + "Ġclient": 10753, + "Ġbasin": 10754, + "Ġsusceptible": 10755, + "Ġcoming": 10756, + "nson": 10757, + "ĠNGC": 10758, + "assert": 10759, + "Ġtensile": 10760, + "Ġarises": 10761, + "cutaneous": 10762, + "Ġcaro": 10763, + "Bi": 10764, + "Ġdiscussions": 10765, + "Ġabnormalities": 10766, + "Ġpollution": 10767, + "ĠAx": 10768, + "Ġloads": 10769, + "Do": 10770, + "iao": 10771, + "Ġmedication": 10772, + "Ġintact": 10773, + "ĠCX": 10774, + "Ġbreeding": 10775, + "ĠUnion": 10776, + "ĠBat": 10777, + "ĠParticipants": 10778, + "ĠRegulation": 10779, + "Ġcontradiction": 10780, + "Ġintensities": 10781, + "encephal": 10782, + "rile": 10783, + "ĠTLR": 10784, + "Ġredund": 10785, + "Ġpersons": 10786, + "ĠArc": 10787, + "solid": 10788, + "law": 10789, + "Results": 10790, + "ilic": 10791, + "zone": 10792, + "ocytosis": 10793, + "Ġtriangle": 10794, + "STM": 10795, + "ĠVirus": 10796, + "Ġaid": 10797, + "soft": 10798, + "Ġsoon": 10799, + "expected": 10800, + "Ġanch": 10801, + "ĠMu": 10802, + "ĠSr": 10803, + "ĠLO": 10804, + "Ġcry": 10805, + "Ġupstream": 10806, + "oxic": 10807, + "mathit": 10808, + "ĠKle": 10809, + "Ġisotropic": 10810, + "Ġspatially": 10811, + "ĠHard": 10812, + "Ġextr": 10813, + "bas": 10814, + "eor": 10815, + "ivil": 10816, + "yan": 10817, + "Ġshifted": 10818, + "Ġbiopsy": 10819, + "Ġfeel": 10820, + "glut": 10821, + "Size": 10822, + "Ġerg": 10823, + "ĠTer": 10824, + "Ġdeaths": 10825, + "borne": 10826, + "Ġrelativistic": 10827, + "ĠVEGF": 10828, + "atab": 10829, + "spring": 10830, + "restim": 10831, + "ĠSearch": 10832, + "yphenyl": 10833, + "ecal": 10834, + "urc": 10835, + "Ġlamin": 10836, + "Ġserial": 10837, + "las": 10838, + "ĠProduction": 10839, + "Ġsocio": 10840, + "Ġmodify": 10841, + "ĠService": 10842, + "Ġbary": 10843, + "Ġradiative": 10844, + "bigl": 10845, + "Ġparadigm": 10846, + "patient": 10847, + "Ġspp": 10848, + "phone": 10849, + "Ġî": 10850, + "Ġrocks": 10851, + "ĠMartin": 10852, + "mn": 10853, + "Ġfluids": 10854, + "ĠINTR": 10855, + "ods": 10856, + "Ġdivis": 10857, + "Consider": 10858, + "component": 10859, + "Ġanomalies": 10860, + "Ġknee": 10861, + "ĠRelationship": 10862, + "aud": 10863, + "Ġovernight": 10864, + "Ġrainf": 10865, + "Ġannealing": 10866, + "Ġtreating": 10867, + "Ġcoarse": 10868, + "Model": 10869, + "Ġpose": 10870, + "Ġoccas": 10871, + "ĠWilliam": 10872, + "oor": 10873, + "Ġadjustment": 10874, + "ĠFunctions": 10875, + "imeter": 10876, + "Ġdetectors": 10877, + "Ġinstitutional": 10878, + "Ġthroughput": 10879, + "ividual": 10880, + "Ġentities": 10881, + "Ġprolonged": 10882, + "Ġship": 10883, + "Ġpreserved": 10884, + "ODUCTION": 10885, + "Ġlogistic": 10886, + "ĠPrediction": 10887, + "tized": 10888, + "ĠOrig": 10889, + "ĠHem": 10890, + "onomous": 10891, + "################": 10892, + "ĠGeneration": 10893, + "bottom": 10894, + "ĠKnow": 10895, + "clinical": 10896, + "Ġtrauma": 10897, + "Ġiterative": 10898, + "Ġfacility": 10899, + "ront": 10900, + "ĠBus": 10901, + "Ġretinal": 10902, + "Ġconduction": 10903, + "Ġchecked": 10904, + "Ġcalls": 10905, + "ologists": 10906, + "CON": 10907, + "ĠSciences": 10908, + "Ġnonzero": 10909, + "Ġbrack": 10910, + "Ġmelting": 10911, + "Ġasc": 10912, + "Ġmention": 10913, + "ĠBL": 10914, + "Ġverification": 10915, + "ukary": 10916, + "ĠSpatial": 10917, + "ĠGram": 10918, + "Ġplaces": 10919, + "Ġnecrosis": 10920, + "ĠChildren": 10921, + "Ġdelivered": 10922, + "Ġresection": 10923, + "Ġdeterministic": 10924, + "Section": 10925, + "Ġmultim": 10926, + "DF": 10927, + "Ġhypotheses": 10928, + "Ġraise": 10929, + "Ġseismic": 10930, + "Ġlam": 10931, + "ĠHCC": 10932, + "bigr": 10933, + "Ġhealing": 10934, + "isy": 10935, + "Ġoptimize": 10936, + "obacterium": 10937, + "edy": 10938, + "Ġtruth": 10939, + "Ġspacetime": 10940, + "Ġchromatin": 10941, + "Ġdomestic": 10942, + "Ġrecru": 10943, + "ĠJose": 10944, + "ĠThermal": 10945, + "Ġenvelope": 10946, + "vable": 10947, + "Ġincons": 10948, + "Ġnod": 10949, + "и": 10950, + "Ġcontributing": 10951, + "Ġguarantee": 10952, + "ĠPhen": 10953, + "Ġrab": 10954, + "Man": 10955, + "Ġsurveillance": 10956, + "Ġthings": 10957, + "Ġprev": 10958, + "ĠNonlinear": 10959, + "Ġgaps": 10960, + "aya": 10961, + "ĠCri": 10962, + "Ġcrystalline": 10963, + "strict": 10964, + "Ġcomputations": 10965, + "Ġunable": 10966, + "habil": 10967, + "umina": 10968, + "Ġpromoting": 10969, + "egrad": 10970, + "Ġregister": 10971, + "Ġcrossing": 10972, + "ulators": 10973, + "ĠLanguage": 10974, + "ĠAA": 10975, + "Ġiner": 10976, + "ĠLV": 10977, + "osan": 10978, + "Ġcoastal": 10979, + "Ġbiod": 10980, + "ĠMOD": 10981, + "Ġneighbour": 10982, + "Ġpredominantly": 10983, + "ĠNewton": 10984, + "ĠStrateg": 10985, + "being": 10986, + "Ġì": 10987, + "Ġcapabilities": 10988, + "Ġunless": 10989, + "formal": 10990, + "Ġvessel": 10991, + "bmatrix": 10992, + "ESS": 10993, + "Ġrainfall": 10994, + "ã": 10995, + "Ġprepar": 10996, + "axial": 10997, + "Ġdental": 10998, + "ĠProte": 10999, + "Ġworse": 11000, + "doped": 11001, + "hentic": 11002, + "Ġvalidate": 11003, + "Zn": 11004, + "Ġspecification": 11005, + "si": 11006, + "ĠAng": 11007, + "Ġtubes": 11008, + "ulic": 11009, + "ĠAny": 11010, + "ĠMap": 11011, + "Ġfabricated": 11012, + "Ġforced": 11013, + "ĠWilson": 11014, + "olysis": 11015, + "ĠWave": 11016, + "ĠCast": 11017, + "Ġasthma": 11018, + "Ġperi": 11019, + "ĠCyt": 11020, + "asty": 11021, + "Ġsky": 11022, + "rupt": 11023, + "Dec": 11024, + "Ġmelanoma": 11025, + "PER": 11026, + "Ġcontinuity": 11027, + "Box": 11028, + "system": 11029, + "Ġnavig": 11030, + "Ġcirculating": 11031, + "Ġcolony": 11032, + "lesssim": 11033, + "adium": 11034, + "Ġtetra": 11035, + "Ġaccounts": 11036, + "Ġpresenting": 11037, + "ĠLik": 11038, + "Ġresis": 11039, + "Ġdamping": 11040, + "ĠGly": 11041, + "ĠNeuro": 11042, + "user": 11043, + "Ġcapital": 11044, + "urate": 11045, + "ĠMW": 11046, + "Ġcorrelates": 11047, + "ĠGib": 11048, + "Ġhappens": 11049, + "Ġgall": 11050, + "ĠWithin": 11051, + "Ġcombine": 11052, + "Ġsinus": 11053, + "ĠKin": 11054, + "********************************": 11055, + "Map": 11056, + "Ġmaturation": 11057, + "Ġblocking": 11058, + "ĠCloud": 11059, + "Ġcontacts": 11060, + "Ġsac": 11061, + "ALL": 11062, + "ĠRab": 11063, + "zz": 11064, + "utch": 11065, + "Ġcarriers": 11066, + "ĠSNR": 11067, + "erb": 11068, + "Ġprotected": 11069, + "racking": 11070, + "radient": 11071, + "Ġattractive": 11072, + "Ġlag": 11073, + "Ġopin": 11074, + "ĠGi": 11075, + "Ġdefense": 11076, + "Ġtuning": 11077, + "Ġelectroph": 11078, + "Ġgreatest": 11079, + "Ġreconstructed": 11080, + "ĠPopulation": 11081, + "MAP": 11082, + "Ġwrote": 11083, + "AND": 11084, + "economic": 11085, + "ĠMichael": 11086, + "ĠBlock": 11087, + "Ġvo": 11088, + "oprop": 11089, + "Ġprofiling": 11090, + "ootst": 11091, + "ĠAsian": 11092, + "Ġoscillation": 11093, + "ĠâĨIJ": 11094, + "UD": 11095, + "Ġsigned": 11096, + "ĠEuler": 11097, + "ĠComparative": 11098, + "ĠWhere": 11099, + "ĠJack": 11100, + "Ġpassing": 11101, + "Ġvillage": 11102, + "Ġau": 11103, + "ĠNorthern": 11104, + "essage": 11105, + "matic": 11106, + "Ġaffili": 11107, + "ĠFac": 11108, + "Ġoverlapping": 11109, + "shell": 11110, + "Ġobstac": 11111, + "Ġbecoming": 11112, + "entive": 11113, + "Ġeasier": 11114, + "initely": 11115, + "Ġcentered": 11116, + "Ġacademic": 11117, + "annels": 11118, + "Ġirregular": 11119, + "Ġprojections": 11120, + "Ġproposition": 11121, + "Ġdiscrimination": 11122, + "Ġremod": 11123, + "Ġshoot": 11124, + "month": 11125, + "essor": 11126, + "Ġdiffers": 11127, + "ĠTV": 11128, + "ĠZhou": 11129, + "Ġinher": 11130, + "Ġmachines": 11131, + "Ġmell": 11132, + "Ġconjugate": 11133, + "Ġcoc": 11134, + "una": 11135, + "anyl": 11136, + "Ġoffic": 11137, + "Ġopportunities": 11138, + "Ġvein": 11139, + "ĠCharacteristics": 11140, + "Ġpathogenic": 11141, + "OYSA": 11142, + "ĠParkinson": 11143, + "ĠGalactic": 11144, + "FFFA": 11145, + "yses": 11146, + "UHFFFA": 11147, + "UHFFFAOYSA": 11148, + "actin": 11149, + "Ġunus": 11150, + "hesia": 11151, + "aceu": 11152, + "adow": 11153, + "oside": 11154, + "Ġglycos": 11155, + "Ġdiluted": 11156, + "ĠSource": 11157, + "olated": 11158, + "armaceu": 11159, + "antom": 11160, + "Ġmusc": 11161, + "Ġaveraging": 11162, + "Ġvisit": 11163, + "Ġcatch": 11164, + "Ġsatisfaction": 11165, + "Ġvon": 11166, + "valid": 11167, + "Ġyielded": 11168, + "Ġpackets": 11169, + "Ġresonant": 11170, + "pret": 11171, + "ĠGFP": 11172, + "Ġcutting": 11173, + "Ġreplacing": 11174, + "aze": 11175, + "Pa": 11176, + "Ġtoday": 11177, + "Ġdecided": 11178, + "ilateral": 11179, + "imate": 11180, + "lings": 11181, + "ĠRobust": 11182, + "ĠAst": 11183, + "odynamics": 11184, + "Ġlacking": 11185, + "izophrenia": 11186, + "Ġcontraction": 11187, + "umann": 11188, + "ĠSample": 11189, + "Ġdiamond": 11190, + "method": 11191, + "TOR": 11192, + "Ġcomments": 11193, + "sey": 11194, + "Ġmanufacturing": 11195, + "ĠDa": 11196, + "NR": 11197, + "Ġoperated": 11198, + "rates": 11199, + "Ġextinction": 11200, + "uvant": 11201, + "ĠFinite": 11202, + "Ġlymphocytes": 11203, + "bro": 11204, + "omology": 11205, + "Ġinstruments": 11206, + "bec": 11207, + "ogle": 11208, + "Ġquoti": 11209, + "Ġhyperbolic": 11210, + "Ġtrim": 11211, + "Ġpap": 11212, + "aturated": 11213, + "haus": 11214, + "Ġsessions": 11215, + "Ġcampaign": 11216, + "Ġvarieties": 11217, + "Ġprojected": 11218, + "Ġrid": 11219, + "bone": 11220, + "Ġancest": 11221, + "ĠET": 11222, + "mail": 11223, + "ĠTransport": 11224, + "///": 11225, + "ĠAnn": 11226, + "Ġcompositions": 11227, + "ĠINTRODUCTION": 11228, + "ĠâĪĴâĨĴ": 11229, + "Ġwhenever": 11230, + "ĠLip": 11231, + "parts": 11232, + "Ġisomorphic": 11233, + "Ġsulfate": 11234, + "Ġhop": 11235, + "Ġgon": 11236, + "ĠObject": 11237, + "Ġpipeline": 11238, + "Ġma": 11239, + "ĠGas": 11240, + "Ġtendency": 11241, + "object": 11242, + "Ġparametric": 11243, + "ĠReturn": 11244, + "Ġdwar": 11245, + "Ġpressures": 11246, + "ĠBios": 11247, + "Ġmultiplication": 11248, + "Ġdimin": 11249, + "Ġcolors": 11250, + "ĠTrue": 11251, + "Max": 11252, + "ĠDepend": 11253, + "Ġpairwise": 11254, + "Ġlake": 11255, + "Ġhierarchy": 11256, + "Ġthresholds": 11257, + "ĠAdaptive": 11258, + "making": 11259, + "Ġcatalysts": 11260, + "ipal": 11261, + "Ġeggs": 11262, + "Ġwire": 11263, + "ophyll": 11264, + "ictor": 11265, + "labeled": 11266, + "Ġmuscles": 11267, + "ĠUnderstanding": 11268, + "Ġfibre": 11269, + "controlled": 11270, + "Ġinvariance": 11271, + "Ġcache": 11272, + "Ġboson": 11273, + "Ġnearby": 11274, + "ĠWomen": 11275, + "ĠInitial": 11276, + "Ġprobabilistic": 11277, + "Ġembryonic": 11278, + "ĠBetween": 11279, + "Ġconjecture": 11280, + "ienti": 11281, + "tx": 11282, + "gens": 11283, + "anck": 11284, + "Ġgir": 11285, + "ĠLower": 11286, + "Ġhospitals": 11287, + "bridge": 11288, + "Method": 11289, + "Ġtheta": 11290, + "ja": 11291, + "Ġconceptual": 11292, + "Ġcolle": 11293, + "ĠSaf": 11294, + "dic": 11295, + "Ġpet": 11296, + "Ġprimer": 11297, + "ĠOh": 11298, + "Ġuntreated": 11299, + "longrightarrow": 11300, + "Ġlicense": 11301, + "Ġhelps": 11302, + "Ġcleavage": 11303, + "Ġamplified": 11304, + "е": 11305, + "Ġaccessible": 11306, + "ĠSelection": 11307, + "ĠLorentz": 11308, + "Py": 11309, + "Ġpolarized": 11310, + "ĠSTAT": 11311, + "mitt": 11312, + "Up": 11313, + "Ġongoing": 11314, + "Ġneph": 11315, + "efficient": 11316, + "activ": 11317, + "ĠRR": 11318, + "Ġfunctioning": 11319, + "otin": 11320, + "Ġlists": 11321, + "Ġformalism": 11322, + "Ġoscillator": 11323, + "Ġgastrointestinal": 11324, + "ootstrap": 11325, + "ĠAsia": 11326, + "ĠDay": 11327, + "Ġcompeting": 11328, + "ivalent": 11329, + "Ġbladder": 11330, + "Ġhit": 11331, + "Ġapproximations": 11332, + "ĠEg": 11333, + "ĠClust": 11334, + "Ġrelies": 11335, + "NE": 11336, + "copro": 11337, + "Ġbank": 11338, + "Ġintegrating": 11339, + "ĠHear": 11340, + "Ġinitiated": 11341, + "acryl": 11342, + "ĠBH": 11343, + "racted": 11344, + "yc": 11345, + "ĠRa": 11346, + "Ġremarkable": 11347, + "ĠË": 11348, + "teness": 11349, + "Ġemploying": 11350, + "steine": 11351, + "Ġï£Ń": 11352, + "Ġtransfected": 11353, + "Ġinjuries": 11354, + "ĠBrief": 11355, + "Ġwidespread": 11356, + "ĠAK": 11357, + "IVE": 11358, + "Ġharm": 11359, + "Ġpole": 11360, + "Ġanisotropic": 11361, + "aten": 11362, + "gene": 11363, + "ivariate": 11364, + "Inter": 11365, + "ductors": 11366, + "Ġaccompl": 11367, + "oglobin": 11368, + "cong": 11369, + "Ġqueries": 11370, + "escope": 11371, + "ĠHop": 11372, + "Ġentity": 11373, + "Ġoffered": 11374, + "State": 11375, + "ĠExperiments": 11376, + "anner": 11377, + "ĠWood": 11378, + "arded": 11379, + "agon": 11380, + "Ġfibroblasts": 11381, + "Ġnanos": 11382, + "Ġperoxid": 11383, + "Ġevid": 11384, + "Ġ": 11385, + "Ġretained": 11386, + "osqu": 11387, + "Ġleaving": 11388, + "Ġfashion": 11389, + "ĠnM": 11390, + "Ġmutual": 11391, + "approxim": 11392, + "Ġwalking": 11393, + "Ġimpossible": 11394, + "Ġdemonstrating": 11395, + "Ġdegener": 11396, + "ĠAV": 11397, + "Ġcontrary": 11398, + "ustion": 11399, + "oclonal": 11400, + "Anal": 11401, + "Ġperformances": 11402, + "Ġcomprom": 11403, + "orms": 11404, + "Ġbudget": 11405, + "ĠHaw": 11406, + "Ġarthritis": 11407, + "obj": 11408, + "noise": 11409, + "TiO": 11410, + "ochrome": 11411, + "Ġgeodes": 11412, + "bean": 11413, + "Ġselectivity": 11414, + "ĠFood": 11415, + "ughter": 11416, + "Ġpermutation": 11417, + "ĠRP": 11418, + "osal": 11419, + "Ġadip": 11420, + "armaceutical": 11421, + "when": 11422, + "ĠText": 11423, + "week": 11424, + "Ġbonding": 11425, + "arb": 11426, + "ocor": 11427, + "Ġvoc": 11428, + "Ġupregulated": 11429, + "Ġneighbors": 11430, + "Ġtrait": 11431, + "Ġtheore": 11432, + "Ġcf": 11433, + "ĠBerg": 11434, + "ĠLA": 11435, + "Ġlas": 11436, + "unte": 11437, + "ceptual": 11438, + "ASE": 11439, + "Ġischemic": 11440, + "Ġbending": 11441, + "dataset": 11442, + "Ġkeeping": 11443, + "Ġarrows": 11444, + "Ġsubstances": 11445, + "Ġns": 11446, + "Ġextending": 11447, + "ĠRu": 11448, + "Ġsupplementation": 11449, + "critical": 11450, + "ĠTraining": 11451, + "bullet": 11452, + "Ġpara": 11453, + "tail": 11454, + "ĠReference": 11455, + "Ġ": 11456, + "Ġdissipation": 11457, + "Ġauxiliary": 11458, + "ĠCycl": 11459, + "stim": 11460, + "Ġdilution": 11461, + "buf": 11462, + "ĠMiss": 11463, + "Ġultimately": 11464, + "Ġpowers": 11465, + "Ġstands": 11466, + "usted": 11467, + "ĠOH": 11468, + "habilitation": 11469, + "analy": 11470, + "ĠBra": 11471, + "adding": 11472, + "Corollary": 11473, + "Ġdrought": 11474, + "quality": 11475, + "Ġstandardized": 11476, + "ĠJe": 11477, + "ĠAcid": 11478, + "Ġmism": 11479, + "ĠChrom": 11480, + "draw": 11481, + "ĠBiom": 11482, + "ĠStability": 11483, + "Furthermore": 11484, + "last": 11485, + "vic": 11486, + "Ġabst": 11487, + "Ġbis": 11488, + "Ġemergence": 11489, + "Ġgiant": 11490, + "De": 11491, + "ĠSamples": 11492, + "ABA": 11493, + "nas": 11494, + "Ġont": 11495, + "Ġevap": 11496, + "levant": 11497, + "main": 11498, + "ĠRod": 11499, + "Ġcros": 11500, + "itary": 11501, + "Ġdoub": 11502, + "rö": 11503, + "igenetic": 11504, + "Ġincomplete": 11505, + "depth": 11506, + "ïģ": 11507, + "Ġsaturated": 11508, + "Ġaerosol": 11509, + "Assum": 11510, + "Ġimmunos": 11511, + "Ġlipids": 11512, + "itoneal": 11513, + "Ġbearing": 11514, + "ĠImplications": 11515, + "Ġsustained": 11516, + "Ġcompetitive": 11517, + "Ġmotivation": 11518, + "Ġdisturbance": 11519, + "rystalline": 11520, + "Ġtaxa": 11521, + "Ġdementia": 11522, + "Ġconcerned": 11523, + "PIO": 11524, + "homogeneous": 11525, + "ĠEv": 11526, + "ĠGeorge": 11527, + "ĠAlgorithms": 11528, + "ickel": 11529, + "usively": 11530, + "Ġcorner": 11531, + "ĠRest": 11532, + "Ġinfinity": 11533, + "ĠTransform": 11534, + "heng": 11535, + "Ġneurode": 11536, + "olim": 11537, + "Íij": 11538, + "Ġskew": 11539, + "ĠBS": 11540, + "score": 11541, + "YPE": 11542, + "eman": 11543, + "elle": 11544, + "ĠCorrelation": 11545, + "Ġcultural": 11546, + "ophosph": 11547, + "Ġattenuation": 11548, + "Ġaggregate": 11549, + "Ġambig": 11550, + "Ġanomalous": 11551, + "Ġtors": 11552, + "Ġplanet": 11553, + "ĠNPs": 11554, + "hr": 11555, + "ĠDivision": 11556, + "ĠEducation": 11557, + "lectic": 11558, + "Ġbrought": 11559, + "ĠMorph": 11560, + "Ġplanes": 11561, + "Ġsugar": 11562, + "Ġdendritic": 11563, + "Ġcontour": 11564, + "Ġcylinder": 11565, + "post": 11566, + "Ġwent": 11567, + "RL": 11568, + "Ġadmission": 11569, + "MSE": 11570, + "IX": 11571, + "Ġdisjoint": 11572, + "Ġannotation": 11573, + "Ġisotope": 11574, + "Ġμν": 11575, + "Ġeliminate": 11576, + "Ġreactor": 11577, + "onents": 11578, + "Ġreasoning": 11579, + "Ġmorbidity": 11580, + "Ġcorrosion": 11581, + "othermal": 11582, + "arctic": 11583, + "ĠMB": 11584, + "ĠZhao": 11585, + "Ġhistological": 11586, + "Ġsuperconducting": 11587, + "attered": 11588, + "Ġhousehold": 11589, + "ĠProp": 11590, + "Ġasser": 11591, + "hered": 11592, + "Ġteams": 11593, + "Ġvanishes": 11594, + "Pre": 11595, + "aments": 11596, + "Ġamorphous": 11597, + "ĠDetermination": 11598, + "missions": 11599, + "Ġoverhead": 11600, + "determ": 11601, + "Ġutilizing": 11602, + "fa": 11603, + "ipolar": 11604, + "Ġformulated": 11605, + "Ġextrap": 11606, + "grid": 11607, + "Ġhumidity": 11608, + "uber": 11609, + "tumor": 11610, + "rous": 11611, + "Ġdistortion": 11612, + "dynamics": 11613, + "ĠLoss": 11614, + "Ġscaled": 11615, + "Ġischemia": 11616, + "Ġaxes": 11617, + "Ġquantit": 11618, + "nit": 11619, + "ĠRegion": 11620, + "ained": 11621, + "Ġfill": 11622, + "Ġbranching": 11623, + "ĠTiss": 11624, + "cross": 11625, + "Ġplatelet": 11626, + "iffiffiffiff": 11627, + "rops": 11628, + "lux": 11629, + "join": 11630, + "uracy": 11631, + "icide": 11632, + "ĠLouis": 11633, + "Ġ": 11634, + "Ġstrings": 11635, + "yset": 11636, + "Ġfacial": 11637, + "ĠMMP": 11638, + "RES": 11639, + "Ġhydrolysis": 11640, + "ĠCanadian": 11641, + "Ġprojective": 11642, + "Ġscatter": 11643, + "uron": 11644, + "ĠPsych": 11645, + "complex": 11646, + "ĠNam": 11647, + "Ġconcurrent": 11648, + "IONS": 11649, + "Ġthous": 11650, + "Ġchance": 11651, + "Ġplacement": 11652, + "Ġawareness": 11653, + "Ġtrib": 11654, + "ĠTex": 11655, + "ĠThird": 11656, + "Ġlabeling": 11657, + "cerol": 11658, + "Ġsaw": 11659, + "ĠBand": 11660, + "ĠPear": 11661, + "Ġpregnant": 11662, + "ĠDown": 11663, + "platin": 11664, + "Seq": 11665, + "xe": 11666, + "ethylene": 11667, + "ĠHigher": 11668, + "Ġreality": 11669, + "uris": 11670, + "ĠPAR": 11671, + "lb": 11672, + "dose": 11673, + "shif": 11674, + "iliar": 11675, + "total": 11676, + "SW": 11677, + "Ġvalve": 11678, + "nder": 11679, + "н": 11680, + "amous": 11681, + "Ġendomet": 11682, + "LISA": 11683, + "Ġfractures": 11684, + "Ġfilt": 11685, + "role": 11686, + "Ġmicrostructure": 11687, + "ĠSNP": 11688, + "TER": 11689, + "ĠZnO": 11690, + "oving": 11691, + "ali": 11692, + "ĠGM": 11693, + "unct": 11694, + "Ġextensions": 11695, + "expression": 11696, + "Ġescape": 11697, + "ĠMas": 11698, + "ĠSpanish": 11699, + "Ġfloor": 11700, + "ĠCommon": 11701, + "otopy": 11702, + "plementation": 11703, + "Ġrhyth": 11704, + "Ġserves": 11705, + "yto": 11706, + "Ġwavelengths": 11707, + "emptyset": 11708, + "ĠHill": 11709, + "nor": 11710, + "ĠElectro": 11711, + "Ġdehydrogen": 11712, + "Ġwhom": 11713, + "imetric": 11714, + "ĠRoman": 11715, + "ĠVe": 11716, + "âī¥": 11717, + "ĠKu": 11718, + "ĠTransfer": 11719, + "Äĩ": 11720, + "ĠTF": 11721, + "brain": 11722, + "coprotein": 11723, + "ĠGreat": 11724, + "aven": 11725, + "ĠIndividual": 11726, + "uri": 11727, + "Ġfungi": 11728, + "Ġparam": 11729, + "pton": 11730, + "symmetry": 11731, + "Ġlock": 11732, + "meas": 11733, + "Ġhaem": 11734, + "Ġhip": 11735, + "Ass": 11736, + "enger": 11737, + "Ġpotassium": 11738, + "anal": 11739, + "ibrary": 11740, + "Ġschools": 11741, + "natal": 11742, + "Ġalleles": 11743, + "ĠHLA": 11744, + "oxygen": 11745, + "ĠCup": 11746, + "Ġpurely": 11747, + "DO": 11748, + "Ġchip": 11749, + "ôı": 11750, + "Car": 11751, + "sil": 11752, + "Ġunlikely": 11753, + "correspond": 11754, + "ĠDP": 11755, + "Ġintense": 11756, + "Ġforcing": 11757, + "ĠJournal": 11758, + "Ġarrow": 11759, + "ocyan": 11760, + "Ġcultiv": 11761, + "Ġblind": 11762, + "Ġselecting": 11763, + "ocarcinoma": 11764, + "rance": 11765, + "Ġhydrophobic": 11766, + "closed": 11767, + "Ġensures": 11768, + "Ġpromoted": 11769, + "Ġdetectable": 11770, + "ranean": 11771, + "Ġschedule": 11772, + "Ġpartly": 11773, + "Ġgland": 11774, + "Ġcouple": 11775, + "ĠEmerg": 11776, + "Ġtraces": 11777, + "poly": 11778, + "Ġprotease": 11779, + "ystic": 11780, + "Ġdocuments": 11781, + "positions": 11782, + "Ġdriver": 11783, + "tium": 11784, + "ĠCYP": 11785, + "close": 11786, + "ĠRecep": 11787, + "Ġpermit": 11788, + "Ġblocked": 11789, + "Ġinvestigating": 11790, + "ĠTumor": 11791, + "ĠBig": 11792, + "Ġwavegu": 11793, + "Ġsubstance": 11794, + "Ġweaker": 11795, + "ĠMont": 11796, + "rovers": 11797, + "ĠMexico": 11798, + "pres": 11799, + "ĠAcute": 11800, + "Ġmicrogl": 11801, + "ĠES": 11802, + "itoring": 11803, + "ĠSeries": 11804, + "lights": 11805, + "Ġhypothesized": 11806, + "Ġconstructs": 11807, + "Ġfiltration": 11808, + "Black": 11809, + "Ġunchanged": 11810, + "Ġobservable": 11811, + "Ġray": 11812, + "between": 11813, + "Ġ": 11814, + "ĠPosition": 11815, + "Ġthi": 11816, + "ĠSystematic": 11817, + "Class": 11818, + "km": 11819, + "ĠTak": 11820, + "Ġrespondents": 11821, + "Ġinnate": 11822, + "Ġant": 11823, + "Ġconnecting": 11824, + "Rel": 11825, + "Ġmanipulation": 11826, + "ĠNeg": 11827, + "NPs": 11828, + "ĠDiab": 11829, + "ĠActive": 11830, + "ĠGall": 11831, + "ĠCoulomb": 11832, + "Ġspacing": 11833, + "ĠFlor": 11834, + "Ġconductance": 11835, + "Ġtracks": 11836, + "ĠZhu": 11837, + "weighted": 11838, + "rocy": 11839, + "Ġfather": 11840, + "idium": 11841, + "structured": 11842, + "ĠTel": 11843, + "Ġstrom": 11844, + "ithub": 11845, + "certain": 11846, + "But": 11847, + "ĠAccess": 11848, + "Ġpreventing": 11849, + "restrial": 11850, + "ĠConsidering": 11851, + "true": 11852, + "Ġhosts": 11853, + "Ġworst": 11854, + "ĠPd": 11855, + "gredi": 11856, + "Ġglycol": 11857, + "Ġstory": 11858, + "osquito": 11859, + "paratus": 11860, + "Ġmeeting": 11861, + "Ġepisode": 11862, + "nc": 11863, + "ĠSand": 11864, + "Ġuint": 11865, + "ynamical": 11866, + "urt": 11867, + "Ġeducational": 11868, + "Ġfocuses": 11869, + "gt": 11870, + "ĠHS": 11871, + "Ġdeterminant": 11872, + "Ġlithium": 11873, + "ĠDigital": 11874, + "Ġguidance": 11875, + "Ġpriority": 11876, + "Ġparty": 11877, + "orial": 11878, + "Two": 11879, + "ĠProblems": 11880, + "Ġseman": 11881, + "ĠCNN": 11882, + "ĠEpid": 11883, + "Ġplaying": 11884, + "Ġelimination": 11885, + "ĠSat": 11886, + "Ġobjectives": 11887, + "plectic": 11888, + "Ġcircumst": 11889, + "ĠGS": 11890, + "ocellular": 11891, + "otrans": 11892, + "Ġfinds": 11893, + "Ġaromatic": 11894, + "izers": 11895, + "Ġfavorable": 11896, + "standard": 11897, + "ichlor": 11898, + "models": 11899, + "otyping": 11900, + "Ġstabilization": 11901, + "Ġhandling": 11902, + "Ġcoated": 11903, + "even": 11904, + "Ġletter": 11905, + "ZE": 11906, + "Ġultrason": 11907, + "Ġfriend": 11908, + "Ġsensiti": 11909, + "Ġattachment": 11910, + "Ġapart": 11911, + "Ġgrey": 11912, + "Ġaircraft": 11913, + "ĠrRNA": 11914, + "Ġenabled": 11915, + "Ġbuff": 11916, + "Ġredox": 11917, + "assisted": 11918, + "Ġgenerality": 11919, + "PSS": 11920, + "Ġelection": 11921, + "response": 11922, + "Ġdedicated": 11923, + "Ġdemographic": 11924, + "Ġimposed": 11925, + "ĠKir": 11926, + "ĠRadio": 11927, + "ĠELISA": 11928, + "gae": 11929, + "Ġresc": 11930, + "ĠRic": 11931, + "raphic": 11932, + "Ġrail": 11933, + "Ġjournal": 11934, + "oler": 11935, + "WS": 11936, + "Ġincorporation": 11937, + "wind": 11938, + "Ġauditory": 11939, + "AE": 11940, + "task": 11941, + "Ġpc": 11942, + "wall": 11943, + "Ġapprec": 11944, + "aterials": 11945, + "Ġpartner": 11946, + "Ġcollective": 11947, + "Ġscoring": 11948, + "ĠFrank": 11949, + "Ġpermanent": 11950, + "ĠIran": 11951, + "umination": 11952, + "Med": 11953, + "ĠHybrid": 11954, + "Ġphenotypic": 11955, + "Ġdisruption": 11956, + "violet": 11957, + "ospheric": 11958, + "Ġregimes": 11959, + "ĠColor": 11960, + "ĠPatient": 11961, + "Ġfever": 11962, + "Ġnn": 11963, + "Ġvariational": 11964, + "keys": 11965, + "Ġdistill": 11966, + "Ġspectroscopic": 11967, + "ĠArchitect": 11968, + "acing": 11969, + "Ġproves": 11970, + "Ġverteb": 11971, + "ĠComputer": 11972, + "Ġexpensive": 11973, + "Ġfrozen": 11974, + "arcoma": 11975, + "NK": 11976, + "Ġhistone": 11977, + "Ġpolymerization": 11978, + "Ġtob": 11979, + "Ġturned": 11980, + "effective": 11981, + "ĠAuthor": 11982, + "API": 11983, + "Ġdecade": 11984, + "ĠRobert": 11985, + "Example": 11986, + "overset": 11987, + "ABLE": 11988, + "ĠBehavior": 11989, + "feed": 11990, + "ĠTai": 11991, + "Ġ": 11992, + "Ġegg": 11993, + "Ġcath": 11994, + "aux": 11995, + "ĠJohnson": 11996, + "Ġtorque": 11997, + "Ġpurification": 11998, + "White": 11999, + "cious": 12000, + "ĠSong": 12001, + "Ġprecipit": 12002, + "reshold": 12003, + "Ġmilitary": 12004, + "Ġconvection": 12005, + "ĠMiddle": 12006, + "ĠWhe": 12007, + "Ġôı": 12008, + "aland": 12009, + "aration": 12010, + "figure": 12011, + "Ġdeduce": 12012, + "chloro": 12013, + "cost": 12014, + "ithmetic": 12015, + "ĠItalian": 12016, + "missible": 12017, + "ĠCommunity": 12018, + "ĠNature": 12019, + "Ġdioxide": 12020, + "Ġbalanced": 12021, + "ett": 12022, + "STAT": 12023, + "ilding": 12024, + "Ġevolved": 12025, + "Ġmonot": 12026, + "pur": 12027, + "Ġpreferences": 12028, + "dinger": 12029, + "Ġargue": 12030, + "Ġmotions": 12031, + "Ġinfant": 12032, + "Ġaccelerated": 12033, + "Ġobserver": 12034, + "Ġfabrication": 12035, + "ĠMechanisms": 12036, + "Ġfunctor": 12037, + "Ġharves": 12038, + "rase": 12039, + "ĠSpecial": 12040, + "Ġdeposits": 12041, + "Ġrub": 12042, + "à¸": 12043, + "ĠCPU": 12044, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 12045, + "atomical": 12046, + "Ġfinit": 12047, + "Ġsecure": 12048, + "Ġnutritional": 12049, + "renal": 12050, + "ĠFalse": 12051, + "Ġshel": 12052, + "Ġrecruited": 12053, + "ambig": 12054, + "ĠSignaling": 12055, + "KO": 12056, + "organisms": 12057, + "ĠLT": 12058, + "elen": 12059, + "ĠMarc": 12060, + "abatic": 12061, + "Ġtables": 12062, + "Ġconfined": 12063, + "ĠAz": 12064, + "Ġproductivity": 12065, + "Ġadherence": 12066, + "Ġreplicates": 12067, + "Ġvirt": 12068, + "fin": 12069, + "Ġagricultural": 12070, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 12071, + "ĠChampionship": 12072, + "anda": 12073, + "ĠChurch": 12074, + "During": 12075, + "Ġinserted": 12076, + "ighter": 12077, + "Ġxen": 12078, + "Ġsave": 12079, + "Ġtangent": 12080, + "venous": 12081, + "Ġconverge": 12082, + "Ġdistinguished": 12083, + "Ġexplos": 12084, + "Ġaortic": 12085, + "Ġjump": 12086, + "Ġneonatal": 12087, + "udden": 12088, + "Ġslower": 12089, + "Ġinfarction": 12090, + "Ġprevents": 12091, + "uer": 12092, + "Ġeros": 12093, + "RP": 12094, + "Ġcontinues": 12095, + "ORT": 12096, + "Ġconsiders": 12097, + "ĠNuclear": 12098, + "lymp": 12099, + "Ġaccounted": 12100, + "oresis": 12101, + "Ġneighboring": 12102, + "ĠRichard": 12103, + "Ġenfor": 12104, + "ĠChronic": 12105, + "Ġdiscover": 12106, + "ĠHong": 12107, + "cells": 12108, + "ĠChall": 12109, + "Ġhomogen": 12110, + "Ġatheros": 12111, + "Ġisolate": 12112, + "ĠPlasma": 12113, + "ĠDL": 12114, + "parametric": 12115, + "ĠUpper": 12116, + "HP": 12117, + "Ġintroduces": 12118, + "Ġmothers": 12119, + "Ġattract": 12120, + "Ġexclusion": 12121, + "gravity": 12122, + "ĠKr": 12123, + "Ġspike": 12124, + "ĠHeat": 12125, + "vival": 12126, + "ĠRNAs": 12127, + "bach": 12128, + "atorial": 12129, + "ĠLtd": 12130, + "onomy": 12131, + "invasive": 12132, + "lass": 12133, + "Ġwells": 12134, + "Ġimaginary": 12135, + "Ġcarbohyd": 12136, + "oda": 12137, + "Ġactivate": 12138, + "µĦ": 12139, + "Ġenzymatic": 12140, + "pes": 12141, + "Ġstatements": 12142, + "Ġapproximated": 12143, + "ĠSalmon": 12144, + "ophageal": 12145, + "ĠHPV": 12146, + "conf": 12147, + "umat": 12148, + "Ġsulfur": 12149, + "ĠRecall": 12150, + "Ġchond": 12151, + "Ġviable": 12152, + "poration": 12153, + "Ġcarefully": 12154, + "tetra": 12155, + "Ġlymphoma": 12156, + "stat": 12157, + "Ġconservative": 12158, + "atabase": 12159, + "mand": 12160, + "Ġscored": 12161, + "Ġvas": 12162, + "Ġprivacy": 12163, + "onymous": 12164, + "Ġlogarithmic": 12165, + "ĠEcon": 12166, + "Ġachieves": 12167, + "Ġabundances": 12168, + "cam": 12169, + "Ġcyan": 12170, + "ĠEL": 12171, + "idelity": 12172, + "jo": 12173, + "Ġanticip": 12174, + "reported": 12175, + "Ġarrangement": 12176, + "iterranean": 12177, + "psis": 12178, + "ichi": 12179, + "Ġta": 12180, + "umping": 12181, + "ĠActivation": 12182, + "Ġmelt": 12183, + "Ġanno": 12184, + "oge": 12185, + "ĠDam": 12186, + "optimal": 12187, + "Ġneurological": 12188, + "sa": 12189, + "ĠParameters": 12190, + "offset": 12191, + "Ġcement": 12192, + "Ġinhibiting": 12193, + "Ġchose": 12194, + "itzer": 12195, + "attr": 12196, + "Ġmoder": 12197, + "atories": 12198, + "Ġteaching": 12199, + "ĠCore": 12200, + "phthal": 12201, + "ĠLuc": 12202, + "Ġingredi": 12203, + "Ġclearance": 12204, + "Ġachieving": 12205, + "tage": 12206, + "Ġburst": 12207, + "vie": 12208, + "ĠSpain": 12209, + "pto": 12210, + "Ġtransmembrane": 12211, + "Ġsupplementary": 12212, + "Ġtoken": 12213, + "Ġobviously": 12214, + "ĠVector": 12215, + "Ġdestr": 12216, + "HOD": 12217, + "Ġassumes": 12218, + "Ġpenetration": 12219, + "Ġsubjective": 12220, + "holds": 12221, + "ão": 12222, + "Ġmotiv": 12223, + "Ġproviders": 12224, + "vascular": 12225, + "Ġdepartment": 12226, + "ocket": 12227, + "File": 12228, + "Ġbreath": 12229, + "ĠBest": 12230, + "grable": 12231, + "Ġliqu": 12232, + "ĠArg": 12233, + "ĠBob": 12234, + "Ġfragmentation": 12235, + "ectic": 12236, + "Ġvital": 12237, + "since": 12238, + "alloc": 12239, + "oxyphenyl": 12240, + "Ġradiotherapy": 12241, + "ĠSDS": 12242, + "Ġcytometry": 12243, + "nucle": 12244, + "ĠIM": 12245, + "ĠTeV": 12246, + "rafish": 12247, + "ĠKorea": 12248, + "Ġstrengthen": 12249, + "Ġbare": 12250, + "Ġwoman": 12251, + "Ġradar": 12252, + "Ġplatforms": 12253, + "ozygous": 12254, + "ĠAh": 12255, + "Ġsubtypes": 12256, + "pyrid": 12257, + "ĠTranscription": 12258, + "Ġáº": 12259, + "ĠMeasurements": 12260, + "Ġsurviv": 12261, + "ĠNear": 12262, + "Ġcascade": 12263, + "outhe": 12264, + "BU": 12265, + "Ġexponentially": 12266, + "Ġhazard": 12267, + "ĠsiRNA": 12268, + "Ġcellulose": 12269, + "Figs": 12270, + "Ġdifferentiated": 12271, + "Ġimplicated": 12272, + "metric": 12273, + "Ġcorrelate": 12274, + "Ġmission": 12275, + "Ġmantle": 12276, + "ĠPhyl": 12277, + "ĠHart": 12278, + "Ġgases": 12279, + "Ġunity": 12280, + "Ġexpert": 12281, + "Ġchart": 12282, + "Ġdict": 12283, + "Ġepile": 12284, + "Ġoffspring": 12285, + "Ġemerged": 12286, + "Ġdemands": 12287, + "Ġpresum": 12288, + "orbid": 12289, + "ĠMedicine": 12290, + "Ġstreams": 12291, + "ticed": 12292, + "ĠNic": 12293, + "Ġfilling": 12294, + "ĠCro": 12295, + "Ġrestrictions": 12296, + "See": 12297, + "ĠMill": 12298, + "Ġparental": 12299, + "Ġdeterminants": 12300, + "Ġecosystem": 12301, + "ĠWall": 12302, + "ĠMemory": 12303, + "plets": 12304, + "Ġaggregates": 12305, + "perturb": 12306, + "Ġresidents": 12307, + "ACK": 12308, + "vectors": 12309, + "Ġmanually": 12310, + "Ġïĺ": 12311, + "ĠFramework": 12312, + "Ġvag": 12313, + "ebrafish": 12314, + "lib": 12315, + "ĠHeart": 12316, + "ĠAnimal": 12317, + "Ġwider": 12318, + "Gene": 12319, + "ĠRos": 12320, + "Ġoperate": 12321, + "Ġpossibilities": 12322, + "ĠStrong": 12323, + "Ġpyro": 12324, + "respectively": 12325, + "Ġhybridization": 12326, + "ipedia": 12327, + "xin": 12328, + "Ġstom": 12329, + "fish": 12330, + "ĠForce": 12331, + "Ġdimer": 12332, + "SUL": 12333, + "else": 12334, + "Ġunde": 12335, + "gar": 12336, + "conv": 12337, + "Ġarrival": 12338, + "Ġmonoclonal": 12339, + "IAL": 12340, + "Ġly": 12341, + "Ġsymmetries": 12342, + "Ġnursing": 12343, + "rach": 12344, + "ĠóµĦ": 12345, + "Ġbiased": 12346, + "Ġcues": 12347, + "Ġbiomarker": 12348, + "ders": 12349, + "Ġcrow": 12350, + "ernels": 12351, + "Ġbilateral": 12352, + "Ġphysically": 12353, + "Ġpatches": 12354, + "Ġuncon": 12355, + "ĠBefore": 12356, + "default": 12357, + "estyle": 12358, + "tfrac": 12359, + "ĠCox": 12360, + "Ġinfiltration": 12361, + "Ġconvert": 12362, + "Ġstrengths": 12363, + "ĠSar": 12364, + "igible": 12365, + "ocomp": 12366, + "Ġstir": 12367, + "Ġschizophrenia": 12368, + "was": 12369, + "Ġow": 12370, + "eterm": 12371, + "ĠOrder": 12372, + "Ġfoss": 12373, + "Ġlineage": 12374, + "Ġrabbit": 12375, + "Ġregularization": 12376, + "ranch": 12377, + "oplastic": 12378, + "TO": 12379, + "Ġmeasurable": 12380, + "Ġmang": 12381, + "initial": 12382, + "Ġbuildings": 12383, + "Ġsystematically": 12384, + "Ġfermions": 12385, + "Ġlibraries": 12386, + "Ġablation": 12387, + "ideos": 12388, + "ĠWi": 12389, + "photon": 12390, + "ĠTesting": 12391, + "ĠComputing": 12392, + "tier": 12393, + "inet": 12394, + "Ġprimitive": 12395, + "Ġcapillary": 12396, + "Ġslip": 12397, + "vergence": 12398, + "rapeutic": 12399, + "ĠBlue": 12400, + "ĠAcad": 12401, + "hai": 12402, + "ĠLew": 12403, + "Ġtriangular": 12404, + "MSO": 12405, + "Ġsalinity": 12406, + "Ġnanocom": 12407, + "oa": 12408, + "Ġhomomorphism": 12409, + "ĠMM": 12410, + "Ġresin": 12411, + "DB": 12412, + "uminescence": 12413, + "dashed": 12414, + "ĠKh": 12415, + "quark": 12416, + "embles": 12417, + "Ġidentifies": 12418, + "Ġfollic": 12419, + "Ġmetam": 12420, + "ĠHerm": 12421, + "Ġtobacco": 12422, + "Ġrealization": 12423, + "hydrox": 12424, + "ĠBet": 12425, + "Because": 12426, + "Ġpieces": 12427, + "Ġtalk": 12428, + "Ġopened": 12429, + "asome": 12430, + "Ġsurge": 12431, + "Ġfluctuation": 12432, + "github": 12433, + "ĠBacter": 12434, + "Ġbinds": 12435, + "ĠRapid": 12436, + "auer": 12437, + "pH": 12438, + "embed": 12439, + "ĠDoc": 12440, + "uchi": 12441, + "ĠCandid": 12442, + "Ġrarely": 12443, + "Ġmountain": 12444, + "ĠFat": 12445, + "Ġsend": 12446, + "ovsk": 12447, + "ĠOrganization": 12448, + "ĠFranc": 12449, + "ĠOP": 12450, + "âμ": 12451, + "okes": 12452, + "ece": 12453, + "deficient": 12454, + "Ġlinkage": 12455, + "odon": 12456, + "Ġfly": 12457, + "Ġtidal": 12458, + "ĠExamples": 12459, + "ĠRout": 12460, + "Ġaccommod": 12461, + "Suppose": 12462, + "adap": 12463, + "Ġdie": 12464, + "root": 12465, + "Ġhon": 12466, + "Ġminimizing": 12467, + "Ġroughness": 12468, + "Ġgrass": 12469, + "enta": 12470, + "ĠLang": 12471, + "edu": 12472, + "ĠSimple": 12473, + "enic": 12474, + "Ġinducing": 12475, + "tf": 12476, + "Ġcontexts": 12477, + "ĠGeneralized": 12478, + "ĠWnt": 12479, + "Pb": 12480, + "atomic": 12481, + "dem": 12482, + "ĠPreparation": 12483, + "Ġinsufficient": 12484, + "sam": 12485, + "ĠSpecies": 12486, + "ĠSolar": 12487, + "Ġunsigned": 12488, + "ĠHER": 12489, + "âĬ": 12490, + "Ġparity": 12491, + "Ġnitrate": 12492, + "ĠCer": 12493, + "ptic": 12494, + "identif": 12495, + "geal": 12496, + "Ġemotion": 12497, + "ĠLP": 12498, + "Ġenhancing": 12499, + "Ġmeaningful": 12500, + "station": 12501, + "Ġrelig": 12502, + "yo": 12503, + "Ġperspectives": 12504, + "Ġscans": 12505, + "uginosa": 12506, + "Ġsummarize": 12507, + "relations": 12508, + "Ġdistant": 12509, + "Ġfunctionality": 12510, + "Ġdeeper": 12511, + "olate": 12512, + "ĠPor": 12513, + "graphs": 12514, + "ĠWa": 12515, + "ophilic": 12516, + "CLUS": 12517, + "ropathy": 12518, + "Ġcred": 12519, + "Ġuniversity": 12520, + "seg": 12521, + "vee": 12522, + "OG": 12523, + "ĠMen": 12524, + "ĠCritical": 12525, + "ãģ": 12526, + "Ġexit": 12527, + "vartheta": 12528, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 12529, + "Ġunf": 12530, + "Ġproposal": 12531, + "Ġtyrosine": 12532, + "otides": 12533, + "Ġproximity": 12534, + "Ġboxes": 12535, + "caten": 12536, + "ĠEnvironmental": 12537, + "bounded": 12538, + "downarrow": 12539, + "Ġfalls": 12540, + "Ġfertil": 12541, + "Ġcomprised": 12542, + "Ġmellitus": 12543, + "Ġleakage": 12544, + "uty": 12545, + "Ġchromosomes": 12546, + "ĠStatistics": 12547, + "%%%%": 12548, + "Ġcombinator": 12549, + "Ġket": 12550, + "advant": 12551, + "Ther": 12552, + "Ġtopics": 12553, + "flat": 12554, + "nia": 12555, + "ĠSpectral": 12556, + "Ġsynchronization": 12557, + "varrho": 12558, + "Ġcolonies": 12559, + "ĠFive": 12560, + "agues": 12561, + "ĠFC": 12562, + "IDS": 12563, + "Ġaward": 12564, + "Ġyielding": 12565, + "Ġarchitectures": 12566, + "ashington": 12567, + "chitz": 12568, + "perty": 12569, + "Ġmoduli": 12570, + "moment": 12571, + "speed": 12572, + "Ġmesenchymal": 12573, + "optera": 12574, + "Ġincomp": 12575, + "Cell": 12576, + "ĠMice": 12577, + "Ġgot": 12578, + "teger": 12579, + "Ġtau": 12580, + "ĠAdS": 12581, + "Ġbill": 12582, + "Ġdrinking": 12583, + "ulsive": 12584, + "Ġknockdown": 12585, + "Ġarms": 12586, + "ĠAutom": 12587, + "ĠIncreased": 12588, + "HF": 12589, + "Ġglobally": 12590, + "Ġdoping": 12591, + "Ġath": 12592, + "ĠCop": 12593, + "Ġsuccessive": 12594, + "ULT": 12595, + "eless": 12596, + "Ġbleeding": 12597, + "Ġfoods": 12598, + "Ġimmunohist": 12599, + "Ġdefinite": 12600, + "ĠJones": 12601, + "ĠTS": 12602, + "Ġjoined": 12603, + "ĠTowards": 12604, + "ĠCs": 12605, + "Ġunlike": 12606, + "Ġvalence": 12607, + "dor": 12608, + "oS": 12609, + "Ġpush": 12610, + "Ġoffice": 12611, + "Ġaluminum": 12612, + "idyl": 12613, + "idirectional": 12614, + "written": 12615, + "Ġbubble": 12616, + "HI": 12617, + "Ġmarkedly": 12618, + "ĠTok": 12619, + "Ġvesicles": 12620, + "Ġquotient": 12621, + "Ġreproduce": 12622, + "Ġelsewhere": 12623, + "ĠMyc": 12624, + "Ġinfrastructure": 12625, + "Ġgained": 12626, + "abel": 12627, + "ĠSex": 12628, + "ĠTables": 12629, + "etin": 12630, + "Ġhomolog": 12631, + "Ġlegal": 12632, + "hea": 12633, + "Ġsociety": 12634, + "Ġmanaged": 12635, + "idase": 12636, + "ĠInhibition": 12637, + "Ġparasite": 12638, + "Ġvolunte": 12639, + "ATP": 12640, + "ios": 12641, + "Ġsepsis": 12642, + "Ġribosomal": 12643, + "Ġconfound": 12644, + "ĠStaphyl": 12645, + "aryngeal": 12646, + "ïĢ": 12647, + "comb": 12648, + "ĠObjective": 12649, + "SULTS": 12650, + "Ġthorough": 12651, + "mt": 12652, + "Ġchest": 12653, + "Vector": 12654, + "element": 12655, + "Ġvirulence": 12656, + "Ġhemisp": 12657, + "Ġsought": 12658, + "ĠKo": 12659, + "Ġnutrition": 12660, + "uling": 12661, + "iana": 12662, + "Ġprototype": 12663, + "ĠOnt": 12664, + "cine": 12665, + "Ġdotted": 12666, + "Ġobese": 12667, + "ountered": 12668, + "Ġphysicians": 12669, + "Ġmini": 12670, + "Ľľ": 12671, + "spaces": 12672, + "Ġexclusively": 12673, + "ĠConvolution": 12674, + "Ġcaspase": 12675, + "ĠLink": 12676, + "div": 12677, + "ĠRoyal": 12678, + "hist": 12679, + "itness": 12680, + "Ġester": 12681, + "Ġconducting": 12682, + "Ġparticipated": 12683, + "Ġairway": 12684, + "Ġaeruginosa": 12685, + "Ext": 12686, + "argument": 12687, + "ocking": 12688, + "Ġintegrate": 12689, + "Ġcontrovers": 12690, + "apes": 12691, + "training": 12692, + "ĠPrevalence": 12693, + "temp": 12694, + "both": 12695, + "Ġreactivity": 12696, + "Ġranking": 12697, + "Ġtunneling": 12698, + "ODE": 12699, + "ĠMediterranean": 12700, + "Ġresonances": 12701, + "Mg": 12702, + "Ġlib": 12703, + "ĠHeter": 12704, + "Ġnothing": 12705, + "Ġindication": 12706, + "ĠHM": 12707, + "ocytic": 12708, + "strand": 12709, + "Ġcollaboration": 12710, + "Ġelectrostatic": 12711, + "Ġindependence": 12712, + "hab": 12713, + "Ġconflic": 12714, + "Ġiod": 12715, + "inus": 12716, + "Ġdependency": 12717, + "ĠLam": 12718, + "Ġexamining": 12719, + "Ġoccupied": 12720, + "Ġqueue": 12721, + "ĠBul": 12722, + "Ġregistered": 12723, + "Ġindividually": 12724, + "Rx": 12725, + "ausal": 12726, + "VE": 12727, + "Ġbrightness": 12728, + "respons": 12729, + "balance": 12730, + "Ġcytotoxic": 12731, + "fall": 12732, + "commut": 12733, + "ICAL": 12734, + "uran": 12735, + "aining": 12736, + "raulic": 12737, + "results": 12738, + "Ġepisodes": 12739, + "YS": 12740, + "ĠGar": 12741, + "Ġsurfact": 12742, + "drug": 12743, + "Ġcities": 12744, + "ĠChange": 12745, + "osition": 12746, + "Ġtriggered": 12747, + "Ġcytoplasmic": 12748, + "erves": 12749, + "Ġlex": 12750, + "Ġasymptotically": 12751, + "phy": 12752, + "Ġfrontal": 12753, + "ĠDensity": 12754, + "Ġsynerg": 12755, + "cycle": 12756, + "ĠImproved": 12757, + "ø": 12758, + "Ġmono": 12759, + "Ġaccumulated": 12760, + "oriented": 12761, + "bour": 12762, + "Ġtunnel": 12763, + "coming": 12764, + "Ġapparatus": 12765, + "Ġencountered": 12766, + "Cre": 12767, + "Ġletters": 12768, + "etch": 12769, + "Ġexcessive": 12770, + "Ġbiofilm": 12771, + "Ġrearrang": 12772, + "Ġpolymorphisms": 12773, + "erobic": 12774, + "Ġconnect": 12775, + "resolved": 12776, + "ĠNN": 12777, + "Ġretro": 12778, + "ĠIniti": 12779, + "ĠQuantif": 12780, + "Ġpup": 12781, + "Tensor": 12782, + "Ġsentences": 12783, + "lay": 12784, + "rants": 12785, + "ploid": 12786, + "ĠAnderson": 12787, + "Ġdesirable": 12788, + "stud": 12789, + "iability": 12790, + "Ġdrying": 12791, + "ecess": 12792, + "Ġdens": 12793, + "Ġdescript": 12794, + "ĠËĨ": 12795, + "Ġclones": 12796, + "Ġjuven": 12797, + "bp": 12798, + "Ġkil": 12799, + "HL": 12800, + "Ġhemorrh": 12801, + "ĠKi": 12802, + "How": 12803, + "Ġenerge": 12804, + "Ġsubsection": 12805, + "ĠSac": 12806, + "dial": 12807, + "Ġcardiomy": 12808, + "Ġtouch": 12809, + "dm": 12810, + "Ġscienti": 12811, + "oides": 12812, + "ĠÃĤ": 12813, + "ysaccharide": 12814, + "Ġsclerosis": 12815, + "ĠZealand": 12816, + "inine": 12817, + "Ġunusual": 12818, + "ĠBA": 12819, + "ipschitz": 12820, + "gap": 12821, + "ĠDifferences": 12822, + "Ġduality": 12823, + "edical": 12824, + "Ġlign": 12825, + "Ġfails": 12826, + "Ġlect": 12827, + "Ġrelate": 12828, + "Ġincorrect": 12829, + "Ġspecify": 12830, + "Ġcylindrical": 12831, + "ĠPF": 12832, + "ĠLind": 12833, + "Ġdeterior": 12834, + "Ġherb": 12835, + "dz": 12836, + "Ġweld": 12837, + "Ġnominal": 12838, + "copy": 12839, + "Ġacetyl": 12840, + "html": 12841, + "Ġrecognize": 12842, + "***": 12843, + "itian": 12844, + "WA": 12845, + "ĠMN": 12846, + "ĠFind": 12847, + "Ġauthentic": 12848, + "perture": 12849, + "Ġcytotoxicity": 12850, + "ofl": 12851, + "ĠGet": 12852, + "Ġcohomology": 12853, + "Ġremainder": 12854, + "Ġexpanding": 12855, + "Ġheav": 12856, + "osterone": 12857, + "Right": 12858, + "Ġcopol": 12859, + "Ġshed": 12860, + "Ġcompliance": 12861, + "Ġacidic": 12862, + "oric": 12863, + "Ġamyloid": 12864, + "Ġevaporation": 12865, + "dl": 12866, + "Ġdelays": 12867, + "Po": 12868, + "ĠCHECK": 12869, + "tains": 12870, + "Ġreversed": 12871, + "ĠMPa": 12872, + "Ġprocessor": 12873, + "Ġhall": 12874, + "ĠLast": 12875, + "Ġplasm": 12876, + "ĠAssociated": 12877, + "ĠBasic": 12878, + "inos": 12879, + "Ġsymptom": 12880, + "ãĢ": 12881, + "Ġanthrop": 12882, + "Ġjudg": 12883, + "Ġeti": 12884, + "kle": 12885, + "Ġwrong": 12886, + "room": 12887, + "Ġdevelopments": 12888, + "ĠMaximum": 12889, + "Ġcoatings": 12890, + "Ġheuristic": 12891, + "rontal": 12892, + "Some": 12893, + "Ġutilize": 12894, + "ĠâĪħ": 12895, + "coll": 12896, + "ĠRelated": 12897, + "Ġdegeneration": 12898, + "template": 12899, + "Ġmodulated": 12900, + "Ġparametri": 12901, + "Ġsaliv": 12902, + "ĠPseudomonas": 12903, + "Ġantigens": 12904, + "Ġharmon": 12905, + "ĠLHC": 12906, + "doi": 12907, + "ensitive": 12908, + "ĠNotice": 12909, + "ĠMoh": 12910, + "tilage": 12911, + "ACS": 12912, + "Ġdiscrepancy": 12913, + "Ġspik": 12914, + "Ġrestrict": 12915, + "itrile": 12916, + "leg": 12917, + "ĠBase": 12918, + "Ġconvolutional": 12919, + "ĠResistance": 12920, + "Ġappearing": 12921, + "ĠImages": 12922, + "ĠMann": 12923, + "Ġreact": 12924, + "Ġmacrophage": 12925, + "Ġwavelet": 12926, + "ochrom": 12927, + "Ġfairly": 12928, + "Ġpreceding": 12929, + "Ġspir": 12930, + "network": 12931, + "ĠNak": 12932, + "IFT": 12933, + "Ġago": 12934, + "Ġencryp": 12935, + "ald": 12936, + "ensin": 12937, + "Ġsulph": 12938, + "ĠPolymer": 12939, + "ĠArt": 12940, + "Ġsubunits": 12941, + "shot": 12942, + "Ġbegins": 12943, + "Ġexer": 12944, + "propto": 12945, + "Ġnurses": 12946, + "Ġsuffices": 12947, + "Ġgraded": 12948, + "ĠRock": 12949, + "Ġuniquely": 12950, + "itol": 12951, + "Ġspiral": 12952, + "Ġthanks": 12953, + "character": 12954, + "ĠDistributed": 12955, + "ĠCart": 12956, + "Form": 12957, + "Ġformulations": 12958, + "ictionary": 12959, + "Ġspreading": 12960, + "Ġsingularity": 12961, + "Ġpigs": 12962, + "itu": 12963, + "otrophic": 12964, + "ÑĢ": 12965, + "Ġsemiconductor": 12966, + "Ġdrag": 12967, + "next": 12968, + "maxim": 12969, + "unn": 12970, + "Ġargued": 12971, + "plastic": 12972, + "Ġdehydrogenase": 12973, + "Ġreinforcement": 12974, + "entral": 12975, + "ĠDS": 12976, + "Ġcompanies": 12977, + "Ġquantization": 12978, + "ĠDri": 12979, + "Ġsimpler": 12980, + "Ġradii": 12981, + "ĠEthics": 12982, + "ĠElectronic": 12983, + "taken": 12984, + "Ġpharmacological": 12985, + "pson": 12986, + "Ġpairing": 12987, + "Ġnest": 12988, + "ĠRS": 12989, + "Ġlic": 12990, + "ocon": 12991, + "Ġobserving": 12992, + "ĠFM": 12993, + "IES": 12994, + "Ġsubmitted": 12995, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 12996, + "Ġnoisy": 12997, + "Ġvanishing": 12998, + "ĠTechnologies": 12999, + "ilst": 13000, + "agic": 13001, + "Ġembeddings": 13002, + "Ġplans": 13003, + "reak": 13004, + "oct": 13005, + "Ġepithelium": 13006, + "Ġreversible": 13007, + "Ġrequests": 13008, + "Vi": 13009, + "ĠProg": 13010, + "methoxy": 13011, + "uria": 13012, + "Ġslice": 13013, + "Ġmetastases": 13014, + "ĠMary": 13015, + "Ġpriori": 13016, + "Ġexplains": 13017, + "ĠSigma": 13018, + "ĠArmy": 13019, + "Ġprey": 13020, + "KL": 13021, + "ĠPass": 13022, + "Ġreproduction": 13023, + "Ġfermentation": 13024, + "ulo": 13025, + "Ġproofs": 13026, + "ĠAccordingly": 13027, + "tist": 13028, + "ĠïĢ©": 13029, + "Ġmeat": 13030, + "Ġplanned": 13031, + "Ġangiogenesis": 13032, + "WR": 13033, + "ĠAust": 13034, + "Similarly": 13035, + "ĠWashington": 13036, + "Ġrefinement": 13037, + "Ġembryo": 13038, + "Ġdissociation": 13039, + "án": 13040, + "plasia": 13041, + "ĠGro": 13042, + "Ġsimilarities": 13043, + "Ġsolubility": 13044, + "Ġimmobil": 13045, + "ĠScot": 13046, + "ĠSubsequently": 13047, + "divid": 13048, + "Ġclosest": 13049, + "ĠWat": 13050, + "ĠâĮ": 13051, + "ĠAGN": 13052, + "Ġprescribed": 13053, + "Ġmosquito": 13054, + "Ġfirm": 13055, + "Ġdegenerate": 13056, + "Ġethyl": 13057, + "Ġharvest": 13058, + "ĠSpecific": 13059, + "Ġcompartment": 13060, + "public": 13061, + "ĠBiological": 13062, + "Ġpiece": 13063, + "Ġattitudes": 13064, + "Ġspray": 13065, + "ĠSix": 13066, + "Ġprofessionals": 13067, + "Ġslot": 13068, + "Ġretrieved": 13069, + "vement": 13070, + "Ġexecuted": 13071, + "seed": 13072, + "Ġoutflow": 13073, + "distance": 13074, + "ĠTerm": 13075, + "ady": 13076, + "ĠProvince": 13077, + "ĠCentre": 13078, + "ĠDFT": 13079, + "Ġsudden": 13080, + "Ġseiz": 13081, + "rat": 13082, + "romo": 13083, + "otechn": 13084, + "Ġhighlights": 13085, + "Ġelectrolyte": 13086, + "ĠAdvanced": 13087, + "allow": 13088, + "px": 13089, + "osed": 13090, + "subarray": 13091, + "racks": 13092, + "PRO": 13093, + "ogeny": 13094, + "Ġpooled": 13095, + "Ġdtype": 13096, + "Ġopposed": 13097, + "ĠGrand": 13098, + "Ġdesigning": 13099, + "bel": 13100, + "itability": 13101, + "Ġminimization": 13102, + "Ġdramatically": 13103, + "Ġsoy": 13104, + "agents": 13105, + "ĠMetal": 13106, + "ĠMV": 13107, + "ribute": 13108, + "DD": 13109, + "itan": 13110, + "Ġspeeds": 13111, + "Ġmarried": 13112, + "Ġevaluations": 13113, + "ĠKingdom": 13114, + "Ġclay": 13115, + "ĠTissue": 13116, + "leftarrow": 13117, + "Ġcompensation": 13118, + "child": 13119, + "pool": 13120, + "uparrow": 13121, + "ĠDomain": 13122, + "species": 13123, + "Ġmethane": 13124, + "ĠEGFR": 13125, + "Ġparser": 13126, + "have": 13127, + "Ġneglected": 13128, + "func": 13129, + "apsed": 13130, + "Ġsays": 13131, + "adata": 13132, + "binom": 13133, + "Case": 13134, + "Ġreporter": 13135, + "Sn": 13136, + "Ġmaximize": 13137, + "Ġbifurc": 13138, + "ĠCNS": 13139, + "ĠOlymp": 13140, + "Ġdeclare": 13141, + "Ġencoder": 13142, + "Ġabelian": 13143, + "Ġsingularities": 13144, + "Ġech": 13145, + "Ψ": 13146, + "Ġproto": 13147, + "Ġphag": 13148, + "Ġpolyg": 13149, + "Ġbott": 13150, + "Ġadipose": 13151, + "uing": 13152, + "jk": 13153, + "uchy": 13154, + "ĠStudent": 13155, + "Ġnanow": 13156, + "Ġthym": 13157, + "Ed": 13158, + "End": 13159, + "Ġtransforms": 13160, + "ĠPCA": 13161, + "kern": 13162, + "regn": 13163, + "Ġcomment": 13164, + "ĠLL": 13165, + "elles": 13166, + "Ġengagement": 13167, + "ĠPeter": 13168, + "ISPR": 13169, + "ĠChannel": 13170, + "iny": 13171, + "Ġbundles": 13172, + "Ald": 13173, + "Ġpublications": 13174, + "TG": 13175, + "stra": 13176, + "Ġfear": 13177, + "Ġretic": 13178, + "plements": 13179, + "Ġcorpus": 13180, + "ĠCluster": 13181, + "ĠRate": 13182, + "Ġsimplest": 13183, + "acic": 13184, + "rbrack": 13185, + "Ġblow": 13186, + "Ġcompress": 13187, + "ĠDark": 13188, + "Ġpsychiatric": 13189, + "ĠConversely": 13190, + "Ġowing": 13191, + "Ġabsor": 13192, + "ĠHP": 13193, + "Ġcrude": 13194, + "equal": 13195, + "ĠArray": 13196, + "ĠRelative": 13197, + "Ġcombustion": 13198, + "Red": 13199, + "kt": 13200, + "ĠmA": 13201, + "Ġtex": 13202, + "porters": 13203, + "Ġdiffered": 13204, + "Ġaudio": 13205, + "zon": 13206, + "odi": 13207, + "Ġmacroscopic": 13208, + "acin": 13209, + "Ġzeros": 13210, + "Ġforeign": 13211, + "Ġduct": 13212, + "bow": 13213, + "worth": 13214, + "ĠRoad": 13215, + "rey": 13216, + "aceous": 13217, + "Ġblast": 13218, + "Ġgranul": 13219, + "Ġwing": 13220, + "Ġannotated": 13221, + "ĠFull": 13222, + "Ġinfluencing": 13223, + "vy": 13224, + "iazol": 13225, + "Ġpitch": 13226, + "Ġrehabilitation": 13227, + "ĠPrior": 13228, + "comit": 13229, + "mathtt": 13230, + "dia": 13231, + "ĠIon": 13232, + "Ġabuse": 13233, + "Ġharvested": 13234, + "Ġepidemic": 13235, + "Ġfilament": 13236, + "Ġnucleation": 13237, + "ĠKnowledge": 13238, + "rinos": 13239, + "Ġbent": 13240, + "Ġsquared": 13241, + "Ġhippocampal": 13242, + "ĠTG": 13243, + "ANT": 13244, + "modified": 13245, + "ario": 13246, + "ĠFace": 13247, + "Ġgrows": 13248, + "Ġfaults": 13249, + "virus": 13250, + "Ġpartitioning": 13251, + "airs": 13252, + "Ġhearing": 13253, + "Ġcongen": 13254, + "Ġrip": 13255, + "ĠCollabor": 13256, + "Ġinterviews": 13257, + "Ġhuge": 13258, + "Ġbreakdown": 13259, + "Ġmonthly": 13260, + "ĠCONCLUS": 13261, + "Each": 13262, + "Diff": 13263, + "Ġrelay": 13264, + "ĠMuse": 13265, + "oscopy": 13266, + "Ġrenew": 13267, + "gb": 13268, + "Ġbrid": 13269, + "Ġoutlined": 13270, + "orig": 13271, + "eat": 13272, + "ĠWithout": 13273, + "Ġspor": 13274, + "ĠTN": 13275, + "ĠJo": 13276, + "ĠAU": 13277, + "Not": 13278, + "Ġretin": 13279, + "ĠAngel": 13280, + "Ġtried": 13281, + "eyond": 13282, + "je": 13283, + "ĠRussian": 13284, + "ĠUnfortunately": 13285, + "ĠMeanwhile": 13286, + "ographs": 13287, + "Ġaccounting": 13288, + "ĠAβ": 13289, + "mb": 13290, + "Ġdopamine": 13291, + "ĠBriefly": 13292, + "ĠFrequency": 13293, + "Matrix": 13294, + "ĠJoseph": 13295, + "Ġexperts": 13296, + "Ġdrops": 13297, + "ĠRESULTS": 13298, + "Ġrectangular": 13299, + "athione": 13300, + "center": 13301, + "ĠLeft": 13302, + "inform": 13303, + "kins": 13304, + "Ġmil": 13305, + "ĠMah": 13306, + "Ġmedial": 13307, + "ĠCompany": 13308, + "Ġpassage": 13309, + "Ġleader": 13310, + "Ġscreened": 13311, + "eri": 13312, + "posites": 13313, + "rarily": 13314, + "Ġphone": 13315, + "ietic": 13316, + "Ġexpectations": 13317, + "ĠParticle": 13318, + "ĠMountain": 13319, + "Ġinterleukin": 13320, + "Ġfifth": 13321, + "Ġvast": 13322, + "Ġlogical": 13323, + "Ġterr": 13324, + "Ġcreates": 13325, + "Ġfinitely": 13326, + "Ġswim": 13327, + "Ġsupernatant": 13328, + "opathological": 13329, + "ĠUltra": 13330, + "ĠTy": 13331, + "Ġgrand": 13332, + "Ġconstitute": 13333, + "ologist": 13334, + "ĠBroad": 13335, + "aware": 13336, + "Ġvicinity": 13337, + "agulation": 13338, + "unsigned": 13339, + "ĠSize": 13340, + "ĠCognitive": 13341, + "Ġsuspected": 13342, + "Ġupl": 13343, + "Ġautoimmune": 13344, + "ĠSK": 13345, + "CB": 13346, + "Ġslices": 13347, + "ĠChi": 13348, + "Ġobservables": 13349, + "Ġhippocampus": 13350, + "sover": 13351, + "Ġfunding": 13352, + "Ġconformation": 13353, + "ĠQuestion": 13354, + "ĠSqu": 13355, + "ĠWill": 13356, + "Ġscattered": 13357, + "irty": 13358, + "Ġplaus": 13359, + "correlation": 13360, + "Ġventilation": 13361, + "ĠGenes": 13362, + "Ġbenign": 13363, + "Ġhetero": 13364, + "Status": 13365, + "angled": 13366, + "Ġbootstrap": 13367, + "Ġvaccines": 13368, + "Ġmicroorganisms": 13369, + "Ġvisits": 13370, + "Ġtheorems": 13371, + "drop": 13372, + "ĠTA": 13373, + "Ġcycling": 13374, + "Ġspectrometer": 13375, + "Ġgroundwater": 13376, + "Ġnanotubes": 13377, + "Ġjoints": 13378, + "ĠEll": 13379, + "Ġconsult": 13380, + "Ġwindows": 13381, + "Ġdisability": 13382, + "Ġgains": 13383, + "Ġdischarg": 13384, + "Ġheated": 13385, + "Ġafore": 13386, + "arying": 13387, + "incre": 13388, + "Ġaggressive": 13389, + "Ġhemod": 13390, + "arium": 13391, + "ĠInst": 13392, + "vm": 13393, + "Ġdroplet": 13394, + "ptive": 13395, + "viously": 13396, + "Ġstarch": 13397, + "Ġdf": 13398, + "osyl": 13399, + "Ġdonors": 13400, + "ĠUnlike": 13401, + "Ġalkaline": 13402, + "Ġintelligence": 13403, + "aa": 13404, + "Ġacceptance": 13405, + "Ġsliding": 13406, + "apses": 13407, + "ĠDiss": 13408, + "istan": 13409, + "auc": 13410, + "Ġbins": 13411, + "Ġmodulate": 13412, + "Ġmanage": 13413, + "outs": 13414, + "Ġsenes": 13415, + "Ġdifferentiate": 13416, + "Ġcounted": 13417, + "ASK": 13418, + "Ġantibacterial": 13419, + "Ġentered": 13420, + "Ġdisadvant": 13421, + "ĠSalmonella": 13422, + "Ġisotopic": 13423, + "Ġannounced": 13424, + "ĠBoard": 13425, + "Ġrestoration": 13426, + "Ġallevi": 13427, + "Ġprogramme": 13428, + "Ġalbumin": 13429, + "Ġcatalog": 13430, + "estine": 13431, + "Ġdifferently": 13432, + "Ġmolar": 13433, + "rödinger": 13434, + "ĠEvent": 13435, + "ministration": 13436, + "ĠSerum": 13437, + "ROM": 13438, + "kw": 13439, + "bot": 13440, + "Ġjets": 13441, + "ĠDouble": 13442, + "eler": 13443, + "Ġinfusion": 13444, + "Ġconsumed": 13445, + "ĠIron": 13446, + "ĠProcesses": 13447, + "Ġadmits": 13448, + "Ġjuris": 13449, + "ĠPeriod": 13450, + "Ġremodeling": 13451, + "alley": 13452, + "Ġenabling": 13453, + "Ġbackward": 13454, + "ĠMid": 13455, + "brevi": 13456, + "Ġclassify": 13457, + "Ġcrypt": 13458, + "Ġhelix": 13459, + "ĠJiang": 13460, + "Ġhoney": 13461, + "gestion": 13462, + "xc": 13463, + "Ġcoincides": 13464, + "ĠDN": 13465, + "Ġapoptotic": 13466, + "Ġinstall": 13467, + "ĠRever": 13468, + "ĠDoppler": 13469, + "icago": 13470, + "erals": 13471, + "Ġpie": 13472, + "ĠMars": 13473, + "ĠStaphylococcus": 13474, + "Ġnoting": 13475, + "Ġgenera": 13476, + "ĠIo": 13477, + "Ġhope": 13478, + "Ġpreserve": 13479, + "MAX": 13480, + "ynchron": 13481, + "Ġrup": 13482, + "Ġcomprising": 13483, + "ĠWay": 13484, + "Ġviolation": 13485, + "QR": 13486, + "Ġreflecting": 13487, + "Ġregularity": 13488, + "ĠSiO": 13489, + "ĠJun": 13490, + "Ġcommunications": 13491, + "rating": 13492, + "Ġfamiliar": 13493, + "Ġinstantaneous": 13494, + "Ġcortic": 13495, + "Ġapparently": 13496, + "XX": 13497, + "Ġexcitations": 13498, + "ĠAward": 13499, + "Num": 13500, + "ĠUN": 13501, + "Ġqubit": 13502, + "ĠAction": 13503, + "ĠFried": 13504, + "Ġeliminated": 13505, + "Ġaspir": 13506, + "hler": 13507, + "Ġdecoding": 13508, + "unov": 13509, + "Ġanalogue": 13510, + "ulmonary": 13511, + "Ġgeographic": 13512, + "Ġsort": 13513, + "ĠCRC": 13514, + "Aldrich": 13515, + "ĠkDa": 13516, + "ĠND": 13517, + "Ġsettle": 13518, + "exists": 13519, + "Ġstatistic": 13520, + "ĠBow": 13521, + "ĠCG": 13522, + "Ġorganizations": 13523, + "ĠMobile": 13524, + "Ġinvent": 13525, + "Ġincorporate": 13526, + "ĠFib": 13527, + "ordan": 13528, + "Ġcolleagues": 13529, + "ĠStation": 13530, + "Ġsen": 13531, + "Ġencaps": 13532, + "ĠRH": 13533, + "relim": 13534, + "Ġcarbonate": 13535, + "ĠNether": 13536, + "mem": 13537, + "EEE": 13538, + "Ġaforementioned": 13539, + "Ġpent": 13540, + "ĠSignal": 13541, + "Ġsuspended": 13542, + "Color": 13543, + "Ġspins": 13544, + "Ġproportions": 13545, + "ulty": 13546, + "Ġenrolled": 13547, + "ĠTEM": 13548, + "ĠReceptor": 13549, + "Ġprevalent": 13550, + "large": 13551, + "vs": 13552, + "Ġtruncated": 13553, + "Ġâĭħ": 13554, + "lm": 13555, + "anil": 13556, + "Ġannih": 13557, + "ĠGalaxy": 13558, + "eras": 13559, + "Ġepigenetic": 13560, + "Ġtooth": 13561, + "Ġcondensation": 13562, + "ĠTensor": 13563, + "Ġinorganic": 13564, + "ymers": 13565, + "uf": 13566, + "anese": 13567, + "aret": 13568, + "Ġarithmetic": 13569, + "âĨ": 13570, + "Ġtrying": 13571, + "Ġimplementing": 13572, + "xd": 13573, + "Ġillumination": 13574, + "ela": 13575, + "Ġdeficits": 13576, + "Ġspots": 13577, + "Ġdoesn": 13578, + "Ġresting": 13579, + "trained": 13580, + "Ġerosion": 13581, + "Ġgranular": 13582, + "Ġscar": 13583, + "Ġpollen": 13584, + "lie": 13585, + "Ġconvers": 13586, + "Ġdisturbances": 13587, + "ĠGod": 13588, + "Ġenlarg": 13589, + "ĠLate": 13590, + "ylase": 13591, + "Ġfacts": 13592, + "enty": 13593, + "ĠStreet": 13594, + "sequence": 13595, + "Ġvenous": 13596, + "ĠCheck": 13597, + "agg": 13598, + "Ġabsorbed": 13599, + "Ġcommit": 13600, + "sets": 13601, + "Ġdestroy": 13602, + "Ġbowel": 13603, + "Ġfinished": 13604, + "ĠFeed": 13605, + "Ġdoped": 13606, + "ĠAlb": 13607, + "ĠMitochond": 13608, + "Ġtheoretically": 13609, + "RI": 13610, + "Ġmeteor": 13611, + "ĠMG": 13612, + "Ġnation": 13613, + "ĠBasin": 13614, + "nik": 13615, + "Ġdepths": 13616, + "ĠMechanism": 13617, + "Ġmotifs": 13618, + "ĠHay": 13619, + "Ġmotivated": 13620, + "ĠCopy": 13621, + "ĠEastern": 13622, + "Ġpersistence": 13623, + "Ġrays": 13624, + "FB": 13625, + "andem": 13626, + "layers": 13627, + "eyer": 13628, + "ĠStrept": 13629, + "Ġregistration": 13630, + "ĠAntarctic": 13631, + "CV": 13632, + "ĠPap": 13633, + "ĠSpe": 13634, + "Ġsplicing": 13635, + "performance": 13636, + "Ġsemantics": 13637, + "Ġlocom": 13638, + "oblastoma": 13639, + "Ġmoney": 13640, + "Ġtransparent": 13641, + "Ġhr": 13642, + "ĠInteractions": 13643, + "Ġsap": 13644, + "Ġbiases": 13645, + "Ġteeth": 13646, + "ynolds": 13647, + "omethyl": 13648, + "ĠmV": 13649, + "Ġsolely": 13650, + "Ġorange": 13651, + "blast": 13652, + "ATIONS": 13653, + "call": 13654, + "opoietic": 13655, + "sided": 13656, + "ĠFox": 13657, + "ĠVideo": 13658, + "Ġinspection": 13659, + "Ġbuck": 13660, + "hesize": 13661, + "present": 13662, + "ĠAntib": 13663, + "Ġham": 13664, + "alam": 13665, + "ĠPG": 13666, + "ĠAE": 13667, + "Ġjoin": 13668, + "Ġmonocytes": 13669, + "estiv": 13670, + "Ġrandomised": 13671, + "Ġtranslocation": 13672, + "Ġincorporating": 13673, + "Ġprolifer": 13674, + "Ġodds": 13675, + "ITH": 13676, + "Ġran": 13677, + "Ġinstruction": 13678, + "Ġresolve": 13679, + "Ġft": 13680, + "ĠHead": 13681, + "Ġreagent": 13682, + "Ġadmitted": 13683, + "human": 13684, + "posure": 13685, + "ĠCha": 13686, + "ĠFr": 13687, + "Ġbroadcast": 13688, + "Ġnutrients": 13689, + "nob": 13690, + "Ġnotable": 13691, + "ĠIGF": 13692, + "ĠClearly": 13693, + "Ġquarks": 13694, + "Ġeukary": 13695, + "ĠAdd": 13696, + "itosan": 13697, + "Ġinteractive": 13698, + "itting": 13699, + "ĠComputational": 13700, + "Ġdissolution": 13701, + "istribution": 13702, + "product": 13703, + "ĠABC": 13704, + "olimits": 13705, + "biased": 13706, + "Ġtrapped": 13707, + "PK": 13708, + "ĠHPLC": 13709, + "rophot": 13710, + "zes": 13711, + "ourse": 13712, + "ĠHot": 13713, + "Ġrecipro": 13714, + "nolimits": 13715, + "ello": 13716, + "Ġassessments": 13717, + "ENTS": 13718, + "Ġalteration": 13719, + "tw": 13720, + "Ġchaotic": 13721, + "ĠLoc": 13722, + "Ġcattle": 13723, + "Ray": 13724, + "Ġformally": 13725, + "leave": 13726, + "textstyle": 13727, + "Ġventral": 13728, + "ĠWilliams": 13729, + "ĠPeople": 13730, + "ixing": 13731, + "ĠTherapy": 13732, + "Ġiii": 13733, + "ĠDT": 13734, + "Ġbic": 13735, + "Ġspheres": 13736, + "Ġvisc": 13737, + "Ġestablishment": 13738, + "Ġdescriptions": 13739, + "ĠAverage": 13740, + "Ġtour": 13741, + "ĠInfection": 13742, + "ĠLicense": 13743, + "Ġprepare": 13744, + "Hs": 13745, + "finite": 13746, + "rium": 13747, + "oreg": 13748, + "entry": 13749, + "Ġdisks": 13750, + "Ġelongation": 13751, + "cpu": 13752, + "ĠCharles": 13753, + "FIGURE": 13754, + "ston": 13755, + "ĠObservations": 13756, + "Add": 13757, + "ĠTask": 13758, + "atomy": 13759, + "igration": 13760, + "ĠDatabase": 13761, + "ĠTexas": 13762, + "Ġphyt": 13763, + "ller": 13764, + "conjug": 13765, + "onald": 13766, + "Ġheavily": 13767, + "Ġsple": 13768, + "Ġassist": 13769, + "ĠCp": 13770, + "Ġhappen": 13771, + "uv": 13772, + "ĠUniverse": 13773, + "ĠGPS": 13774, + "WE": 13775, + "Xi": 13776, + "Ġadministr": 13777, + "strong": 13778, + "Ġmagnitudes": 13779, + "Ġsimplify": 13780, + "Ġelegans": 13781, + "esh": 13782, + "ĠBody": 13783, + "ĠNetherlands": 13784, + "ï": 13785, + "ometers": 13786, + "Bo": 13787, + "FM": 13788, + "ĠNiger": 13789, + "plus": 13790, + "instance": 13791, + "Ġdistress": 13792, + "Organ": 13793, + "Cas": 13794, + "Ġsymplectic": 13795, + "Ġbreaks": 13796, + "ÑĤ": 13797, + "Ġfermion": 13798, + "emporal": 13799, + "Ġsomatic": 13800, + "event": 13801, + "neut": 13802, + "lammation": 13803, + "ĠLibrary": 13804, + "Ġmultiplic": 13805, + "ĠInstr": 13806, + "ethel": 13807, + "urys": 13808, + "Ġhelped": 13809, + "Ġcollege": 13810, + "Ġcartilage": 13811, + "Ġrpm": 13812, + "western": 13813, + "resis": 13814, + "Ġlobe": 13815, + "QL": 13816, + "Input": 13817, + "Ġemphasis": 13818, + "best": 13819, + "Ġtotally": 13820, + "ĠMETHOD": 13821, + "ĠFa": 13822, + "ĠReduction": 13823, + "icious": 13824, + "Ġimplantation": 13825, + "potential": 13826, + "problem": 13827, + "Ġobtains": 13828, + "urons": 13829, + "Ġconstructing": 13830, + "ĠMusic": 13831, + "Ġcancell": 13832, + "Ġnews": 13833, + "ĠChapter": 13834, + "Ġlabelled": 13835, + "Ġzebrafish": 13836, + "ĠSolid": 13837, + "Ġglutamate": 13838, + "ĉĉĉĉĉ": 13839, + "Ġchapter": 13840, + "ĠPresident": 13841, + "Min": 13842, + "Ġatrial": 13843, + "cp": 13844, + "fi": 13845, + "final": 13846, + "Ġtok": 13847, + "Ġeffector": 13848, + "Ġspine": 13849, + "Ġidentities": 13850, + "isco": 13851, + "olis": 13852, + "ĠCle": 13853, + "Ġinvariants": 13854, + "Path": 13855, + "ĠGon": 13856, + "factory": 13857, + "Ġexogenous": 13858, + "ĠMAPK": 13859, + "Ġanswers": 13860, + "Ġgetting": 13861, + "Rs": 13862, + "IH": 13863, + "ĠDefine": 13864, + "ĠConvolutional": 13865, + "Ġgeometrical": 13866, + "ĠInput": 13867, + "Ġà": 13868, + "Ġattenuated": 13869, + "Ġradicals": 13870, + "ĠAcademy": 13871, + "ãĥ": 13872, + "ichlet": 13873, + "Ġtorus": 13874, + "ĠTheoretical": 13875, + "ĠTD": 13876, + "Ġantiv": 13877, + "onge": 13878, + "Ġintravenous": 13879, + "Ġhypoth": 13880, + "Ġwastewater": 13881, + "ĠFlo": 13882, + "Ġporosity": 13883, + "Ġpall": 13884, + "aci": 13885, + "Ġrecordings": 13886, + "Ġeating": 13887, + "ĠDW": 13888, + "unting": 13889, + "ĠDim": 13890, + "Ġemitted": 13891, + "ĠJoint": 13892, + "ofib": 13893, + "Ġearthquake": 13894, + "Ġmunic": 13895, + "Ġreductions": 13896, + "Ġconjunction": 13897, + "ĠLocation": 13898, + "Ġestablishing": 13899, + "ĠMathematical": 13900, + "ĠSolution": 13901, + "buffer": 13902, + "arin": 13903, + "iley": 13904, + "ĠCommission": 13905, + "ĠGABA": 13906, + "ĠMuseum": 13907, + "Ġverb": 13908, + "lecules": 13909, + "infection": 13910, + "Ġinsect": 13911, + "iser": 13912, + "Ġprovision": 13913, + "Ġagreed": 13914, + "Ġafford": 13915, + "theory": 13916, + "knowledge": 13917, + "Protein": 13918, + "Ġkernels": 13919, + "Ġderm": 13920, + "Ġwish": 13921, + "Ġvox": 13922, + "Scale": 13923, + "hu": 13924, + "Ġcounterparts": 13925, + "ĠRoss": 13926, + "Ġunp": 13927, + "ĠOnline": 13928, + "Ġtransporter": 13929, + "Graph": 13930, + "Ġuter": 13931, + "Ġminute": 13932, + "Ġautomorphism": 13933, + "iltr": 13934, + "ĠRespons": 13935, + "ĠSym": 13936, + "Ġfactorization": 13937, + "sem": 13938, + "Ġmediates": 13939, + "Ġunexpected": 13940, + "Ġorganism": 13941, + "Ġattempted": 13942, + "aran": 13943, + "venue": 13944, + "etheless": 13945, + "Ġnoticed": 13946, + "ĠInvestigation": 13947, + "Ġcareg": 13948, + "Ġgrouped": 13949, + "orbit": 13950, + "Ġshortest": 13951, + "Ġbroader": 13952, + "ĠMIM": 13953, + "rises": 13954, + "veloper": 13955, + "ĠHi": 13956, + "ĠkHz": 13957, + "Ġbeads": 13958, + "Ġphyto": 13959, + "ĠDoes": 13960, + "Ġmammals": 13961, + "Ġrefined": 13962, + "volume": 13963, + "Ser": 13964, + "Ġresistivity": 13965, + "Ġterrestrial": 13966, + "Ġaxi": 13967, + "ifluor": 13968, + "Ġ£": 13969, + "Ġvice": 13970, + "ĠKel": 13971, + "VM": 13972, + "ĠTown": 13973, + "adm": 13974, + "plates": 13975, + "Ġholomorphic": 13976, + "ĠRib": 13977, + "ĠSB": 13978, + "ĠTemporal": 13979, + "src": 13980, + "Ġupdates": 13981, + "Ġseek": 13982, + "endix": 13983, + "oretic": 13984, + "warz": 13985, + "Ġroutes": 13986, + "Ġstanding": 13987, + "ĠÃģ": 13988, + "Ġclassic": 13989, + "Ġpale": 13990, + "lections": 13991, + "Ġclassifiers": 13992, + "Ġpathophys": 13993, + "Ġmounted": 13994, + "Ġdesignated": 13995, + "Ġvideos": 13996, + "Ġincoming": 13997, + "Ġguarantees": 13998, + "Ġparasites": 13999, + "ĠBacillus": 14000, + "four": 14001, + "Ġâ΍": 14002, + "Ġcommutative": 14003, + "stackrel": 14004, + "ĠBanach": 14005, + "Ġdealing": 14006, + "emporary": 14007, + "Multi": 14008, + "otomy": 14009, + "reting": 14010, + "Ġnond": 14011, + "ĠConference": 14012, + "tzmann": 14013, + "Ġphosphorus": 14014, + "Ġchemicals": 14015, + "Ġdispar": 14016, + "degree": 14017, + "Ġarbitrarily": 14018, + "rocyte": 14019, + "Ġparabolic": 14020, + "Ġdimensionless": 14021, + "Ġosm": 14022, + "Ġphonon": 14023, + "tiary": 14024, + "ĠSect": 14025, + "ophysical": 14026, + "ĠMapping": 14027, + "bis": 14028, + "ĠCommunication": 14029, + "Ġmimic": 14030, + "Ġregulators": 14031, + "Ġneutrophils": 14032, + "fn": 14033, + "ĠImportantly": 14034, + "Ġmere": 14035, + "Ġconfirms": 14036, + "agram": 14037, + "Ġattend": 14038, + "ungal": 14039, + "ĠGroups": 14040, + "Ġzo": 14041, + "Ġmouth": 14042, + "Ġsteep": 14043, + "Ġprevented": 14044, + "Ġdepressive": 14045, + "acies": 14046, + "ĠLS": 14047, + "Ġnitric": 14048, + "Ġvisualized": 14049, + "Ġtranscriptome": 14050, + "Ġgait": 14051, + "ercury": 14052, + "Ġshot": 14053, + "ĠVen": 14054, + "Ġexchang": 14055, + "Ġintention": 14056, + "ĠTang": 14057, + "Ġfavour": 14058, + "veolar": 14059, + "Ġpermission": 14060, + "Ġhabitats": 14061, + "Ġmaize": 14062, + "inct": 14063, + "Ġtelevision": 14064, + "rystals": 14065, + "ĠRadi": 14066, + "Ġflavon": 14067, + "Ġcann": 14068, + "iota": 14069, + "ĠOT": 14070, + "pic": 14071, + "Rad": 14072, + "titial": 14073, + "ĠOrth": 14074, + "stellar": 14075, + "ĠKine": 14076, + "Ġnavigation": 14077, + "fast": 14078, + "ĠCRISPR": 14079, + "Ġkinematic": 14080, + "Ġsearching": 14081, + "Ġmicrom": 14082, + "Ġinstalled": 14083, + "ĠTaiwan": 14084, + "ila": 14085, + "rf": 14086, + "riage": 14087, + "plinary": 14088, + "Ġecho": 14089, + "rav": 14090, + "ĠLes": 14091, + "create": 14092, + "Ġubiquit": 14093, + "Ġprecursors": 14094, + "KE": 14095, + "Ġdivide": 14096, + "Ġlnc": 14097, + "ĠConstruction": 14098, + "anic": 14099, + "estim": 14100, + "isters": 14101, + "Ġfeet": 14102, + "ariant": 14103, + "ĠSchw": 14104, + "Ġexclude": 14105, + "Ġvolcan": 14106, + "ĠOverview": 14107, + "Ġyr": 14108, + "olk": 14109, + "Ġ©": 14110, + "ĠFE": 14111, + "Ġspermat": 14112, + "Ġcapacitance": 14113, + "ĠSchrödinger": 14114, + "ĠGE": 14115, + "Ġcalibrated": 14116, + "SEM": 14117, + "Ġlattices": 14118, + "plier": 14119, + "Arg": 14120, + "ĠNT": 14121, + "ĠEnhanced": 14122, + "Ġbrom": 14123, + "Ġmultip": 14124, + "Ġcertified": 14125, + "Ġislands": 14126, + "Ġcyst": 14127, + "Ġaltitude": 14128, + "edef": 14129, + "Ġconstrain": 14130, + "Ġsatisfactory": 14131, + "Ġspecialized": 14132, + "Ġjunctions": 14133, + "Ġcoronavirus": 14134, + "udge": 14135, + "exc": 14136, + "Ġalt": 14137, + "ĠBacterial": 14138, + "Ġseasons": 14139, + "ĠLM": 14140, + "Ġhistogram": 14141, + "Ġsolvents": 14142, + "average": 14143, + "Ġcardinal": 14144, + "chrom": 14145, + "python": 14146, + "dered": 14147, + "enia": 14148, + "ĠGH": 14149, + "ĠEss": 14150, + "____": 14151, + "ĠPak": 14152, + "sized": 14153, + "ĠHg": 14154, + "Ġelif": 14155, + "ĠSchematic": 14156, + "Ġcytoplasm": 14157, + "ĠFort": 14158, + "ania": 14159, + "Ġcareful": 14160, + "ĠDual": 14161, + "Ġtranslated": 14162, + "Ġnasal": 14163, + "Inv": 14164, + "Ġdaughter": 14165, + "Ġemphasize": 14166, + "modules": 14167, + "Ġlives": 14168, + "Ġhomotopy": 14169, + "Ġbot": 14170, + "Ġdisordered": 14171, + "mato": 14172, + "Second": 14173, + "Ġclaimed": 14174, + "addle": 14175, + "Ġinterfacial": 14176, + "Ġviscous": 14177, + "Ġdestination": 14178, + "ĠPlanck": 14179, + "Ġabsorbance": 14180, + "Ġvolatile": 14181, + "Ġstorm": 14182, + "Ġcarboxyl": 14183, + "ĠBank": 14184, + "ĠPack": 14185, + "Ġscaffold": 14186, + "tebr": 14187, + "ipot": 14188, + "Ġtumours": 14189, + "ĠGol": 14190, + "Ġelectrophoresis": 14191, + "Ġrealize": 14192, + "Ġconstituents": 14193, + "Sol": 14194, + "ĠEvery": 14195, + "Ġmediate": 14196, + "Ġcoincide": 14197, + "Ġexploit": 14198, + "Ġmonoton": 14199, + "measure": 14200, + "Ġsupplied": 14201, + "racellular": 14202, + "Ġferro": 14203, + "Ġpurs": 14204, + "erentially": 14205, + "trast": 14206, + "ĠRB": 14207, + "Ġdissem": 14208, + "asy": 14209, + "Ġrelating": 14210, + "null": 14211, + "uates": 14212, + "constant": 14213, + "ĠContinuous": 14214, + "Ġgeometries": 14215, + "rust": 14216, + "ĠSTR": 14217, + "cluster": 14218, + "Ġprogenitor": 14219, + "ĠCSF": 14220, + "ĠYam": 14221, + "ĠReynolds": 14222, + "ĠMY": 14223, + "ĠKO": 14224, + "ĠWalk": 14225, + "ariable": 14226, + "inder": 14227, + "ĠRight": 14228, + "ĠAlgebra": 14229, + "ĠWik": 14230, + "Ġinactivation": 14231, + "tmp": 14232, + "access": 14233, + "ĠLater": 14234, + "Ġmicrobiome": 14235, + "Ġgeodesic": 14236, + "Ġrejection": 14237, + "uses": 14238, + "Ġhardness": 14239, + "Ġhydrodynamic": 14240, + "Ġvanish": 14241, + "Ġpollut": 14242, + "amycin": 14243, + "ĠÏŃ": 14244, + "ipitation": 14245, + "Ġaugmented": 14246, + "ĠTT": 14247, + "aval": 14248, + "Ġencode": 14249, + "Ġtoxin": 14250, + "eto": 14251, + "ighbor": 14252, + "addr": 14253, + "Ġdamaged": 14254, + "oi": 14255, + "Ġtransduction": 14256, + "Ġinteracts": 14257, + "ÃŃa": 14258, + "ĠCall": 14259, + "riends": 14260, + "ĠMonitoring": 14261, + "ĠVariation": 14262, + "Ġôı¼": 14263, + "Ġdich": 14264, + "Ġspars": 14265, + "align": 14266, + "Ġanatomical": 14267, + "Ġcentrifuged": 14268, + "urally": 14269, + "ĠZr": 14270, + "ĠCarl": 14271, + "Recall": 14272, + "Ġopinion": 14273, + "Ġera": 14274, + "Ġdrainage": 14275, + "Ġmicroarray": 14276, + "status": 14277, + "umental": 14278, + "Ġcomprises": 14279, + "pressure": 14280, + "Ġpractition": 14281, + "mac": 14282, + "Ġcongr": 14283, + "urnal": 14284, + "ĠAPI": 14285, + "ĠLR": 14286, + "Ġtransfection": 14287, + "Ġslopes": 14288, + "ĠCode": 14289, + "Ġphil": 14290, + "bool": 14291, + "Ws": 14292, + "ĠâĻ": 14293, + "Ġassociate": 14294, + "otoxicity": 14295, + "rade": 14296, + "ĠMiller": 14297, + "ĠϪ": 14298, + "Ġshorten": 14299, + "Ġadditionally": 14300, + "ĠEffective": 14301, + "Ġsupervised": 14302, + "Ġelabor": 14303, + "ĠCellular": 14304, + "Ġtell": 14305, + "ĠRC": 14306, + "save": 14307, + "imid": 14308, + "Ġratings": 14309, + "ĠTaking": 14310, + "Ġapproval": 14311, + "Ġpenalty": 14312, + "KK": 14313, + "context": 14314, + "aks": 14315, + "pecific": 14316, + "Ġtempor": 14317, + "Ġupregulation": 14318, + "VAL": 14319, + "Ġencodes": 14320, + "inin": 14321, + "Ġnotes": 14322, + "ĠForest": 14323, + "Ġcombinatorial": 14324, + "ymptotic": 14325, + "Ġsquamous": 14326, + "ĠAsh": 14327, + "ourn": 14328, + "Ġmyeloid": 14329, + "elines": 14330, + "Bio": 14331, + "Ġbreed": 14332, + "ĠRub": 14333, + "uzz": 14334, + "Ġsinglet": 14335, + "enna": 14336, + "Ġcritically": 14337, + "dig": 14338, + "disci": 14339, + "Ġdropped": 14340, + "Ġlipoprotein": 14341, + "ĠEt": 14342, + "Ġnov": 14343, + "ophen": 14344, + "Ġancient": 14345, + "Base": 14346, + "Ġsmoothing": 14347, + "itives": 14348, + "pine": 14349, + "Ġsolver": 14350, + "perm": 14351, + "ĠHome": 14352, + "Ġazim": 14353, + "lVert": 14354, + "Ġtransportation": 14355, + "Ġdex": 14356, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 14357, + "opathic": 14358, + "experim": 14359, + "âĢ¢âĢ¢": 14360, + "perfusion": 14361, + "Ġdoi": 14362, + "ĠLact": 14363, + "Ġhepatocellular": 14364, + "Ġmismatch": 14365, + "Ġadenocarcinoma": 14366, + "ĠPain": 14367, + "Ġspr": 14368, + "Ġconfinement": 14369, + "Ġexceeds": 14370, + "Ġhash": 14371, + "ĠComparing": 14372, + "ĠSensor": 14373, + "Ġfiring": 14374, + "kes": 14375, + "vir": 14376, + "inea": 14377, + "affected": 14378, + "Ġmodelled": 14379, + "Ġether": 14380, + "Ġsuffer": 14381, + "â̲â̲": 14382, + "оÐ": 14383, + "ĠBir": 14384, + "Äģ": 14385, + "Ġsecreted": 14386, + "Ġcatheter": 14387, + "Ġyouth": 14388, + "expl": 14389, + "ĠDar": 14390, + "ĠWHO": 14391, + "Ġfoundation": 14392, + "Ġhydraulic": 14393, + "ĠCarol": 14394, + "SSION": 14395, + "Ġá¹": 14396, + "feld": 14397, + "avor": 14398, + "Ġpasses": 14399, + "visiae": 14400, + "Ġapplicability": 14401, + "Ġnested": 14402, + "Fl": 14403, + "ĠCatal": 14404, + "Ġmicroenvironment": 14405, + "labels": 14406, + "Ġcrystallization": 14407, + "Info": 14408, + "Ġpositioning": 14409, + "Ġtriangles": 14410, + "Ġtryp": 14411, + "ĠTransition": 14412, + "Ġsett": 14413, + "Ġneurot": 14414, + "Mon": 14415, + "Ġdroplets": 14416, + "ĠART": 14417, + "Ġcorne": 14418, + "Ġmultiplicity": 14419, + "Ġeccentric": 14420, + "Ġiv": 14421, + "ĠMatter": 14422, + "learning": 14423, + "electro": 14424, + "ĠWeyl": 14425, + "Ġdecide": 14426, + "ĠWr": 14427, + "ĠHierarch": 14428, + "Ġapical": 14429, + "Ġfailures": 14430, + "Ġdigestion": 14431, + "MIC": 14432, + "Ġgeographical": 14433, + "ĠElement": 14434, + "ĠThough": 14435, + "Ġchron": 14436, + "limited": 14437, + "ĠDISC": 14438, + "ĠArchitecture": 14439, + "Ġvibrational": 14440, + "ĠVarious": 14441, + "Ġdynamically": 14442, + "aked": 14443, + "Ġconvenience": 14444, + "ĠIsra": 14445, + "ĠMDA": 14446, + "itic": 14447, + "Au": 14448, + "Ġassistance": 14449, + "ventional": 14450, + "midt": 14451, + "ospor": 14452, + "Following": 14453, + "Ġinferior": 14454, + "Ġnickel": 14455, + "raine": 14456, + "paren": 14457, + "Ġtitanium": 14458, + "Field": 14459, + "Ġhoc": 14460, + "ĠCauchy": 14461, + "ĠMcC": 14462, + "ĠScreen": 14463, + "Ġneglect": 14464, + "classes": 14465, + "ĠIF": 14466, + "Ġstratified": 14467, + "enses": 14468, + "ĠPlate": 14469, + "ozoic": 14470, + "Ġinstitutions": 14471, + "ĠThose": 14472, + "Ġgenerations": 14473, + "transform": 14474, + "Ġpartitions": 14475, + "Rxiv": 14476, + "enth": 14477, + "Ġstic": 14478, + "olith": 14479, + "ĠFem": 14480, + "Ġagar": 14481, + "beam": 14482, + "Ġprotons": 14483, + "LU": 14484, + "Ġworkload": 14485, + "Ġminerals": 14486, + "Ġmt": 14487, + "lla": 14488, + "ĠPharmac": 14489, + "Ġconverter": 14490, + "ĠMechanical": 14491, + "Ġflavor": 14492, + "Ġphosphatase": 14493, + "Ġsums": 14494, + "PCs": 14495, + "Ġisoforms": 14496, + "igroup": 14497, + "pyr": 14498, + "features": 14499, + "Ġperc": 14500, + "Ġcompleteness": 14501, + "Ġforests": 14502, + "Ġdividing": 14503, + "ĠLipschitz": 14504, + "periodic": 14505, + "Ġrecycl": 14506, + "ĠNag": 14507, + "Ġtwin": 14508, + "eptides": 14509, + "Ġcohor": 14510, + "Ġsearches": 14511, + "eated": 14512, + "Hg": 14513, + "ĠPU": 14514, + "ĠTree": 14515, + "allic": 14516, + "PF": 14517, + "Ġappendix": 14518, + "ĠCov": 14519, + "Ġchecking": 14520, + "Ġbackbone": 14521, + "Thermo": 14522, + "Ġactivating": 14523, + "ĠVictor": 14524, + "Ġcritic": 14525, + "ĠLem": 14526, + "groups": 14527, + "REG": 14528, + "ĠOcc": 14529, + "SCC": 14530, + "ĠXRD": 14531, + "ĠValues": 14532, + "Ġsubtype": 14533, + "Ġstretching": 14534, + "ORM": 14535, + "some": 14536, + "Ġflip": 14537, + "Ġphenolic": 14538, + "Ġkilled": 14539, + "Ġsequenced": 14540, + "uscular": 14541, + "abin": 14542, + "Ġquadr": 14543, + "Ġtranslational": 14544, + "Ġsolids": 14545, + "direct": 14546, + "Ġpromotion": 14547, + "Ġcohorts": 14548, + "ĠClimate": 14549, + "ĠOld": 14550, + "ĠSir": 14551, + "gue": 14552, + "strate": 14553, + "ĠPoss": 14554, + "Ġreceives": 14555, + "ĠValidation": 14556, + "uctive": 14557, + "Ġcerevisiae": 14558, + "Gu": 14559, + "isis": 14560, + "ceil": 14561, + "ĠPearson": 14562, + "ĠPrelim": 14563, + "ĠGran": 14564, + "CSF": 14565, + "Ġsterile": 14566, + "ofluorescence": 14567, + "bad": 14568, + "Ġcolored": 14569, + "compass": 14570, + "equation": 14571, + "jan": 14572, + "Ġconditioning": 14573, + "Ġvoice": 14574, + "Ġmening": 14575, + "Ġgranted": 14576, + "Ġrenormalization": 14577, + "ĠLimit": 14578, + "thi": 14579, + "Ġaperture": 14580, + "Ġdosage": 14581, + "directed": 14582, + "ĠBreast": 14583, + "ocular": 14584, + "bearing": 14585, + "sal": 14586, + "ascul": 14587, + "upervised": 14588, + "Ġmonolayer": 14589, + "Ġmembership": 14590, + "ĠWireless": 14591, + "show": 14592, + "ĠMedia": 14593, + "ĠVL": 14594, + "essel": 14595, + "Ġdecoder": 14596, + "ĠMF": 14597, + "ĠComposition": 14598, + "ĠClark": 14599, + "Point": 14600, + "ĠNano": 14601, + "ĠDeg": 14602, + "NL": 14603, + "ĠBox": 14604, + "Ġexploring": 14605, + "molecular": 14606, + "Other": 14607, + "ĠDiabetes": 14608, + "height": 14609, + "Ġkinases": 14610, + "Ġadjusting": 14611, + "Ġsports": 14612, + "offs": 14613, + "ĠIEEE": 14614, + "Ġtil": 14615, + "ĠIntra": 14616, + "Ġplanets": 14617, + "ĠEpidem": 14618, + "Ġtomato": 14619, + "Ġscaffolds": 14620, + "ĠMetabol": 14621, + "ĠGeometry": 14622, + "imetry": 14623, + "ĠTen": 14624, + "thread": 14625, + "ohex": 14626, + "Ġproposes": 14627, + "prim": 14628, + "ĠParty": 14629, + "Ġquarter": 14630, + "ĠShi": 14631, + "Ġaberr": 14632, + "ĠIntr": 14633, + "Ġdirector": 14634, + "affe": 14635, + "ĠSus": 14636, + "ensors": 14637, + "Ele": 14638, + "Ġpoles": 14639, + "Additional": 14640, + "Ġbypass": 14641, + "catenin": 14642, + "Ġundertaken": 14643, + "imation": 14644, + "opor": 14645, + "Ġpreserving": 14646, + "Ġmultiplex": 14647, + "ĠRepresentative": 14648, + "sis": 14649, + "ĠAG": 14650, + "achy": 14651, + "Ġfruits": 14652, + "Ġreconstruct": 14653, + "ensen": 14654, + "Ġstrongest": 14655, + "Ġscav": 14656, + "ĠCheng": 14657, + "ĠCoron": 14658, + "ĠObservation": 14659, + "ĠAch": 14660, + "ĠGeorg": 14661, + "ĠSVM": 14662, + "ĠChern": 14663, + "Ġreversal": 14664, + "via": 14665, + "imp": 14666, + "Ġdeployment": 14667, + "ĠHad": 14668, + "Ġcircumstances": 14669, + "obi": 14670, + "Ġcurved": 14671, + "Induced": 14672, + "ĠPositive": 14673, + "imb": 14674, + "ĠParis": 14675, + "ĠStein": 14676, + "icz": 14677, + "ĠCath": 14678, + "Ġdrawing": 14679, + "tory": 14680, + "Ġcontinental": 14681, + "Ġquantitatively": 14682, + "acerb": 14683, + "Ġnorms": 14684, + "ĠBE": 14685, + "Several": 14686, + "door": 14687, + "Ġplateau": 14688, + "Gal": 14689, + "Ġcivil": 14690, + "ĠFix": 14691, + "LAB": 14692, + "occal": 14693, + "Ġsorted": 14694, + "ĠâĢĿ": 14695, + "Ġediting": 14696, + "ĠChristian": 14697, + "Ġclarify": 14698, + "Ġwaveguide": 14699, + "bell": 14700, + "Ġdeduced": 14701, + "odec": 14702, + "utrition": 14703, + "Ġcompressive": 14704, + "ĠEU": 14705, + "ĠRegression": 14706, + "Ġranked": 14707, + "Ġestimators": 14708, + "Ġabilities": 14709, + "Ġbeliefs": 14710, + "three": 14711, + "ĠâĩĴ": 14712, + "rology": 14713, + "Ġautonomous": 14714, + "ĠSz": 14715, + "schem": 14716, + "ĠALT": 14717, + "ĠPatterns": 14718, + "Ġexon": 14719, + "Ġlifestyle": 14720, + "fill": 14721, + "ĠCAR": 14722, + "ĠDomains": 14723, + "Ġpaid": 14724, + "Ġtab": 14725, + "ĠCohen": 14726, + "airy": 14727, + "Ġsheep": 14728, + "Ġseaw": 14729, + "ĠKong": 14730, + "gas": 14731, + "Ġreserved": 14732, + "Ġresil": 14733, + "Ġobl": 14734, + "carbox": 14735, + "ĠGovernment": 14736, + "upper": 14737, + "racting": 14738, + "Ġgangl": 14739, + "ĠRV": 14740, + "Ġbronch": 14741, + "Methods": 14742, + "ĠLiver": 14743, + "Ġguess": 14744, + "charomy": 14745, + "ICE": 14746, + "Ġcongenital": 14747, + "Ġka": 14748, + "Ġspanning": 14749, + "ĠRecomm": 14750, + "ea": 14751, + "Ġconvention": 14752, + "Ġsheets": 14753, + "Ġthermo": 14754, + "Ġqualitatively": 14755, + "Ġoxides": 14756, + "Ġcongru": 14757, + "ĠJer": 14758, + "Ġpreservation": 14759, + "ĠBT": 14760, + "ĠDMSO": 14761, + "Ġcomplication": 14762, + "Ġsurvivors": 14763, + "Ġreduct": 14764, + "Ġdescent": 14765, + "Ġsucrose": 14766, + "ĠCourt": 14767, + "Ġmetabolite": 14768, + "ĠMath": 14769, + "ĠSecurity": 14770, + "ĠNotably": 14771, + "ĠStem": 14772, + "Ġdwarf": 14773, + "bc": 14774, + "Ġrevis": 14775, + "ĠKl": 14776, + "ĠGh": 14777, + "Ġmanager": 14778, + "Ġinvestment": 14779, + "Ġmotility": 14780, + "Em": 14781, + "ĠMr": 14782, + "asic": 14783, + "ĠBos": 14784, + "Ġinspired": 14785, + "placian": 14786, + "Ġease": 14787, + "Ġtorsion": 14788, + "ĠDirichlet": 14789, + "Ġspleen": 14790, + "agation": 14791, + "onate": 14792, + "ĠTrial": 14793, + "Ġturnover": 14794, + "Ġselectively": 14795, + "ĠÍĴ": 14796, + "iano": 14797, + "Ġnontrivial": 14798, + "iasis": 14799, + "Ñģ": 14800, + "ĠGuo": 14801, + "Ġaddresses": 14802, + "Ġuniqueness": 14803, + "Ġwithdraw": 14804, + "riz": 14805, + "Ġcomputationally": 14806, + "Ġpersonality": 14807, + "AX": 14808, + "wenty": 14809, + "Ġgovern": 14810, + "berts": 14811, + "Ġrobots": 14812, + "Ġready": 14813, + "Ġdiets": 14814, + "lit": 14815, + "My": 14816, + "ĠReve": 14817, + "ĠLos": 14818, + "infrared": 14819, + "Ġintram": 14820, + "lated": 14821, + "plankton": 14822, + "ĠGrant": 14823, + "piper": 14824, + "Ġantennas": 14825, + "Ġbol": 14826, + "fp": 14827, + "ĠVit": 14828, + "Compar": 14829, + "oken": 14830, + "Ġkeys": 14831, + "ĠClub": 14832, + "inery": 14833, + "ĠFoot": 14834, + "Ġwarming": 14835, + "mond": 14836, + "Ġmiles": 14837, + "Ġspeaking": 14838, + "ĠIv": 14839, + "Ġconformational": 14840, + "ĠOk": 14841, + "Ġunified": 14842, + "Ġassembled": 14843, + "Ġinverted": 14844, + "Ġfelt": 14845, + "corresponding": 14846, + "ĠECM": 14847, + "ĠNSC": 14848, + "Ġindoor": 14849, + "gov": 14850, + "Ġantagonist": 14851, + "unched": 14852, + "ĠJava": 14853, + "ĠCombined": 14854, + "tivities": 14855, + "Ġalternating": 14856, + "ãĤ": 14857, + "ĠDiagnosis": 14858, + "Ġdistinction": 14859, + "leigh": 14860, + "ĠTogether": 14861, + "Ġparticipating": 14862, + "Ġglomer": 14863, + "oche": 14864, + "Ġcopyright": 14865, + "ĠGTP": 14866, + "ĠVar": 14867, + "Ġammonium": 14868, + "Ġfacilitates": 14869, + "Ġperfusion": 14870, + "ĠLB": 14871, + "full": 14872, + "Ġreti": 14873, + "iferase": 14874, + "Ġimmunosup": 14875, + "ĠImplementation": 14876, + "Ġpores": 14877, + "ĠBB": 14878, + "ĠBud": 14879, + "ĠVO": 14880, + "ĠVo": 14881, + "Ġphysician": 14882, + "ĠAUC": 14883, + "Ġcertainly": 14884, + "μm": 14885, + "ĠKol": 14886, + "Ġwrap": 14887, + "middle": 14888, + "Ġsilencing": 14889, + "Ġfreshwater": 14890, + "igan": 14891, + "area": 14892, + "AI": 14893, + "Ġmicrotub": 14894, + "Ġarranged": 14895, + "structive": 14896, + "ĠRegular": 14897, + "ĠFile": 14898, + "alks": 14899, + "Ġplain": 14900, + "Ġintegrable": 14901, + "ĠMembrane": 14902, + "istors": 14903, + "Ġaquatic": 14904, + "Ġworkflow": 14905, + "ĠGer": 14906, + "ulant": 14907, + "Ġactivates": 14908, + "Term": 14909, + "ĠUpon": 14910, + "ĠPut": 14911, + "Var": 14912, + "ĠOD": 14913, + "half": 14914, + "Ġulcer": 14915, + "ĠBO": 14916, + "ĠGy": 14917, + "rences": 14918, + "Ġpurity": 14919, + "Ġarrive": 14920, + "ĠSignificant": 14921, + "ĠMAC": 14922, + "ĠOtherwise": 14923, + "oured": 14924, + "Ġtan": 14925, + "ĠRL": 14926, + "ĠQTL": 14927, + "Ġammonia": 14928, + "vmode": 14929, + "Ġmagnesium": 14930, + "Ġacknowled": 14931, + "Ġalternatives": 14932, + "idents": 14933, + "rVert": 14934, + "ĠComplete": 14935, + "ĠBone": 14936, + "yer": 14937, + "ĠBab": 14938, + "Ġeut": 14939, + "Ġnovo": 14940, + "disciplinary": 14941, + "Ġseverely": 14942, + "uki": 14943, + "ĠPN": 14944, + "leavevmode": 14945, + "clip": 14946, + "ĠSynd": 14947, + "ĠMIMO": 14948, + "adequ": 14949, + "ĠArctic": 14950, + "lycer": 14951, + "RET": 14952, + "ensed": 14953, + "coated": 14954, + "VP": 14955, + "Ġlakes": 14956, + "Ġchurch": 14957, + "Ġhomologous": 14958, + "Ġoxidase": 14959, + "ĠAud": 14960, + "Ġincrement": 14961, + "Ġneutrinos": 14962, + "arbon": 14963, + "TYPE": 14964, + "izumab": 14965, + "utable": 14966, + "Ġimplying": 14967, + "ĠMotion": 14968, + "Ġâīĥ": 14969, + "Ġpages": 14970, + "Ġplausible": 14971, + "ĠNL": 14972, + "Ġisotop": 14973, + "ĠHyd": 14974, + "Att": 14975, + "lattice": 14976, + "shore": 14977, + "Ġsucceed": 14978, + "Ġsupposed": 14979, + "ĠTransmission": 14980, + "Dimensional": 14981, + "inguistic": 14982, + "Ġcontours": 14983, + "Ġconcomit": 14984, + "Ġagrees": 14985, + "ĠDani": 14986, + "quar": 14987, + "Ġshield": 14988, + "Ġozone": 14989, + "ĠTet": 14990, + "lbrack": 14991, + "Ġwat": 14992, + "Ġcytochrome": 14993, + "tailed": 14994, + "pix": 14995, + "Ġcoex": 14996, + "ĠView": 14997, + "odef": 14998, + "ĠWild": 14999, + "ĠLE": 15000, + "hop": 15001, + "Ġpointing": 15002, + "uncture": 15003, + "Ġecology": 15004, + "Ġbab": 15005, + "rea": 15006, + "ego": 15007, + "Ġviolence": 15008, + "ĠtRNA": 15009, + "ĠRN": 15010, + "pent": 15011, + "orel": 15012, + "ĠParallel": 15013, + "Ġdrives": 15014, + "nobreak": 15015, + "Ġholog": 15016, + "Ġprobable": 15017, + "Ġentering": 15018, + "Ġsink": 15019, + "Ġswelling": 15020, + "producing": 15021, + "âĨĴâĪŀ": 15022, + "ĠSafety": 15023, + "Ġanalyse": 15024, + "series": 15025, + "Ġdrivers": 15026, + "KS": 15027, + "ĠRMS": 15028, + "Ġgenetics": 15029, + "ĠFred": 15030, + "Ġsubm": 15031, + "Ġscientists": 15032, + "ĠFD": 15033, + "ĠSolutions": 15034, + "ĠFab": 15035, + "Ġencompass": 15036, + "commutative": 15037, + "Ġadiabatic": 15038, + "butyl": 15039, + "PEG": 15040, + "Ġαβ": 15041, + "ĠStan": 15042, + "Ġclustered": 15043, + "Ġholding": 15044, + "ĠBeck": 15045, + "ĠYan": 15046, + "Ġaster": 15047, + "Ġeconom": 15048, + "Ġignored": 15049, + "uro": 15050, + "yles": 15051, + "ubbles": 15052, + "Ġfate": 15053, + "Ġperceptions": 15054, + "Ġlin": 15055, + "én": 15056, + "Ġactu": 15057, + "Ġarsen": 15058, + "Ġba": 15059, + "epoch": 15060, + "ĠStim": 15061, + "Ġmedications": 15062, + "ECs": 15063, + "ĠMinistry": 15064, + "ĠPublisher": 15065, + "Ġdepri": 15066, + "Ġobstruction": 15067, + "ĠmRNAs": 15068, + "Ġbrother": 15069, + "Ġcrossover": 15070, + "ĠTurb": 15071, + "tation": 15072, + "Ġtank": 15073, + "ĠMem": 15074, + "Ġintestine": 15075, + "Ġmicroglia": 15076, + "ĠMaxwell": 15077, + "Ġjurisdic": 15078, + "Ġphenyl": 15079, + "hyper": 15080, + "ums": 15081, + "ĠHIF": 15082, + "ĠShen": 15083, + "Ġcheckpoint": 15084, + "ĠBrownian": 15085, + "ĠâĭĨ": 15086, + "ĠStrain": 15087, + "ĠExtraction": 15088, + "Ġbatteries": 15089, + "ĠPle": 15090, + "ĠConditions": 15091, + "Ġinconsistent": 15092, + "ĠHost": 15093, + "ypical": 15094, + "Ġcrops": 15095, + "alg": 15096, + "ĠFI": 15097, + "anta": 15098, + "Ġfounded": 15099, + "Ġmarks": 15100, + "distribution": 15101, + "Ġι": 15102, + "Ġhors": 15103, + "Ġsnap": 15104, + "WM": 15105, + "Ġmanifestations": 15106, + "empl": 15107, + "Ġproving": 15108, + "leading": 15109, + "ĠACE": 15110, + "ĠLED": 15111, + "channels": 15112, + "Ġlift": 15113, + "Function": 15114, + "inase": 15115, + "supervised": 15116, + "ĠUser": 15117, + "Ġphysiology": 15118, + "Ġlinking": 15119, + "pressed": 15120, + "Ġiff": 15121, + "ĠJim": 15122, + "Ġglutathione": 15123, + "ĠTI": 15124, + "Ġane": 15125, + "enosis": 15126, + "Ġcollections": 15127, + "Ġgenetically": 15128, + "ĠFilter": 15129, + "ĠChicago": 15130, + "ĠServices": 15131, + "Ġsupersymmetric": 15132, + "Ġstriking": 15133, + "Ġirrig": 15134, + "ococcal": 15135, + "Ġfibres": 15136, + "Ġecosystems": 15137, + "uming": 15138, + "fly": 15139, + "Ġlungs": 15140, + "Ġcovariates": 15141, + "Ġlayout": 15142, + "ĠRaj": 15143, + "Ġsummation": 15144, + "abled": 15145, + "Ġfreely": 15146, + "Ġrevised": 15147, + "Ġcuts": 15148, + "ĠIntegrated": 15149, + "Ġpharmaceutical": 15150, + "Ġrespiration": 15151, + "ĠBill": 15152, + "Ġestrogen": 15153, + "raint": 15154, + "Ġpercentages": 15155, + "ĠPf": 15156, + "ĠGF": 15157, + "methylene": 15158, + "Ġorigins": 15159, + "trim": 15160, + "match": 15161, + "itney": 15162, + "ĠYe": 15163, + "Ġallocated": 15164, + "manifold": 15165, + "ĠTris": 15166, + "ĠLys": 15167, + "Ġcompressed": 15168, + "orer": 15169, + "Ġhimself": 15170, + "Ġquin": 15171, + "ĠAssembly": 15172, + "single": 15173, + "temporal": 15174, + "Ġsoph": 15175, + "Ġepidemiological": 15176, + "Ġknockout": 15177, + "Ġcompares": 15178, + "ĠSensitivity": 15179, + "Ġgirls": 15180, + "ĠValley": 15181, + "alid": 15182, + "ĠScheme": 15183, + "ĠCOMP": 15184, + "Ġrefractive": 15185, + "ĠOffice": 15186, + "Ġlatest": 15187, + "Ġprices": 15188, + "carboxyl": 15189, + "Ġeconomy": 15190, + "Ġbooks": 15191, + "ĠDD": 15192, + "Ġneoplas": 15193, + "appings": 15194, + "Ġfolding": 15195, + "momentum": 15196, + "potent": 15197, + "Ġprefix": 15198, + "ĠRiemannian": 15199, + "ĠERK": 15200, + "ĠPathway": 15201, + "Ġlarval": 15202, + "olor": 15203, + "Ġattitude": 15204, + "geqslant": 15205, + "Ġgates": 15206, + "Ġagonist": 15207, + "Ġï̍": 15208, + "ĠMCF": 15209, + "ostatic": 15210, + "micro": 15211, + "Ġdoubl": 15212, + "ĠParameter": 15213, + "Ġequivalently": 15214, + "Ġsrc": 15215, + "Most": 15216, + "ĉĠĠĠ": 15217, + "Ġrheumat": 15218, + "ĠHum": 15219, + "region": 15220, + "Ġwinds": 15221, + "Ġquadrup": 15222, + "cales": 15223, + "ulfide": 15224, + "balanced": 15225, + "Under": 15226, + "generated": 15227, + "oplasmic": 15228, + "Ġweighting": 15229, + "ĠNov": 15230, + "veloc": 15231, + "utils": 15232, + "ĠACT": 15233, + "Ġvulnerable": 15234, + "dc": 15235, + "Ġstromal": 15236, + "Ġexacerb": 15237, + "HV": 15238, + "Ġperfectly": 15239, + "txt": 15240, + "direction": 15241, + "ogon": 15242, + "Ġbim": 15243, + "ĠMarg": 15244, + "itons": 15245, + "Ġtermination": 15246, + "eda": 15247, + "Ġpretreatment": 15248, + "Ġimportantly": 15249, + "Ġduc": 15250, + "Ġartifacts": 15251, + "Stud": 15252, + "otensin": 15253, + "reland": 15254, + "ahn": 15255, + "Ġdeployed": 15256, + "ĠEF": 15257, + "ensing": 15258, + "ĠCard": 15259, + "ĠJordan": 15260, + "apunov": 15261, + "Ġanesthesia": 15262, + "Ġatherosclerosis": 15263, + "inner": 15264, + "structural": 15265, + "ĠAsp": 15266, + "throughput": 15267, + "urities": 15268, + "Ġinset": 15269, + "without": 15270, + "Ġacquire": 15271, + "Ġcombines": 15272, + "ĠShar": 15273, + "MASK": 15274, + "ĠLiter": 15275, + "Ġconscious": 15276, + "iscell": 15277, + "consistent": 15278, + "yst": 15279, + "Ġfilaments": 15280, + "ĠAlice": 15281, + "ĠGround": 15282, + "ĠmTOR": 15283, + "versal": 15284, + "Ġlineages": 15285, + "particles": 15286, + "aroscopic": 15287, + "ĠProced": 15288, + "Ġorientations": 15289, + "ĠMouse": 15290, + "Ġaccordingly": 15291, + "Ġsuppressor": 15292, + "Ġdestruction": 15293, + "OV": 15294, + "ĠProteins": 15295, + "PECT": 15296, + "Ġcup": 15297, + "Ġmonomer": 15298, + "plemental": 15299, + "Ġneutrophil": 15300, + "Ġerup": 15301, + "Ġtac": 15302, + "Ġasymptomatic": 15303, + "ĠEmbed": 15304, + "ĠRadiation": 15305, + "ĠGame": 15306, + "Ġneedle": 15307, + "Ġreuse": 15308, + "ĠDutch": 15309, + "Ġjuvenile": 15310, + "Ġmomenta": 15311, + "ĠBose": 15312, + "Ġdeveloper": 15313, + "Ġresiduals": 15314, + "Å¡": 15315, + "Ġcognition": 15316, + "ĠRegional": 15317, + "You": 15318, + "ĠConcent": 15319, + "ocin": 15320, + "ĠPartial": 15321, + "Ġcompletes": 15322, + "ĠSingh": 15323, + "ĠExc": 15324, + "ĠIsolation": 15325, + "ĠStructures": 15326, + "Ġintermitt": 15327, + "Exception": 15328, + "Ġanalytically": 15329, + "Ġelectricity": 15330, + "âĭ": 15331, + "Äį": 15332, + "Ġproteome": 15333, + "Ġic": 15334, + "kal": 15335, + "inux": 15336, + "ĠBeyond": 15337, + "Ġimplied": 15338, + "ASH": 15339, + "Ġclone": 15340, + "ĠRussia": 15341, + "ĠHod": 15342, + "tebrates": 15343, + "Ġproxy": 15344, + "holder": 15345, + "elve": 15346, + "Ġvalley": 15347, + "utely": 15348, + "Ġjobs": 15349, + "ruption": 15350, + "roids": 15351, + "ĠWhy": 15352, + "eping": 15353, + "ĠYet": 15354, + "Ġpyl": 15355, + "Ġbra": 15356, + "ilization": 15357, + "eters": 15358, + "Ġadver": 15359, + "Ġove": 15360, + "kernel": 15361, + "samples": 15362, + "ordinate": 15363, + "ĠAssuming": 15364, + "Ġcontaminated": 15365, + "Ġbipolar": 15366, + "Ġlac": 15367, + "Ġluc": 15368, + "Ġcentrifugation": 15369, + "Both": 15370, + "Ġnd": 15371, + "Ġtib": 15372, + "Before": 15373, + "ĠImmune": 15374, + "Ġash": 15375, + "Ġconditioned": 15376, + "ĠRank": 15377, + "NOS": 15378, + "Ġnanoparticle": 15379, + "Ġdependencies": 15380, + "Ġhouseholds": 15381, + "agers": 15382, + "Ġspectrophot": 15383, + "Ġbile": 15384, + "ĠHans": 15385, + "ĠAcknowledgements": 15386, + "ratio": 15387, + "ĠSecondary": 15388, + "Ġdownregulated": 15389, + "fixed": 15390, + "Obs": 15391, + "ĠHL": 15392, + "Ġsends": 15393, + "tings": 15394, + "Ġfi": 15395, + "ĠPaper": 15396, + "Ġultraviolet": 15397, + "ĠBall": 15398, + "Ġdrastic": 15399, + "ailure": 15400, + "oil": 15401, + "exchange": 15402, + "ĠDan": 15403, + "ĠAuto": 15404, + "Ġarchae": 15405, + "ĠCollection": 15406, + "Ġantiviral": 15407, + "ĠChemistry": 15408, + "Ġferr": 15409, + "choice": 15410, + "vac": 15411, + "olipid": 15412, + "Ġdanger": 15413, + "ĠLittle": 15414, + "Ġdehyd": 15415, + "Ġoccasion": 15416, + "opropyl": 15417, + "abe": 15418, + "Ġinterferon": 15419, + "Ġexport": 15420, + "onitrile": 15421, + "pd": 15422, + "ĠContext": 15423, + "ruz": 15424, + "ĠDys": 15425, + "Ġassembl": 15426, + "Ġoils": 15427, + "Image": 15428, + "rowing": 15429, + "Ġaneurys": 15430, + "Ġliquids": 15431, + "Ġactively": 15432, + "Ġevapor": 15433, + "ĠPresent": 15434, + "Ġconstitutive": 15435, + "ĠSite": 15436, + "Ġscript": 15437, + "Ġrepeats": 15438, + "ĠSIR": 15439, + "ĠFilm": 15440, + "ĠSanta": 15441, + "ĠRepresentation": 15442, + "ĠAma": 15443, + "ordon": 15444, + "ĠMolecule": 15445, + "Ġgoverning": 15446, + "ĠSoil": 15447, + "Ver": 15448, + "Ġphotonic": 15449, + "tify": 15450, + "ĠLewis": 15451, + "athered": 15452, + "Ġcategorical": 15453, + "iscellaneous": 15454, + "update": 15455, + "Ġdeficit": 15456, + "Ġadjuvant": 15457, + "ĠHenry": 15458, + "Group": 15459, + "istency": 15460, + "agraph": 15461, + "ĠImproving": 15462, + "El": 15463, + "Ġflame": 15464, + "rogate": 15465, + "omorph": 15466, + "Ġqubits": 15467, + "Ġillustration": 15468, + "ĠFlorida": 15469, + "ĠDG": 15470, + "bigcup": 15471, + "Ġprovince": 15472, + "egradation": 15473, + "ĠLandau": 15474, + "Ġgrating": 15475, + "Ġinsects": 15476, + "Ġdraft": 15477, + "ĠHb": 15478, + "Ġss": 15479, + "ĠRas": 15480, + "Ġmucosa": 15481, + "Ġhydroxyl": 15482, + "Ġmodest": 15483, + "Ġconfirming": 15484, + "ĠGalaxies": 15485, + "Gaussian": 15486, + "ĠRetrie": 15487, + "Ġrestored": 15488, + "memory": 15489, + "Ġreinforced": 15490, + "rific": 15491, + "Ġassisted": 15492, + "Ġaffiliations": 15493, + "RC": 15494, + "ducer": 15495, + "ĠIntellig": 15496, + "ĠASD": 15497, + "modium": 15498, + "Ġomitted": 15499, + "okers": 15500, + "Ġguided": 15501, + "Ġgraphical": 15502, + "ĠQual": 15503, + "Due": 15504, + "Ġnemat": 15505, + "variable": 15506, + "Ġsenescence": 15507, + "Ġpipe": 15508, + "Ġsustainable": 15509, + "Ġteacher": 15510, + "Ġthing": 15511, + "ĠGPU": 15512, + "TB": 15513, + "Ġreform": 15514, + "Ġreflex": 15515, + "Ġindicative": 15516, + "about": 15517, + "Ġopi": 15518, + "effect": 15519, + "Ġdispersed": 15520, + "kh": 15521, + "ithelial": 15522, + "ĠTreg": 15523, + "ipl": 15524, + "ĠAutomatic": 15525, + "Ġnitro": 15526, + "complete": 15527, + "Ġbosons": 15528, + "Ġpac": 15529, + "Ġavoiding": 15530, + "isl": 15531, + "plasty": 15532, + "responsive": 15533, + "dest": 15534, + "ĠBrad": 15535, + "ĠDecision": 15536, + "ĠDiscovery": 15537, + "Ġchicken": 15538, + "mus": 15539, + "ĠWITH": 15540, + "Ġtric": 15541, + "Ġquartz": 15542, + "onstruction": 15543, + "ĠFields": 15544, + "Ġassim": 15545, + "oprot": 15546, + "Ġguaranteed": 15547, + "fat": 15548, + "icts": 15549, + "Ġchol": 15550, + "ido": 15551, + "ĠKL": 15552, + "Ġchitosan": 15553, + "ĠNd": 15554, + "ĠOscill": 15555, + "Ġevolve": 15556, + "cu": 15557, + "Ġmast": 15558, + "Ġamph": 15559, + "torch": 15560, + "Vis": 15561, + "entity": 15562, + "ĠAdam": 15563, + "Ġdevoted": 15564, + "Ġethical": 15565, + "Ġpremature": 15566, + "Ġconsumer": 15567, + "Ġrecursive": 15568, + "Ġgluon": 15569, + "Ġmoderately": 15570, + "Ġmodalities": 15571, + "Ġcanal": 15572, + "force": 15573, + "ĠChlor": 15574, + "slash": 15575, + "sten": 15576, + "Ġcommercially": 15577, + "ongs": 15578, + "Ġstimulate": 15579, + "atinum": 15580, + "ĠRail": 15581, + "Ġconvective": 15582, + "Ġarteries": 15583, + "inv": 15584, + "ĠWol": 15585, + "ĠLung": 15586, + "letes": 15587, + "raphy": 15588, + "ĠHI": 15589, + "Ġgraphite": 15590, + "Ġhousing": 15591, + "each": 15592, + "Ġcalor": 15593, + "acetamide": 15594, + "rochemical": 15595, + "Ġhands": 15596, + "Ġelucidate": 15597, + "ĠChand": 15598, + "road": 15599, + "nova": 15600, + "ĠLineage": 15601, + "Ġram": 15602, + "Ġfight": 15603, + "Ġrecommendation": 15604, + "Ġamongst": 15605, + "Ġswitches": 15606, + "berry": 15607, + "Ġtherein": 15608, + "algebras": 15609, + "ĠTaken": 15610, + "azz": 15611, + "Ġfurn": 15612, + "Ġamel": 15613, + "Ġteachers": 15614, + "arn": 15615, + "Ġavoided": 15616, + "Ġaverages": 15617, + "amer": 15618, + "ĠCondition": 15619, + "Ġdislocation": 15620, + "ircon": 15621, + "Ġadolescent": 15622, + "Ġtur": 15623, + "env": 15624, + "Ġze": 15625, + "DL": 15626, + "loading": 15627, + "icidal": 15628, + "category": 15629, + "ĠDB": 15630, + "Ġmucosal": 15631, + "ĠRG": 15632, + "Ġtaxonomic": 15633, + "Ġmutagen": 15634, + "ĠStage": 15635, + "necess": 15636, + "ĠPerm": 15637, + "Ġocclusion": 15638, + "Ġexploited": 15639, + "Ġanaerobic": 15640, + "uled": 15641, + "Ġwanted": 15642, + "ĠCombining": 15643, + "Ġsubcutaneous": 15644, + "Recomm": 15645, + "Ġdiscusses": 15646, + "Ġcounterpart": 15647, + "ĠFB": 15648, + "Ġadsorbed": 15649, + "don": 15650, + "Many": 15651, + "ĠSweden": 15652, + "ĠAndrew": 15653, + "enhanced": 15654, + "Ġdoctor": 15655, + "ĠKorean": 15656, + "ĠSAR": 15657, + "Ġmating": 15658, + "aturation": 15659, + "ĠLatin": 15660, + "Ġsorting": 15661, + "Ġskip": 15662, + "Os": 15663, + "Ġwife": 15664, + "Ġcommittee": 15665, + "lvert": 15666, + "ĠACC": 15667, + "ĠComm": 15668, + "Ġsubtle": 15669, + "ĠSurvival": 15670, + "because": 15671, + "Ġfeat": 15672, + "ĠPortug": 15673, + "ARY": 15674, + "ĠISB": 15675, + "itron": 15676, + "Ġsectors": 15677, + "Ġadjoint": 15678, + "ĠAlexander": 15679, + "Ġimpurity": 15680, + "ĠMarine": 15681, + "lact": 15682, + "Ġtrapping": 15683, + "Ġgeneralize": 15684, + "filter": 15685, + "Ġpolarity": 15686, + "Also": 15687, + "Ġstabilized": 15688, + "ĠVirgin": 15689, + "Ġstores": 15690, + "PAGE": 15691, + "Ġdrawback": 15692, + "Ġâݪ": 15693, + "jet": 15694, + "Ġsubstituted": 15695, + "LINE": 15696, + "Ġoutperforms": 15697, + "Ġtermed": 15698, + "Ġweekly": 15699, + "Ġpolyc": 15700, + "Ġfused": 15701, + "Ġferromagnetic": 15702, + "lr": 15703, + "ellites": 15704, + "ĠTurn": 15705, + "ĠCulture": 15706, + "prise": 15707, + "ÅĤ": 15708, + "omposition": 15709, + "elfare": 15710, + "ĠGoogle": 15711, + "oarth": 15712, + "Ġë": 15713, + "Ġmist": 15714, + "ĠMathematics": 15715, + "SET": 15716, + "Ġepochs": 15717, + "Ġcontras": 15718, + "ishment": 15719, + "ĠFirstly": 15720, + "Ġdeclared": 15721, + "aur": 15722, + "ĠPed": 15723, + "Ġreplicate": 15724, + "Ġeligible": 15725, + "Ġconcaten": 15726, + "Ġcig": 15727, + "Ġtriplet": 15728, + "found": 15729, + "ĠCz": 15730, + "Ġaccomplished": 15731, + "Ġgoverned": 15732, + "onuclear": 15733, + "ĠNY": 15734, + "ĠEthiop": 15735, + "Ġinject": 15736, + "Ġeosin": 15737, + "annon": 15738, + "olo": 15739, + "ĠMHC": 15740, + "Ġpreoperative": 15741, + "Ġdates": 15742, + "Ġsigma": 15743, + "Long": 15744, + "ĠReson": 15745, + "Ġsymptomatic": 15746, + "Ġvolunteers": 15747, + "Ġcooperation": 15748, + "Ġarr": 15749, + "Ġcloned": 15750, + "Ġdent": 15751, + "ĠSob": 15752, + "Ġcathode": 15753, + "ctx": 15754, + "Ġencephal": 15755, + "Ġpiv": 15756, + "vive": 15757, + "umetric": 15758, + "ĠFF": 15759, + "Ġunderestim": 15760, + "Ġcoded": 15761, + "Ġanalges": 15762, + "spectral": 15763, + "Ġattracted": 15764, + "Ġtwenty": 15765, + "Ġinactive": 15766, + "Ġvictim": 15767, + "Ġholder": 15768, + "ogenes": 15769, + "Ġsuffering": 15770, + "rex": 15771, + "Ġprophyl": 15772, + "ĠUniversal": 15773, + "Ġdenom": 15774, + "stolic": 15775, + "ansion": 15776, + "SIZE": 15777, + "ĠHCV": 15778, + "Ġtechnological": 15779, + "CNN": 15780, + "enching": 15781, + "Ġdebris": 15782, + "ĠBoundary": 15783, + "linking": 15784, + "Ġstopped": 15785, + "ĠDie": 15786, + "ĠCosm": 15787, + "Ġturning": 15788, + "Ġglycoprotein": 15789, + "ĠKumar": 15790, + "Ġpg": 15791, + "ĠBY": 15792, + "Ġrising": 15793, + "ĠROC": 15794, + "Despite": 15795, + "ĠBoolean": 15796, + "ilder": 15797, + "Ġexponents": 15798, + "inters": 15799, + "printf": 15800, + "Ġlit": 15801, + "track": 15802, + "Ġfidelity": 15803, + "Ġsmoke": 15804, + "otemporal": 15805, + "Ġadmissible": 15806, + "ĠBoltzmann": 15807, + "TF": 15808, + "olite": 15809, + "liament": 15810, + "Ġcalculus": 15811, + "itized": 15812, + "Ġdivergent": 15813, + "Ġcolonization": 15814, + "Ġconvergent": 15815, + "ĠHas": 15816, + "Ġconsumers": 15817, + "Ġmyc": 15818, + "Ġcontig": 15819, + "Ġepidemiology": 15820, + "és": 15821, + "ĠAssoci": 15822, + "given": 15823, + "Ġwhilst": 15824, + "ĠKur": 15825, + "Ġreasonably": 15826, + "Ġaerobic": 15827, + "separ": 15828, + "Ġchecks": 15829, + "ĠSemantic": 15830, + "Ġserving": 15831, + "ĠAtmosp": 15832, + "Ġoxidized": 15833, + "coupled": 15834, + "ĠbioRxiv": 15835, + "Ġtuned": 15836, + "uspended": 15837, + "Ġindirectly": 15838, + "ĠCAD": 15839, + "ĠCurrently": 15840, + "Ġbehaviours": 15841, + "ĠPPAR": 15842, + "rors": 15843, + "ereb": 15844, + "Ġwidths": 15845, + "diagonal": 15846, + "ervice": 15847, + "Ġole": 15848, + "means": 15849, + "IME": 15850, + "ĠTracking": 15851, + "Ġacknowledge": 15852, + "ĠHon": 15853, + "ĠTechniques": 15854, + "ĠOxid": 15855, + "blind": 15856, + "Ġdiast": 15857, + "named": 15858, + "asitic": 15859, + "Ġpreparations": 15860, + "ĠArth": 15861, + "Ġpreserves": 15862, + "Ġfasc": 15863, + "Ġwaveform": 15864, + "ĠCrystal": 15865, + "Ġuncom": 15866, + "Ġelast": 15867, + "Ġfunctionally": 15868, + "Hom": 15869, + "ĠCoast": 15870, + "Ġoptic": 15871, + "ĠAlternatively": 15872, + "onyl": 15873, + "ĠLig": 15874, + "aldehyde": 15875, + "Ġsimulator": 15876, + "Ġdramatic": 15877, + "ifera": 15878, + "Ġexhibiting": 15879, + "Ġbehavioural": 15880, + "thick": 15881, + "xture": 15882, + "Ġexecutive": 15883, + "Ġcondensate": 15884, + "ĠOutcomes": 15885, + "Text": 15886, + "ointed": 15887, + "ĠCopyright": 15888, + "Ġdc": 15889, + "odd": 15890, + "ĠDiversity": 15891, + "chip": 15892, + "ĠBuilding": 15893, + "Ġpulsed": 15894, + "harmonic": 15895, + "Ġclinicians": 15896, + "dp": 15897, + "ĠqPCR": 15898, + "marks": 15899, + "Ġappreci": 15900, + "ĠLaser": 15901, + "Ġsizeof": 15902, + "yrene": 15903, + "Ġcooperative": 15904, + "generative": 15905, + "ĠLib": 15906, + "Ġdispersal": 15907, + "Ġevolving": 15908, + "ĠStatus": 15909, + "Ġsupercon": 15910, + "ĠMamm": 15911, + "Ġinterstitial": 15912, + "isenberg": 15913, + "Ġâľ": 15914, + "Ġconfocal": 15915, + "Ġmodulates": 15916, + "hour": 15917, + "Ġperoxide": 15918, + "dependence": 15919, + "Ġperturbed": 15920, + "illation": 15921, + "Ġplaque": 15922, + "ĠNeumann": 15923, + "Ġtriggers": 15924, + "omain": 15925, + "ĠAdministration": 15926, + "olia": 15927, + "ĠMIC": 15928, + "osaic": 15929, + "ĠGB": 15930, + "textnormal": 15931, + "Ġdominance": 15932, + "ĠExper": 15933, + "CAM": 15934, + "ĠAbout": 15935, + "ĠGarc": 15936, + "Ġsummarizes": 15937, + "App": 15938, + "charomyces": 15939, + "tificial": 15940, + "Ġglycerol": 15941, + "ĠAssumption": 15942, + "Ġtect": 15943, + "ĠFW": 15944, + "Ġcotton": 15945, + "general": 15946, + "ĠFern": 15947, + "Pt": 15948, + "Ġworker": 15949, + "Ġanion": 15950, + "grams": 15951, + "req": 15952, + "Ġlooks": 15953, + "Ġimplementations": 15954, + "ĠColumb": 15955, + "agi": 15956, + "ĠAttention": 15957, + "ĠTeam": 15958, + "oning": 15959, + "onential": 15960, + "tiny": 15961, + "ĠHighly": 15962, + "textup": 15963, + "Ġinvertible": 15964, + "ocortic": 15965, + "Inf": 15966, + "ĠOfficial": 15967, + "ĠModelling": 15968, + "Ġinclusions": 15969, + "Ġblank": 15970, + "Ġsight": 15971, + "ĠGamma": 15972, + "Ġlepton": 15973, + "Ġpneumoniae": 15974, + "Ġrotor": 15975, + "Ġethnic": 15976, + "Ġretain": 15977, + "varying": 15978, + "ĠEB": 15979, + "Ġastrocytes": 15980, + "ĠNorm": 15981, + "Ġnanom": 15982, + "classical": 15983, + "Ġshadow": 15984, + "ĠReferences": 15985, + "ĠFS": 15986, + "Ġnonnegative": 15987, + "bond": 15988, + "ĠCoh": 15989, + "Ġnumpy": 15990, + "Ġoct": 15991, + "span": 15992, + "racts": 15993, + "Ġnotably": 15994, + "Ġsophistic": 15995, + "PAR": 15996, + "Ġhormones": 15997, + "Ġtensors": 15998, + "ĠÌĦ": 15999, + "ĠConstraints": 16000, + "ĠâIJ": 16001, + "Ġtransit": 16002, + "Ġruntime": 16003, + "author": 16004, + "Ġprompt": 16005, + "ĠSG": 16006, + "Ġgrate": 16007, + "cemia": 16008, + "ĠLyapunov": 16009, + "convex": 16010, + "Ġforecasting": 16011, + "push": 16012, + "Ġjurisdictional": 16013, + "ÃĢ": 16014, + "Ġbiomedical": 16015, + "Ġepilepsy": 16016, + "feature": 16017, + "wiki": 16018, + "View": 16019, + "Ġlesser": 16020, + "Ġconjugated": 16021, + "Ġwaiting": 16022, + "ĠWord": 16023, + "IZ": 16024, + "Ġhydroxy": 16025, + "Ġdisp": 16026, + "Ġseeded": 16027, + "fitting": 16028, + "Ġstratification": 16029, + "Ġendpoint": 16030, + "Ġmediators": 16031, + "ductive": 16032, + "Ġinjections": 16033, + "ĠMicrobi": 16034, + "Ġinsert": 16035, + "ĠEmb": 16036, + "Ġstopping": 16037, + "welling": 16038, + "Ġirradiated": 16039, + "Ġmetallicity": 16040, + "vinyl": 16041, + "Ġplasmids": 16042, + "Rep": 16043, + "ĠDifferenti": 16044, + "ĠSmart": 16045, + "ĠIdentifier": 16046, + "ĠBF": 16047, + "ropic": 16048, + "Ġkinematics": 16049, + "Ġinoculated": 16050, + "CK": 16051, + "auses": 16052, + "ĠReturns": 16053, + "reement": 16054, + "Ġanticancer": 16055, + "Ġspecifications": 16056, + "Ġadds": 16057, + "Ġstake": 16058, + "Ġwheel": 16059, + "üller": 16060, + "ĠSon": 16061, + "Ġrupture": 16062, + "Ġsold": 16063, + "than": 16064, + "Ġintermedi": 16065, + "ĠNik": 16066, + "Ġtuple": 16067, + "establ": 16068, + "Ġnorthe": 16069, + "Ġsuppresses": 16070, + "Ġfet": 16071, + "Ġwashing": 16072, + "Ġinterplay": 16073, + "Ġregularly": 16074, + "EXT": 16075, + "Ġemployees": 16076, + "yz": 16077, + "rupted": 16078, + "etts": 16079, + "ĠUAV": 16080, + "Ġdifferentiable": 16081, + "inge": 16082, + "MDA": 16083, + "Ġho": 16084, + "Ġtags": 16085, + "Ġcompatibility": 16086, + "ĠÃĥ": 16087, + "bus": 16088, + "ĠUC": 16089, + "Ġtokens": 16090, + "Ġclients": 16091, + "Ġprescription": 16092, + "ĠÌĪ": 16093, + "ĠReaction": 16094, + "velocity": 16095, + "ĠNLR": 16096, + "ĠGast": 16097, + "ĠPlasmodium": 16098, + "ĠCut": 16099, + "Ġnas": 16100, + "grained": 16101, + "Ġchromosomal": 16102, + "Ġpossesses": 16103, + "Ġmath": 16104, + "Ġelected": 16105, + "placement": 16106, + "Ġcollecting": 16107, + "Ġgels": 16108, + "aire": 16109, + "Ġdeformations": 16110, + "raise": 16111, + "Ġflank": 16112, + "sulfanyl": 16113, + "zens": 16114, + "priate": 16115, + "Ġchlorophyll": 16116, + "abi": 16117, + "available": 16118, + "ا": 16119, + "Ġtack": 16120, + "fields": 16121, + "Ġrichness": 16122, + "Ġimplants": 16123, + "obenz": 16124, + "idential": 16125, + "Ġbillion": 16126, + "utor": 16127, + "ĠISBN": 16128, + "Ġinsurance": 16129, + "NET": 16130, + "Ġinadequ": 16131, + "Ġmerged": 16132, + "ĠRange": 16133, + "Ġavoidance": 16134, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 16135, + "rics": 16136, + "Ġexclusive": 16137, + "LV": 16138, + "Ġ": 16139, + "Ġcategorized": 16140, + "Ġultrasonic": 16141, + "ipe": 16142, + "icans": 16143, + "ĠAPP": 16144, + "Ġtraumatic": 16145, + "Ba": 16146, + "ĠAssay": 16147, + "ĠGrid": 16148, + "ĠClassical": 16149, + "ĠDES": 16150, + "Ġsoybean": 16151, + "Ġtopography": 16152, + "ĠControll": 16153, + "Ġemotions": 16154, + "Ġcarbohydrate": 16155, + "Ġconsol": 16156, + "oxyl": 16157, + "Ġbifurcation": 16158, + "Ġcoil": 16159, + "find": 16160, + "Ġwitness": 16161, + "ĠLF": 16162, + "threshold": 16163, + "Ġaddressing": 16164, + "Ġscrew": 16165, + "Ġactor": 16166, + "ĠWell": 16167, + "Ġ": 16168, + "ïĺ": 16169, + "ĠDF": 16170, + "ĠCorporation": 16171, + "ĠMitochondrial": 16172, + "Ġkpc": 16173, + "unders": 16174, + "Ġfibrin": 16175, + "axel": 16176, + "Ġpolyt": 16177, + "Ġshaped": 16178, + "rez": 16179, + "steresis": 16180, + "ĠComprehens": 16181, + "Ġ": 16182, + "dh": 16183, + "Ġsemic": 16184, + "Ġmot": 16185, + "ĠDavis": 16186, + "ska": 16187, + "ĠLH": 16188, + "Ġexpansions": 16189, + "acks": 16190, + "Ġoptimizing": 16191, + "eak": 16192, + "ĠQi": 16193, + "mul": 16194, + "ograft": 16195, + "Ġsuicide": 16196, + "calar": 16197, + "ĠScott": 16198, + "Ġthinking": 16199, + "Ġdirectional": 16200, + "Ġsurfactant": 16201, + "Ġdegraded": 16202, + "Ġregimen": 16203, + "itative": 16204, + "ĠVersion": 16205, + "ĠMaster": 16206, + "ĠSimulations": 16207, + "NCBI": 16208, + "lip": 16209, + "Ġreagents": 16210, + "Ġposted": 16211, + "osus": 16212, + "Ġlayered": 16213, + "ĠSpectrum": 16214, + "ĠGraphs": 16215, + "burst": 16216, + "Ġlived": 16217, + "Ġelemental": 16218, + "Ġ": 16219, + "ĠDiscrete": 16220, + "Ġexcluding": 16221, + "Ġoriginating": 16222, + "ĠGames": 16223, + "continuous": 16224, + "ATED": 16225, + "Ġpyram": 16226, + "luent": 16227, + "Ġtwisted": 16228, + "ĠNb": 16229, + "oxicity": 16230, + "Ġscr": 16231, + "Ġfun": 16232, + "ĠSegmentation": 16233, + "Ġphenol": 16234, + "Ġmeters": 16235, + "ĠEigen": 16236, + "ĠWeak": 16237, + "Ġschematic": 16238, + "rone": 16239, + "Ġphilos": 16240, + "titis": 16241, + "ĠIreland": 16242, + "Ġgy": 16243, + "ĠPTM": 16244, + "Ġpacking": 16245, + "ilinear": 16246, + "zeros": 16247, + "Ġubiquitin": 16248, + "ĠPressure": 16249, + "Ġinfiltr": 16250, + "ENS": 16251, + "validation": 16252, + "Ġprone": 16253, + "Ġoutline": 16254, + "hs": 16255, + "rength": 16256, + "Ġattain": 16257, + "Ġtwe": 16258, + "Ġtandem": 16259, + "Can": 16260, + "Ġlatitude": 16261, + "uitary": 16262, + "Ġvoltages": 16263, + "ĠGao": 16264, + "Ġpharmacokine": 16265, + "Ġcontextual": 16266, + "Ġxyl": 16267, + "elson": 16268, + "ĠMetabolic": 16269, + "oden": 16270, + "tiles": 16271, + "fficking": 16272, + "Ġdistilled": 16273, + "Ġalph": 16274, + "Ġpiezo": 16275, + "growth": 16276, + "Ġbore": 16277, + "Ġredundant": 16278, + "Ġdemonstration": 16279, + "Ġik": 16280, + "Ġrounds": 16281, + "ĠSri": 16282, + "figuration": 16283, + "ĠRayleigh": 16284, + "Line": 16285, + "ovol": 16286, + "Ġobstacle": 16287, + "cn": 16288, + "Ġbioactive": 16289, + "ĠOA": 16290, + "physical": 16291, + "atidyl": 16292, + "ACC": 16293, + "how": 16294, + "Ġresultant": 16295, + "ĠHubble": 16296, + "ĠVor": 16297, + "Ġensuring": 16298, + "Ġannotations": 16299, + "acyl": 16300, + "stituted": 16301, + "ĠAmb": 16302, + "feeding": 16303, + "Ġpresumably": 16304, + "Ġblockade": 16305, + "Ġsoc": 16306, + "ĠUrb": 16307, + "Ġmultiplied": 16308, + "Ġdiffe": 16309, + "Ġreflectance": 16310, + "ĠKeywords": 16311, + "ĠBayes": 16312, + "odeficiency": 16313, + "ĠBinding": 16314, + "inely": 16315, + "except": 16316, + "ĠUltr": 16317, + "ĠBrazilian": 16318, + "Number": 16319, + "Ġmassless": 16320, + "ĠConsistent": 16321, + "Ġcrisis": 16322, + "ogs": 16323, + "Ġresidence": 16324, + "Ġimper": 16325, + "fts": 16326, + "Ġcaptures": 16327, + "ĠSyndrome": 16328, + "Ġdimensionality": 16329, + "jun": 16330, + "Ġexhaus": 16331, + "ĠModern": 16332, + "Ġpercenti": 16333, + "Level": 16334, + "ĠResponses": 16335, + "Ġlaunched": 16336, + "Ġrepos": 16337, + "ĠKam": 16338, + "atility": 16339, + "Ġcarotid": 16340, + "rotic": 16341, + "ĠMand": 16342, + "UB": 16343, + "ĠMixed": 16344, + "Ġindexes": 16345, + "Ġcisplatin": 16346, + "ican": 16347, + "ionine": 16348, + "Ġhab": 16349, + "ĠIce": 16350, + "ĠGT": 16351, + "ĠAgg": 16352, + "ĠLDL": 16353, + "Ġvolcanic": 16354, + "dB": 16355, + "ĠElectric": 16356, + "Ġtmp": 16357, + "Ġgrids": 16358, + "liquid": 16359, + "prom": 16360, + "ĠGAL": 16361, + "Ġpestic": 16362, + "Ġhelium": 16363, + "Ġ": 16364, + "ĠDong": 16365, + "Ġmagnification": 16366, + "kip": 16367, + "ĠGrad": 16368, + "ĠWei": 16369, + "ĠPDF": 16370, + "ĠGluc": 16371, + "Pol": 16372, + "Ġtumorigen": 16373, + "yrin": 16374, + "Ġshelf": 16375, + "adher": 16376, + "entials": 16377, + "sn": 16378, + "Ġcultivars": 16379, + "Ġorbitals": 16380, + "ĠPEG": 16381, + "ĠAnne": 16382, + "eno": 16383, + "Ġattended": 16384, + "ophore": 16385, + "ishop": 16386, + "Ġfriends": 16387, + "posable": 16388, + "Ġimpose": 16389, + "Ġendemic": 16390, + "Ġsick": 16391, + "shifts": 16392, + "ĠOutput": 16393, + "LM": 16394, + "ĠMiscellaneous": 16395, + "Ġthousands": 16396, + "ĠDataset": 16397, + "Ġperturbative": 16398, + "oprec": 16399, + "Ġbene": 16400, + "Ġreef": 16401, + "Ġfossil": 16402, + "Ġcited": 16403, + "plicates": 16404, + "Ġrelates": 16405, + "ĠVII": 16406, + "Ġantifer": 16407, + "Ġglasses": 16408, + "closure": 16409, + "Ġrubber": 16410, + "Ġbird": 16411, + "Ġsupersymmetry": 16412, + "Ġmeson": 16413, + "hell": 16414, + "Ġparties": 16415, + "kar": 16416, + "ĠHur": 16417, + "ĠEA": 16418, + "ĠStars": 16419, + "othing": 16420, + "hot": 16421, + "illar": 16422, + "ASP": 16423, + "hev": 16424, + "ïĥ": 16425, + "aques": 16426, + "Ġcoordinated": 16427, + "ĠIslands": 16428, + "enable": 16429, + "SiO": 16430, + "Ġexceptional": 16431, + "Comb": 16432, + "ĠLike": 16433, + "Ġbroadly": 16434, + "ĠBac": 16435, + "Ġnil": 16436, + "ipartite": 16437, + "rations": 16438, + "Ġrewrite": 16439, + "Ġsalts": 16440, + "dimension": 16441, + "ĠVehic": 16442, + "Ġhundreds": 16443, + "ĠUr": 16444, + "Ġendpoints": 16445, + "ĠMODEL": 16446, + "ĠHBV": 16447, + "ĠVirtual": 16448, + "ĠConfl": 16449, + "ĠPractice": 16450, + "ĠAFM": 16451, + "Ġadversarial": 16452, + "Ġdiameters": 16453, + "Ġtransported": 16454, + "REM": 16455, + "ĠBart": 16456, + "Ġedition": 16457, + "Ġturbine": 16458, + "Ġminus": 16459, + "otechnology": 16460, + "Ig": 16461, + "Ġbigger": 16462, + "abul": 16463, + "Ġperoxidase": 16464, + "white": 16465, + "ĠSed": 16466, + "dihydro": 16467, + "Ġsegregation": 16468, + "Ġreductase": 16469, + "Ġhoriz": 16470, + "Ġinfinitely": 16471, + "availability": 16472, + "Ġactivator": 16473, + "Ġcensus": 16474, + "pressing": 16475, + "Ġspirit": 16476, + "conver": 16477, + "ĠQuantification": 16478, + "omerase": 16479, + "Ġrelapse": 16480, + "ĠFinal": 16481, + "Ġoverweight": 16482, + "aper": 16483, + "Ġformulae": 16484, + "rr": 16485, + "Ġfemoral": 16486, + "Ġfoam": 16487, + "otics": 16488, + "Ġprovider": 16489, + "Ġinstrumental": 16490, + "Ġadvice": 16491, + "Ġoccupation": 16492, + "assembly": 16493, + "bias": 16494, + "ĠNOT": 16495, + "restric": 16496, + "ĠProtocol": 16497, + "ĠCandida": 16498, + "ĠRhod": 16499, + "arden": 16500, + "funder": 16501, + "osens": 16502, + "Ġparams": 16503, + "front": 16504, + "Ġexerc": 16505, + "Ġgalactic": 16506, + "rvert": 16507, + "Ġimbalance": 16508, + "Ġkilling": 16509, + "ĠGenomic": 16510, + "Ġip": 16511, + "Ġcave": 16512, + "Ġfalc": 16513, + "ĠRM": 16514, + "Ġcarries": 16515, + "global": 16516, + "Ġcube": 16517, + "Ġrigorous": 16518, + "Ġcomputes": 16519, + "QP": 16520, + "Ġexposures": 16521, + "cover": 16522, + "ologically": 16523, + "Oper": 16524, + "Ġpec": 16525, + "Ġinhomogeneous": 16526, + "Ġservers": 16527, + "aliana": 16528, + "nb": 16529, + "Ġexplaining": 16530, + "Ġshrink": 16531, + "Ġcomorbid": 16532, + "ethoxy": 16533, + "outheast": 16534, + "Ġcourses": 16535, + "ĠNM": 16536, + "ĠShape": 16537, + "Ġflies": 16538, + "ĠMir": 16539, + "Ġpublicly": 16540, + "Ġphotometric": 16541, + "versible": 16542, + "olev": 16543, + "Ġvulnerability": 16544, + "Ġcations": 16545, + "Ġseeking": 16546, + "UTR": 16547, + "Ġdecomposed": 16548, + "Ġhus": 16549, + "Ġdisappear": 16550, + "Ġencounter": 16551, + "Ġtransforming": 16552, + "Ġpolymeric": 16553, + "Ġdiscretization": 16554, + "otoxic": 16555, + "ĠIter": 16556, + "ĠMari": 16557, + "Ġunfold": 16558, + "ĠAdult": 16559, + "obacillus": 16560, + "metal": 16561, + "berger": 16562, + "raphene": 16563, + "respective": 16564, + "Ġsurvive": 16565, + "ovich": 16566, + "Ġprotects": 16567, + "ĠRog": 16568, + "Ġimmunotherapy": 16569, + "ĠDSM": 16570, + "Ġanalogy": 16571, + "ĠPER": 16572, + "ĠPython": 16573, + "hum": 16574, + "ĠAdj": 16575, + "ĠLikewise": 16576, + "Ġ": 16577, + "Ġstomach": 16578, + "Ġinit": 16579, + "Ġwires": 16580, + "Ġingredients": 16581, + "Ġperceptual": 16582, + "Hand": 16583, + "Back": 16584, + "Ġmood": 16585, + "Ġdeformed": 16586, + "ĠRead": 16587, + "Ġrhiz": 16588, + "ĠOrganism": 16589, + "ĠIndones": 16590, + "annot": 16591, + "ictory": 16592, + "Ġtended": 16593, + "ĠSound": 16594, + "iax": 16595, + "Sr": 16596, + "ĠTab": 16597, + "ĠLaplacian": 16598, + "oluminescence": 16599, + "backslash": 16600, + "iologic": 16601, + "Ġtypename": 16602, + "ĠYear": 16603, + "Dependent": 16604, + "Ġslides": 16605, + "Ġsacrific": 16606, + "Ġconcomitant": 16607, + "opsies": 16608, + "Bigg": 16609, + "peak": 16610, + "ĠApplying": 16611, + "Ġcodon": 16612, + "ĠSimultaneous": 16613, + "tise": 16614, + "Ġtertiary": 16615, + "ĠPoll": 16616, + "Ġrevision": 16617, + "RAF": 16618, + "xmm": 16619, + "Ġsuited": 16620, + "ĠRecommend": 16621, + "ĠRy": 16622, + "Ġsake": 16623, + "Ġstretch": 16624, + "ĠSampling": 16625, + "Ġtubular": 16626, + "Ġpark": 16627, + "Ġultimate": 16628, + "Ġlands": 16629, + "ĠCriter": 16630, + "assay": 16631, + "mor": 16632, + "Ġdocking": 16633, + "Ġgradual": 16634, + "Ġeditor": 16635, + "Ġpolice": 16636, + "affin": 16637, + "ĠDeath": 16638, + "Ġpromoters": 16639, + "assic": 16640, + "Ġwriter": 16641, + "ĠVolume": 16642, + "iso": 16643, + "Ġdisag": 16644, + "token": 16645, + "Ġsteroid": 16646, + "Non": 16647, + "ĠMethyl": 16648, + "Americ": 16649, + "due": 16650, + "ĠLess": 16651, + "Ġdyst": 16652, + "ĠStatement": 16653, + "ĠTwenty": 16654, + "Ġaccessed": 16655, + "Ġblotting": 16656, + "ĠCOPD": 16657, + "Ġsteam": 16658, + "Ġdescriptive": 16659, + "ĠVery": 16660, + "Ġcapacities": 16661, + "ĠPersonal": 16662, + "acid": 16663, + "ähler": 16664, + "estival": 16665, + "Context": 16666, + "Ġastr": 16667, + "Analysis": 16668, + "Ġsept": 16669, + "Ġprinted": 16670, + "dual": 16671, + "aman": 16672, + "erer": 16673, + "Ġweakness": 16674, + "ìĿ": 16675, + "ĠTranslation": 16676, + "Ġpropagating": 16677, + "ĠSections": 16678, + "aca": 16679, + "Ġconfusion": 16680, + "IK": 16681, + "Ġframeworks": 16682, + "Ġsituated": 16683, + "Ġstays": 16684, + "nodes": 16685, + "chen": 16686, + "artments": 16687, + "Ġfreezing": 16688, + "ws": 16689, + "nett": 16690, + "Ġcontrollers": 16691, + "Ġsilic": 16692, + "LAST": 16693, + "foot": 16694, + "ĠDISCU": 16695, + "RH": 16696, + "ridine": 16697, + "ĠRev": 16698, + "perg": 16699, + "pyrim": 16700, + "flags": 16701, + "ĠGuide": 16702, + "Ġspeaker": 16703, + "tisol": 16704, + "rell": 16705, + "ĠDEG": 16706, + "Ġfu": 16707, + "ĠGut": 16708, + "Ġshar": 16709, + "Ġgross": 16710, + "Ġcrosses": 16711, + "wavelength": 16712, + "ĠApplied": 16713, + "ïve": 16714, + "ĠHB": 16715, + "ĠEdge": 16716, + "Ġinertial": 16717, + "Ġvocal": 16718, + "production": 16719, + "pathetic": 16720, + "Ġplanetary": 16721, + "Ġsister": 16722, + "Ġminima": 16723, + "Ġlongest": 16724, + "Ġflash": 16725, + "Ġperiodon": 16726, + "Ġepidermal": 16727, + "Ġfloating": 16728, + "GET": 16729, + "ĠTake": 16730, + "pdf": 16731, + "ĠLiquid": 16732, + "Ġremarkably": 16733, + "Sign": 16734, + "Ġshells": 16735, + "oglobulin": 16736, + "quilibrium": 16737, + "ĠMoore": 16738, + "ĠAdvers": 16739, + "ĠMycobacterium": 16740, + "Invitrogen": 16741, + "Ġthaliana": 16742, + "BY": 16743, + "ĠBit": 16744, + "Ġts": 16745, + "Ġsynchronous": 16746, + "yx": 16747, + "Ġpropagator": 16748, + "ĠIncreasing": 16749, + "iparum": 16750, + "Ġfreeze": 16751, + "ĠSelective": 16752, + "afe": 16753, + "Ġstrept": 16754, + "phantom": 16755, + "ĠGenerally": 16756, + "Ġalternate": 16757, + "ĠConvergence": 16758, + "////////////////": 16759, + "enging": 16760, + "ĠRandomized": 16761, + "develop": 16762, + "predict": 16763, + "ressor": 16764, + "Ġmathematics": 16765, + "fr": 16766, + "ĠComputation": 16767, + "ĠMalays": 16768, + "Ġbreathing": 16769, + "Through": 16770, + "ĠSIM": 16771, + "Ġanode": 16772, + "oad": 16773, + "ĠATCC": 16774, + "Ġconstituent": 16775, + "ĠMeasuring": 16776, + "ĠfMRI": 16777, + "Ġanemia": 16778, + "liest": 16779, + "Ġhemisphere": 16780, + "Ġmaxima": 16781, + "Ġtemporary": 16782, + "Ġdz": 16783, + "otoxin": 16784, + "Count": 16785, + "oned": 16786, + "ú": 16787, + "Ġcollaborative": 16788, + "Ġkb": 16789, + "Ġversa": 16790, + "ĠSwedish": 16791, + "ika": 16792, + "Ġdialysis": 16793, + "Ġperovsk": 16794, + "Ġwilling": 16795, + "ĠGreek": 16796, + "Output": 16797, + "Ġsemigroup": 16798, + "Ġbottlen": 16799, + "ĠGibbs": 16800, + "dark": 16801, + "Ġrheumatoid": 16802, + "urring": 16803, + "matched": 16804, + "Ġsophisticated": 16805, + "Ġcustomer": 16806, + "tetrahydro": 16807, + "XY": 16808, + "bug": 16809, + "Ġmorning": 16810, + "ĠCVD": 16811, + "Ġmappings": 16812, + "ĠMSCs": 16813, + "ĠDH": 16814, + "Ġquatern": 16815, + "health": 16816, + "ı": 16817, + "Ġtemp": 16818, + "ĠJew": 16819, + "ĠIl": 16820, + "Ġvortices": 16821, + "Ġserine": 16822, + "ĠOxygen": 16823, + "weg": 16824, + "Ġexplanations": 16825, + "PG": 16826, + "Ġciti": 16827, + "Ġlocality": 16828, + "===": 16829, + "ĠThom": 16830, + "Ġdairy": 16831, + "Block": 16832, + "ordial": 16833, + "akov": 16834, + "Ġglioma": 16835, + "Ġtransaction": 16836, + "Ġincremental": 16837, + "anche": 16838, + "Ret": 16839, + "magnetic": 16840, + "pyrrol": 16841, + "ĠPic": 16842, + "Ġamelior": 16843, + "oxidant": 16844, + "roviral": 16845, + "oratory": 16846, + "Ġsav": 16847, + "ĠStream": 16848, + "Ġsuperf": 16849, + "ĠICU": 16850, + "Ġevidenced": 16851, + "Ġrepeatedly": 16852, + "Ġrated": 16853, + "ĠPit": 16854, + "FAULT": 16855, + "Ġhat": 16856, + "ĠContent": 16857, + "Ġisoform": 16858, + "VER": 16859, + "Ġnodal": 16860, + "Ġscheduled": 16861, + "Ġshoulder": 16862, + "Ġtap": 16863, + "Ġportal": 16864, + "Ġtraps": 16865, + "aev": 16866, + "ĠSOD": 16867, + "ematic": 16868, + "Ġenj": 16869, + "Ġreticulum": 16870, + "ĠMinister": 16871, + "ĠSel": 16872, + "Ġfalling": 16873, + "rost": 16874, + "NG": 16875, + "fd": 16876, + "nitro": 16877, + "ĠMove": 16878, + "relativistic": 16879, + "enges": 16880, + "ĠSST": 16881, + "ĠInv": 16882, + "Ġfinish": 16883, + "ĠPoland": 16884, + "osecond": 16885, + "ĠBAL": 16886, + "oarthritis": 16887, + "Ġoptics": 16888, + "ĠSky": 16889, + "Ġadvoc": 16890, + "Ġhemorrhage": 16891, + "Ġmodulating": 16892, + "nis": 16893, + "Ġmachinery": 16894, + "Ġupdating": 16895, + "Ġcharacterizing": 16896, + "ishman": 16897, + "Ġtemplates": 16898, + "ĠLaplace": 16899, + "ĠEns": 16900, + "Recently": 16901, + "orus": 16902, + "arts": 16903, + "diffusion": 16904, + "ĠLevels": 16905, + "aga": 16906, + "ĠInj": 16907, + "ĠLayer": 16908, + "Ġremn": 16909, + "Ġelasticity": 16910, + "Ġmerely": 16911, + "Ġfission": 16912, + "engue": 16913, + "make": 16914, + "Ġmonop": 16915, + "Ġurea": 16916, + "ĠSimon": 16917, + "miR": 16918, + "ĠSecondly": 16919, + "uric": 16920, + "ĠVariable": 16921, + "ilis": 16922, + "Ġmultiplicative": 16923, + "ĠNoise": 16924, + "Ġswitched": 16925, + "Ġnicot": 16926, + "Ġefficiencies": 16927, + "hema": 16928, + "Ġappointed": 16929, + "guided": 16930, + "Ġwinning": 16931, + "ĠMechanics": 16932, + "Ġneo": 16933, + "ĠBRCA": 16934, + "udi": 16935, + "Ġcontainer": 16936, + "shop": 16937, + "Ġsuggestions": 16938, + "KB": 16939, + "Ġsubstitute": 16940, + "Ox": 16941, + "VC": 16942, + "Ġstone": 16943, + "anna": 16944, + "ĠDepression": 16945, + "Ġcontemporary": 16946, + "Ġoutliers": 16947, + "quet": 16948, + "ĠZheng": 16949, + "Ġoccl": 16950, + "Ġalveolar": 16951, + "expressing": 16952, + "Ġcomfort": 16953, + "Ġignore": 16954, + "Among": 16955, + "ĠKlein": 16956, + "Ġrhythm": 16957, + "Ġimmers": 16958, + "Ġfaith": 16959, + "bling": 16960, + "Ġaugmentation": 16961, + "ĠPrevention": 16962, + "Ġhepar": 16963, + "Ġnotations": 16964, + "Ġhematopoietic": 16965, + "perfect": 16966, + "Ġshares": 16967, + "notin": 16968, + "Ġpictures": 16969, + "ĠAcknowledgments": 16970, + "Ġtick": 16971, + "Ġunrelated": 16972, + "ĠTool": 16973, + "Ġmas": 16974, + "osocial": 16975, + "gest": 16976, + "ushed": 16977, + "Ġphosphorylated": 16978, + "Ġceramic": 16979, + "cool": 16980, + "orylation": 16981, + "Ġdeficient": 16982, + "Ġrelaxed": 16983, + "ĠAnalyses": 16984, + "ecraft": 16985, + "Ġretina": 16986, + "ĠInternal": 16987, + "Ġspite": 16988, + "Ġrecipients": 16989, + "Ġshut": 16990, + "Ġethylene": 16991, + "ĠGulf": 16992, + "Ġunaffected": 16993, + "ĠResource": 16994, + "ĠNet": 16995, + "Ġperpet": 16996, + "Ġslab": 16997, + "report": 16998, + "Ġμmol": 16999, + "Ġidx": 17000, + "Ġskill": 17001, + "ĠInduction": 17002, + "Ġmalignancy": 17003, + "Ġcv": 17004, + "Ġdiffering": 17005, + "Ġappropriately": 17006, + "ijing": 17007, + "Ġwarrant": 17008, + "rally": 17009, + "Ġalgae": 17010, + "weights": 17011, + "casts": 17012, + "Ġocular": 17013, + "racycl": 17014, + "Ġdominates": 17015, + "Ġleuc": 17016, + "Where": 17017, + "phon": 17018, + "Ġsocioeconomic": 17019, + "itzerland": 17020, + "Ġresilience": 17021, + "Ġneighbourhood": 17022, + "Ġtone": 17023, + "psych": 17024, + "ĠOrganic": 17025, + "Ġgather": 17026, + "Ġfalciparum": 17027, + "Ġengineered": 17028, + "ĠAvail": 17029, + "intering": 17030, + "Ġclimatic": 17031, + "ĠEvolutionary": 17032, + "NMR": 17033, + "Ġrev": 17034, + "central": 17035, + "ĠSin": 17036, + "Ġdeclined": 17037, + "opausal": 17038, + "Ġalarm": 17039, + "Rightarrow": 17040, + "sex": 17041, + "Ġenergetic": 17042, + "ïĤ": 17043, + "Ġdiscs": 17044, + "Ġolfactory": 17045, + "uripot": 17046, + "spectrum": 17047, + "spot": 17048, + "Ġhemoglobin": 17049, + "Mark": 17050, + "cov": 17051, + "arboxyl": 17052, + "Ġindications": 17053, + "Ġsalmon": 17054, + "Ġsearched": 17055, + "Ġended": 17056, + "rologic": 17057, + "rfloor": 17058, + "Ġautism": 17059, + "Ġselen": 17060, + "ĠHung": 17061, + "ĠInference": 17062, + "Ġmammary": 17063, + "lfloor": 17064, + "Ġseroton": 17065, + "Ġfunded": 17066, + "ĠViet": 17067, + "Ġrivers": 17068, + "ĠReinfor": 17069, + "urg": 17070, + "Ġalbicans": 17071, + "ĠThermo": 17072, + "ERROR": 17073, + "Ġmutually": 17074, + "Ġirr": 17075, + "ĠRat": 17076, + "Ġimg": 17077, + "Ġlymphocyte": 17078, + "ĠRefs": 17079, + "ĠSparse": 17080, + "holders": 17081, + "Free": 17082, + "RED": 17083, + "ĠGauss": 17084, + "Ġcircadian": 17085, + "ĠJin": 17086, + "Ġconstitutes": 17087, + "Ġwors": 17088, + "Ġfeatured": 17089, + "ocent": 17090, + "lete": 17091, + "Ġontology": 17092, + "Ġbilayer": 17093, + "ĠCambridge": 17094, + "Ġencryption": 17095, + "rotron": 17096, + "etti": 17097, + "ĠAer": 17098, + "Ġcouples": 17099, + "rail": 17100, + "Ġtwist": 17101, + "Ġridge": 17102, + "GAN": 17103, + "iders": 17104, + "SHIFT": 17105, + "Ġdiffus": 17106, + "Ġmeant": 17107, + "ĠSchwarz": 17108, + "Sb": 17109, + "Ġarcs": 17110, + "Notice": 17111, + "iy": 17112, + "Ġemerge": 17113, + "kwargs": 17114, + "Eff": 17115, + "Ent": 17116, + "ionization": 17117, + "choline": 17118, + "ustries": 17119, + "acher": 17120, + "spl": 17121, + "population": 17122, + "fol": 17123, + "Ġquestionnaires": 17124, + "Ġallergic": 17125, + "wich": 17126, + "ĠVacc": 17127, + "Ġattained": 17128, + "ĠAnimals": 17129, + "amics": 17130, + "ĠRegarding": 17131, + "ĠSemi": 17132, + "Ġglac": 17133, + "ĠEfficacy": 17134, + "Ġsynergistic": 17135, + "ISH": 17136, + "Ġmaintains": 17137, + "Ġsongs": 17138, + "ĠNegative": 17139, + "amoto": 17140, + "ĠModified": 17141, + "Ġseparable": 17142, + "Ġbinaries": 17143, + "Ġaccessibility": 17144, + "Iter": 17145, + "din": 17146, + "ĠBinary": 17147, + "equilibrium": 17148, + "Ġcue": 17149, + "magn": 17150, + "Ġedema": 17151, + "�": 17152, + "Ġpositioned": 17153, + "Ġcharging": 17154, + "Ġunivariate": 17155, + "hep": 17156, + "Ġclade": 17157, + "Ġcysteine": 17158, + "racle": 17159, + "Ġrescue": 17160, + "habit": 17161, + "ĠDISCUSSION": 17162, + "Ġdepicts": 17163, + "pole": 17164, + "Ġstenosis": 17165, + "Ġveter": 17166, + "pringer": 17167, + "ĠPow": 17168, + "Ġcovariant": 17169, + "Ġmodifying": 17170, + "Algorithm": 17171, + "averaged": 17172, + "alo": 17173, + "reson": 17174, + "Ġcharacterised": 17175, + "Ġni": 17176, + "Ġseemed": 17177, + "ĠRom": 17178, + "short": 17179, + "NV": 17180, + "Ġfertility": 17181, + "ĠMemb": 17182, + "Ġlying": 17183, + "Ġinstitution": 17184, + "images": 17185, + "ĠBorel": 17186, + "fsys": 17187, + "cataly": 17188, + "Ġseparating": 17189, + "biotic": 17190, + "mel": 17191, + "pgfsys": 17192, + "ĠJackson": 17193, + "Ġbag": 17194, + "ograp": 17195, + "propyl": 17196, + "ĠProgramming": 17197, + "ocratic": 17198, + "Ġpion": 17199, + "ĠGradient": 17200, + "Ġsphe": 17201, + "Ġinline": 17202, + "Ġdominate": 17203, + "Ġsuffered": 17204, + "ĠDiseases": 17205, + "igenous": 17206, + "will": 17207, + "Ġamin": 17208, + "adherin": 17209, + "ĠTro": 17210, + "adjusted": 17211, + "EW": 17212, + "Ġdebut": 17213, + "nea": 17214, + "ĠDun": 17215, + "Ġdictionary": 17216, + "operatively": 17217, + "KA": 17218, + "beit": 17219, + "Ġpersonnel": 17220, + "ĠŽ": 17221, + "review": 17222, + "into": 17223, + "ĠTokyo": 17224, + "Ġtrop": 17225, + "Ġventric": 17226, + "ĠMETHODS": 17227, + "Ġimplication": 17228, + "akis": 17229, + "ĠCMB": 17230, + "Ġtransmitter": 17231, + "oichi": 17232, + "ĠNigeria": 17233, + "ĠKon": 17234, + "Ġbear": 17235, + "ĠKan": 17236, + "ĠPlot": 17237, + "ĠSPSS": 17238, + "ĠBiology": 17239, + "Ġbaryon": 17240, + "ĠmicroRNA": 17241, + "Ġreproducibility": 17242, + "Ġlactate": 17243, + "Ġpolyphen": 17244, + "ĠMt": 17245, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 17246, + "endit": 17247, + "Ġhydrothermal": 17248, + "Ġwealth": 17249, + "Ġhadron": 17250, + "Ġwhereby": 17251, + "ellum": 17252, + "ĠDiffusion": 17253, + "ĠOrigin": 17254, + "Ġnonlinearity": 17255, + "Ġinformative": 17256, + "Ġvisited": 17257, + "Ġvirtually": 17258, + "ĠTun": 17259, + "Ġreset": 17260, + "ĠElectrical": 17261, + "ĠGlu": 17262, + "ĠSAM": 17263, + "ĠIsing": 17264, + "ĠStra": 17265, + "onder": 17266, + "Ġdies": 17267, + "Ġreciprocal": 17268, + "Check": 17269, + "ĠGuidelines": 17270, + "hester": 17271, + "Ġproblematic": 17272, + "ĠAtomic": 17273, + "Ġconcentrate": 17274, + "steps": 17275, + "json": 17276, + "Recommended": 17277, + "ĠScreening": 17278, + "Ġnaive": 17279, + "Ġpractitioners": 17280, + "Ġfasting": 17281, + "Ġmechanistic": 17282, + "options": 17283, + "Ptr": 17284, + "ITE": 17285, + "Work": 17286, + "âĢĺ": 17287, + "rafts": 17288, + "Ġunw": 17289, + "Ġannihilation": 17290, + "objective": 17291, + "ĠDynamical": 17292, + "adec": 17293, + "ĠLith": 17294, + "Ġextracting": 17295, + "Ġcoral": 17296, + "ĠStable": 17297, + "Ġbackgrounds": 17298, + "omorphisms": 17299, + "ĠâĪ«": 17300, + "Ġgrew": 17301, + "Inst": 17302, + "gels": 17303, + "Ġinhal": 17304, + "dam": 17305, + "heim": 17306, + "benzyl": 17307, + "Ġpelvic": 17308, + "Ġdiarr": 17309, + "Ġdiode": 17310, + "Ġempir": 17311, + "ĠAlf": 17312, + "ĠUncertain": 17313, + "ĠHCl": 17314, + "Ġjointly": 17315, + "Ġdepar": 17316, + "Ġmerging": 17317, + "Ġchi": 17318, + "apt": 17319, + "Ġplt": 17320, + "Ġidi": 17321, + "Ġperfor": 17322, + "stituting": 17323, + "page": 17324, + "aré": 17325, + "indices": 17326, + "putation": 17327, + "different": 17328, + "burn": 17329, + "Ġsurrounded": 17330, + "ĠTL": 17331, + "untary": 17332, + "strip": 17333, + "lan": 17334, + "Ġcow": 17335, + "ĠSab": 17336, + "ĠGaAs": 17337, + "pf": 17338, + "Ġesophageal": 17339, + "ĠAlt": 17340, + "Ġhospitalization": 17341, + "ĠApproximation": 17342, + "Organism": 17343, + "ĠFair": 17344, + "Ġtracing": 17345, + "Ġpreferentially": 17346, + "Ġlowering": 17347, + "uliar": 17348, + "ĠDeriv": 17349, + "Ġphytoplankton": 17350, + "omyc": 17351, + "That": 17352, + "ĠIsrael": 17353, + "Ġminimized": 17354, + "Ġanything": 17355, + "rule": 17356, + "pow": 17357, + "Ġfamous": 17358, + "ĠAccuracy": 17359, + "Ġphotocatalytic": 17360, + "ĠNonetheless": 17361, + "Ġdivisor": 17362, + "vb": 17363, + "Ġcameras": 17364, + "ĠWales": 17365, + "ĠContributions": 17366, + "Ġdisplacements": 17367, + "ĠTam": 17368, + "Ġvolumetric": 17369, + "essional": 17370, + "Ġcompensate": 17371, + "Ġace": 17372, + "triangle": 17373, + "buff": 17374, + "Ġnamespace": 17375, + "Ġbounding": 17376, + "ynchronous": 17377, + "md": 17378, + "Ġimagery": 17379, + "itated": 17380, + "Ġoriginated": 17381, + "ĠBelg": 17382, + "ĠECG": 17383, + "existing": 17384, + "ĠStokes": 17385, + "sensitivity": 17386, + "tidine": 17387, + "ĠWM": 17388, + "Ġmonotone": 17389, + "Ġproceeds": 17390, + "ĠClustering": 17391, + "ĠIoT": 17392, + "ernary": 17393, + "alamic": 17394, + "ĠCollaboration": 17395, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 17396, + "OLD": 17397, + "Îĺ": 17398, + "ĠNanopar": 17399, + "ĠMultiv": 17400, + "Ġcystic": 17401, + "pire": 17402, + "Ġoperates": 17403, + "Ġmediating": 17404, + "Ġbeneath": 17405, + "obe": 17406, + "gate": 17407, + "Ġoocytes": 17408, + "Ġmargins": 17409, + "ymmetries": 17410, + "Ġreligious": 17411, + "ĠNit": 17412, + "Ġcutaneous": 17413, + "ANS": 17414, + "Ġdevelops": 17415, + "asia": 17416, + "ĠRoberts": 17417, + "avier": 17418, + "Ġsimplic": 17419, + "Ġrevealing": 17420, + "UND": 17421, + "Ġtea": 17422, + "Ġlysis": 17423, + "Ġaggregated": 17424, + "ĠRGB": 17425, + "Ġcorro": 17426, + "Ġbir": 17427, + "inae": 17428, + "vd": 17429, + "Ġcourt": 17430, + "Ġcontroversial": 17431, + "Ġtow": 17432, + "Ġhysteresis": 17433, + "enberg": 17434, + "Ġenters": 17435, + "png": 17436, + "ĠFlex": 17437, + "Assume": 17438, + "ĠBad": 17439, + "ĠSimilarities": 17440, + "Experim": 17441, + "ATH": 17442, + "Ġut": 17443, + "terms": 17444, + "ĠMol": 17445, + "Ġvisually": 17446, + "Ġadoption": 17447, + "Ġprinting": 17448, + "Ġequiv": 17449, + "ĠPert": 17450, + "Ġpercol": 17451, + "Ġsomeone": 17452, + "abulary": 17453, + "Ġlever": 17454, + "ĠHaus": 17455, + "icillin": 17456, + "itar": 17457, + "Ġtourn": 17458, + "Altern": 17459, + "Exp": 17460, + "~~~~": 17461, + "ĠFo": 17462, + "Ġabol": 17463, + "median": 17464, + "Ġrolling": 17465, + "hm": 17466, + "Ġtelescope": 17467, + "ĠCav": 17468, + "Ġseedlings": 17469, + "inhib": 17470, + "Ġdin": 17471, + "Ġimpurities": 17472, + "Ġamplifier": 17473, + "ĠKer": 17474, + "Ġdiminished": 17475, + "PB": 17476, + "fib": 17477, + "rock": 17478, + "ĠBin": 17479, + "Ġphotosynthetic": 17480, + "ĠCrypt": 17481, + "Ġpreterm": 17482, + "Ġhits": 17483, + "Ġfractal": 17484, + "Ġdiscarded": 17485, + "Ġendocrine": 17486, + "oshi": 17487, + "Ġmodulo": 17488, + "wt": 17489, + "Ġquenching": 17490, + "Ġsounds": 17491, + "ĠEDTA": 17492, + "reactive": 17493, + "Ġresist": 17494, + "anghai": 17495, + "Ġnarr": 17496, + "Ġinitiate": 17497, + "ĠSaint": 17498, + "XR": 17499, + "GeV": 17500, + "ĠIndependent": 17501, + "Ġinjective": 17502, + "upus": 17503, + "Ġlinguistic": 17504, + "Ġanalogues": 17505, + "Ġdissection": 17506, + "Ġlasers": 17507, + "diab": 17508, + "ĠTele": 17509, + "Ġcracks": 17510, + "Ġbrane": 17511, + "VO": 17512, + "ĠExtended": 17513, + "Ġtells": 17514, + "Ġremarks": 17515, + "ulting": 17516, + "ĠBurn": 17517, + "dL": 17518, + "ressible": 17519, + "ĠChap": 17520, + "Ġsq": 17521, + "Ġreproduced": 17522, + "ĠBcl": 17523, + "Ġswarm": 17524, + "opathology": 17525, + "chrotron": 17526, + "Ġmine": 17527, + "Ġhadronic": 17528, + "ĠLocalization": 17529, + "ĠMotor": 17530, + "Ġvisualize": 17531, + "Ġcats": 17532, + "Ġbalancing": 17533, + "ĠSched": 17534, + "CoA": 17535, + "Ġthermodynamics": 17536, + "ĠDiagnostic": 17537, + "Ġrelief": 17538, + "Ġpositivity": 17539, + "Ġhub": 17540, + "ĠInfrared": 17541, + "Sur": 17542, + "omed": 17543, + "Ġoptically": 17544, + "Ġvascul": 17545, + "isations": 17546, + "encoder": 17547, + "Ġcopolymer": 17548, + "Ġrestore": 17549, + "Ġinertia": 17550, + "ubicin": 17551, + "Ġetiology": 17552, + "ĠSecret": 17553, + "ĠCW": 17554, + "Const": 17555, + "ĠBrit": 17556, + "ĠConstant": 17557, + "ĠDIS": 17558, + "Ġdiscipl": 17559, + "bra": 17560, + "ĠOral": 17561, + "ĠUL": 17562, + "Ġdeline": 17563, + "Ġnucleon": 17564, + "Ġemployment": 17565, + "ĠRD": 17566, + "qq": 17567, + "ĠCarolina": 17568, + "ĠGab": 17569, + "Ġassertion": 17570, + "CMC": 17571, + "rgb": 17572, + "Frame": 17573, + "ĠJust": 17574, + "Ġinoculation": 17575, + "cluding": 17576, + "Ġoscillatory": 17577, + "Ġcancel": 17578, + "ĠPoinc": 17579, + "pora": 17580, + "ĠJul": 17581, + "ruvate": 17582, + "Ġpolitic": 17583, + "urus": 17584, + "ĠAdvances": 17585, + "ĠRoot": 17586, + "thood": 17587, + "oxygenase": 17588, + "msg": 17589, + "ĠkV": 17590, + "Ġadmit": 17591, + "Ġrefractory": 17592, + "Ġcloning": 17593, + "Ġfatal": 17594, + "plantation": 17595, + "ĠGir": 17596, + "Ġtes": 17597, + "ĠRho": 17598, + "ohn": 17599, + "Ġinnovation": 17600, + "Ġsending": 17601, + "Ġcable": 17602, + "Ġniche": 17603, + "Ġreserve": 17604, + "Ġatrophy": 17605, + "athan": 17606, + "ĠÃij": 17607, + "itization": 17608, + "Ġfan": 17609, + "Ġbubbles": 17610, + "ĠTheorems": 17611, + "ĠSwitzerland": 17612, + "ĠHeisenberg": 17613, + "ĠReduced": 17614, + "Ra": 17615, + "Zr": 17616, + "ĠPossible": 17617, + "Upsilon": 17618, + "ĠAgric": 17619, + "ellect": 17620, + "nds": 17621, + "mathds": 17622, + "atre": 17623, + "Ġforaging": 17624, + "Ġupward": 17625, + "idene": 17626, + "Ġglands": 17627, + "fed": 17628, + "uccessful": 17629, + "ĠWolf": 17630, + "Ġusefulness": 17631, + "oporous": 17632, + "Ġpunct": 17633, + "ardo": 17634, + "Ġsystolic": 17635, + "ĠTargeting": 17636, + "Ġillumin": 17637, + "Ġpigment": 17638, + "Ġsimulating": 17639, + "Ġportions": 17640, + "ĠPrinciples": 17641, + "ĠHopf": 17642, + "lipid": 17643, + "ĠLU": 17644, + "ubation": 17645, + "ĠArtificial": 17646, + "Ġprison": 17647, + "aning": 17648, + "ĠGN": 17649, + "ĠStrategies": 17650, + "ĠPas": 17651, + "Ta": 17652, + "ĠProbability": 17653, + "orum": 17654, + "Ġskeleton": 17655, + "Ġcompartments": 17656, + "Read": 17657, + "Ġcoach": 17658, + "Ġmodality": 17659, + "ĠRegister": 17660, + "Ġje": 17661, + "Ġheights": 17662, + "inyl": 17663, + "Ġsubspaces": 17664, + "tip": 17665, + "Ġá¸": 17666, + "ĠGI": 17667, + "Char": 17668, + "rogenic": 17669, + "rett": 17670, + "eutics": 17671, + "Ġadhesive": 17672, + "ĠPier": 17673, + "Left": 17674, + "idental": 17675, + "NAc": 17676, + "Ġconjugation": 17677, + "orov": 17678, + "idge": 17679, + "imaging": 17680, + "ĠTW": 17681, + "Ġpresident": 17682, + "ĠOste": 17683, + "assemb": 17684, + "Ġinternet": 17685, + "Ġdeals": 17686, + "ĠGAP": 17687, + "Ġformulate": 17688, + "ĠUpdate": 17689, + "ĠRNAi": 17690, + "clero": 17691, + "Ġpermutations": 17692, + "Ġisotopes": 17693, + "opic": 17694, + "ĠQU": 17695, + "romes": 17696, + "ĠPolicy": 17697, + "ĠCreek": 17698, + "ĠWindows": 17699, + "Ġmerge": 17700, + "Ġaccident": 17701, + "Ġsuperposition": 17702, + "Ġdebate": 17703, + "Ġdocumentation": 17704, + "Ġeigenvectors": 17705, + "sor": 17706, + "ĠPhoto": 17707, + "Ġdeposit": 17708, + "Ġgermination": 17709, + "Ġsubgraph": 17710, + "ĠRecords": 17711, + "Ġchemically": 17712, + "ĠPredicting": 17713, + "ĠKy": 17714, + "selective": 17715, + "ynman": 17716, + "dispers": 17717, + "Ġlumbar": 17718, + "Ġmusical": 17719, + "inates": 17720, + "Ġinherited": 17721, + "ju": 17722, + "Ġtracer": 17723, + "Ġending": 17724, + "Ġengaged": 17725, + "handed": 17726, + "Ġproducer": 17727, + "Ġentangled": 17728, + "ĠDelta": 17729, + "Ġpiecewise": 17730, + "NAME": 17731, + "stop": 17732, + "Ġmutated": 17733, + "Ġrecess": 17734, + "Ġimmuno": 17735, + "cancer": 17736, + "ĠAkt": 17737, + "iters": 17738, + "ĠBMP": 17739, + "Ġcompanion": 17740, + "Ġcommunicate": 17741, + "Ġhollow": 17742, + "Ġpad": 17743, + "Ġsph": 17744, + "omod": 17745, + "Ġparton": 17746, + "Ġspontaneously": 17747, + "eared": 17748, + "Ġrotations": 17749, + "Ġcosmology": 17750, + "Ġmoreover": 17751, + "princ": 17752, + "Ġeverywhere": 17753, + "brane": 17754, + "lational": 17755, + "eme": 17756, + "Ġbehave": 17757, + "umen": 17758, + "oston": 17759, + "oves": 17760, + "Ġgar": 17761, + "Ġadrenal": 17762, + "ĠEstimating": 17763, + "Nb": 17764, + "Ġechocardi": 17765, + "Ġemphasized": 17766, + "Ġengines": 17767, + "Ġbrackets": 17768, + "Ġleaders": 17769, + "Ġdistinctive": 17770, + "ĠLymph": 17771, + "Ġexert": 17772, + "Ġinnovative": 17773, + "coupling": 17774, + "ĠSignific": 17775, + "sheet": 17776, + "ĠCover": 17777, + "ĠCCD": 17778, + "ĠFall": 17779, + "stimulated": 17780, + "Ġsuperoxide": 17781, + "Ġpollutants": 17782, + "Ġbytes": 17783, + "ĠLipid": 17784, + "Ġtrafficking": 17785, + "Ġleadership": 17786, + "informatics": 17787, + "Ġbiodiversity": 17788, + "ador": 17789, + "Ġinterconn": 17790, + "Ġharmonics": 17791, + "Ġseawater": 17792, + "ĠIllumina": 17793, + "necessary": 17794, + "ĠAnton": 17795, + "Ġprocessors": 17796, + "typename": 17797, + "Det": 17798, + "proton": 17799, + "Ġsubtraction": 17800, + "Ġshifting": 17801, + "Ġcustomers": 17802, + "Ke": 17803, + "ĠOB": 17804, + "atonin": 17805, + "atellite": 17806, + "ĠSUS": 17807, + "ĠColon": 17808, + "ĠTimes": 17809, + "TV": 17810, + "ĠMink": 17811, + "ĠIntegration": 17812, + "Ġprofound": 17813, + "ITC": 17814, + "Ġgras": 17815, + "ĠNASA": 17816, + "ĠACK": 17817, + "radiol": 17818, + "ĠMale": 17819, + "ĠWorking": 17820, + "ticity": 17821, + "ilibria": 17822, + "boundary": 17823, + "ĠRI": 17824, + "ĠAli": 17825, + "cardi": 17826, + "ĠFGF": 17827, + "branes": 17828, + "Ġbeet": 17829, + "Ġmissed": 17830, + "Source": 17831, + "ĠBot": 17832, + "ieve": 17833, + "Ġisother": 17834, + "neys": 17835, + "nl": 17836, + "ortion": 17837, + "Ġcooled": 17838, + "MV": 17839, + "Ġomit": 17840, + "Ġverbal": 17841, + "arette": 17842, + "Ġconference": 17843, + "Ġtransformer": 17844, + "Ġrejected": 17845, + "Ġprogressively": 17846, + "ĠTurkey": 17847, + "Ġathletes": 17848, + "Ġanatomy": 17849, + "EQ": 17850, + "Ġdeterioration": 17851, + "ĠDietary": 17852, + "Ġcorn": 17853, + "Ġcapsule": 17854, + "Ġvibrations": 17855, + "Ġoccupational": 17856, + "Ġexosomes": 17857, + "Ġrewritten": 17858, + "Ġlignin": 17859, + "Ġbiopsies": 17860, + "ĠAdversarial": 17861, + "Ġmercury": 17862, + "Ġplatinum": 17863, + "Ġirrelevant": 17864, + "Ġkeratin": 17865, + "ĠEmission": 17866, + "Ġeukaryotic": 17867, + "Ġinteg": 17868, + "Ġknot": 17869, + "Ġsera": 17870, + "Ġcavities": 17871, + "ĠMedi": 17872, + "Indeed": 17873, + "Eu": 17874, + "ĠâŁ": 17875, + "Ġscenes": 17876, + "Ġlaparoscopic": 17877, + "Ġsenior": 17878, + "ĠDistance": 17879, + "predic": 17880, + "Ġearliest": 17881, + "Ġorg": 17882, + "ĠThor": 17883, + "bury": 17884, + "oblasts": 17885, + "Ġpumping": 17886, + "targeted": 17887, + "Ġrap": 17888, + "ĠPil": 17889, + "Îł": 17890, + "Ġneurom": 17891, + "oft": 17892, + "ostat": 17893, + "Ġpadding": 17894, + "Ġconflicts": 17895, + "Ġstems": 17896, + "ĠSaccharomyces": 17897, + "engine": 17898, + "Ġalkyl": 17899, + "Ġtill": 17900, + "ĠQuad": 17901, + "good": 17902, + "rox": 17903, + "ĠFuzzy": 17904, + "Ġrobotic": 17905, + "ĠDenote": 17906, + "ĠNIR": 17907, + "ĠYuk": 17908, + "parency": 17909, + "Ġlegs": 17910, + "ylvan": 17911, + "Ġtightly": 17912, + "Ġdecor": 17913, + "ĠVP": 17914, + "ĠMun": 17915, + "atoms": 17916, + "ĠSilver": 17917, + "Ġneurodegenerative": 17918, + "Ġresponded": 17919, + "Ġrecons": 17920, + "GEN": 17921, + "ĠFine": 17922, + "fc": 17923, + "Ġparagraph": 17924, + "Ġintens": 17925, + "Ġalongside": 17926, + "Ġbrand": 17927, + "monium": 17928, + "Ġpm": 17929, + "Ġsimplex": 17930, + "ĠPreliminary": 17931, + "Ġdownregulation": 17932, + "Ġxy": 17933, + "ĠMak": 17934, + "opter": 17935, + "ushing": 17936, + "ĠBog": 17937, + "oxia": 17938, + "================================": 17939, + "common": 17940, + "ĠASS": 17941, + "ĠHDL": 17942, + "alamus": 17943, + "Ġirrigation": 17944, + "NM": 17945, + "Ġfading": 17946, + "Ġpreventive": 17947, + "Ġreliably": 17948, + "ĠEthiopia": 17949, + "othesis": 17950, + "izability": 17951, + "OB": 17952, + "Ġtriglycer": 17953, + "Ġgestational": 17954, + "Ġbesides": 17955, + "ĠIii": 17956, + "ĠZone": 17957, + "Ġcoping": 17958, + "Ġminority": 17959, + "Ġdeprivation": 17960, + "Ġhexagonal": 17961, + "chlorophenyl": 17962, + "ĠóµĦ¨": 17963, + "Ġgyr": 17964, + "Ġviewing": 17965, + "Newton": 17966, + "ĠHierarchical": 17967, + "oL": 17968, + "eces": 17969, + "Ġconcludes": 17970, + "Ġfungus": 17971, + "Ġpylori": 17972, + "Ġobstacles": 17973, + "thiazol": 17974, + "conjugated": 17975, + "rass": 17976, + "Ġlose": 17977, + "Ġforth": 17978, + "ĠAllen": 17979, + "oplast": 17980, + "ĠProtection": 17981, + "Ġintermittent": 17982, + "Ġluciferase": 17983, + "ĠMK": 17984, + "Ġgaug": 17985, + "ĠFan": 17986, + "Ġmodal": 17987, + "ĠExercise": 17988, + "scattering": 17989, + "ĠShim": 17990, + "Ġexcretion": 17991, + "Ġatypical": 17992, + "Ġmalignancies": 17993, + "anglades": 17994, + "ĠSpectroscopy": 17995, + "Ġadenosine": 17996, + "lif": 17997, + "Ġnucleic": 17998, + "Ġinclination": 17999, + "ĠCass": 18000, + "Ġethn": 18001, + "Ġexempl": 18002, + "ĠDy": 18003, + "Ġlambda": 18004, + "Ġjac": 18005, + "ĠPRE": 18006, + "Ġrailway": 18007, + "Ġfle": 18008, + "Ġreflections": 18009, + "Ġnanostructures": 18010, + "tists": 18011, + "prints": 18012, + "ĠCAT": 18013, + "Ġsib": 18014, + "Ġchloro": 18015, + "Ġrecipient": 18016, + "optic": 18017, + "Ġcounty": 18018, + "Ġnucleotides": 18019, + "Ġzircon": 18020, + "Ġhorses": 18021, + "ĠMental": 18022, + "inline": 18023, + "ĠNorway": 18024, + "They": 18025, + "Ġmuscular": 18026, + "acetic": 18027, + "ĠJu": 18028, + "Ġcommunic": 18029, + "files": 18030, + "filled": 18031, + "HB": 18032, + "Ġregulations": 18033, + "Ġaccumulate": 18034, + "ĠPanel": 18035, + "Cy": 18036, + "öl": 18037, + "ĠPakistan": 18038, + "Ġthoracic": 18039, + "ĠMPI": 18040, + "portion": 18041, + "Ġinductive": 18042, + "ĠCongress": 18043, + "Ġfibroblast": 18044, + "clust": 18045, + "Ġcentres": 18046, + "adel": 18047, + "Ġsubstitutions": 18048, + "Ġtruncation": 18049, + "rification": 18050, + "oka": 18051, + "Flow": 18052, + "ĠReduc": 18053, + "polarized": 18054, + "ibular": 18055, + "Pe": 18056, + "ĠAML": 18057, + "ĠAgency": 18058, + "Ġtilt": 18059, + "ublished": 18060, + "Ġdepolar": 18061, + "Ġbelt": 18062, + "Ġoptimizer": 18063, + "ELL": 18064, + "ĠHandbook": 18065, + "ĠVirginia": 18066, + "sense": 18067, + "ĠDur": 18068, + "Ġpiezoelectric": 18069, + "Ġawarded": 18070, + "ailing": 18071, + "Pos": 18072, + "pref": 18073, + "ĠSummer": 18074, + "edo": 18075, + "ĠIde": 18076, + "ĠBSA": 18077, + "Ġmonomers": 18078, + "Ġcoagulation": 18079, + "Ġgam": 18080, + "Ġhomes": 18081, + "Ġheads": 18082, + "admium": 18083, + "ĠOC": 18084, + "Ġoccupancy": 18085, + "ĠEmpirical": 18086, + "ĠIi": 18087, + "Ġchir": 18088, + "Ġdegeneracy": 18089, + "Ġflowers": 18090, + "Ġsuperconductivity": 18091, + "Ġinversely": 18092, + "optical": 18093, + "were": 18094, + "ĠAsymptotic": 18095, + "Sec": 18096, + "title": 18097, + "posal": 18098, + "ĠProgn": 18099, + "Ġposes": 18100, + "ĠBorn": 18101, + "Ġcontinuation": 18102, + "Ġcultivated": 18103, + "entiment": 18104, + "Ġmanaging": 18105, + "Ġthrombosis": 18106, + "aug": 18107, + "CNT": 18108, + "urea": 18109, + "Ġspind": 18110, + "ĠWhereas": 18111, + "ĠPerson": 18112, + "Ġbipartite": 18113, + "Ġrescal": 18114, + "Ġmarkets": 18115, + "phan": 18116, + "perties": 18117, + "Ġfermionic": 18118, + "Ġmunicip": 18119, + "Ġachievable": 18120, + "tab": 18121, + "Åį": 18122, + "ĠRelation": 18123, + "Total": 18124, + "xia": 18125, + "Ġintelligent": 18126, + "ĠUT": 18127, + "ĠDal": 18128, + "Ġmedicinal": 18129, + "Ġinadequate": 18130, + "iently": 18131, + "ersen": 18132, + "Ġprecondition": 18133, + "Ġmethodological": 18134, + "Ġcanopy": 18135, + "Ġbacterium": 18136, + "column": 18137, + "Cal": 18138, + "ĠDiego": 18139, + "ĠSak": 18140, + "ĠComprehensive": 18141, + "Ġantitumor": 18142, + "Ġflower": 18143, + "ĠKhan": 18144, + "Ġmetadata": 18145, + "Ġphotore": 18146, + "ogenicity": 18147, + "Ġleague": 18148, + "olating": 18149, + "Ġpromise": 18150, + "ĠPere": 18151, + "Ġpermits": 18152, + "Ġthreads": 18153, + "ĠDCs": 18154, + "ĠCham": 18155, + "razol": 18156, + "Bank": 18157, + "Ġwithdrawal": 18158, + "Ġappend": 18159, + "othelial": 18160, + "ĠMeasures": 18161, + "Ġguideline": 18162, + "Ġmitigate": 18163, + "adjoint": 18164, + "Ġbracket": 18165, + "Pad": 18166, + "Mills": 18167, + "Buffer": 18168, + "Ġcass": 18169, + "hoc": 18170, + "manifolds": 18171, + "herry": 18172, + "Ġfacilitated": 18173, + "Event": 18174, + "ĠÈ": 18175, + "ĠCruz": 18176, + "ĠBrand": 18177, + "Ġnecessity": 18178, + "burgh": 18179, + "ĠmeV": 18180, + "ĠcAMP": 18181, + "Off": 18182, + "selected": 18183, + "Ġengage": 18184, + "Ġredundancy": 18185, + "Ġnanocomposites": 18186, + "solution": 18187, + "onset": 18188, + "ĠExposure": 18189, + "Ġrepetitive": 18190, + "Ãł": 18191, + "ĠRAD": 18192, + "ĠTurk": 18193, + "Ġcorneal": 18194, + "Ġexploiting": 18195, + "Ġobstructive": 18196, + "gramming": 18197, + "ĠMED": 18198, + "Ġmathem": 18199, + "Ġconductive": 18200, + "Ġphotosynthesis": 18201, + "Einstein": 18202, + "ĠPeng": 18203, + "MW": 18204, + "ĠSchmidt": 18205, + "Ġrepetition": 18206, + "identified": 18207, + "Ġinjured": 18208, + "Ġdefective": 18209, + "ĠPel": 18210, + "Ġcultivation": 18211, + "Ġfirstly": 18212, + "Ġanalyzer": 18213, + "Ġstainless": 18214, + "Ġjoining": 18215, + "ĠOxidative": 18216, + "Ġphage": 18217, + "Ġexpendit": 18218, + "Ġhomogeneity": 18219, + "iple": 18220, + "ovic": 18221, + "Ġcrossed": 18222, + "ĠTrust": 18223, + "ĠFract": 18224, + "rophysiological": 18225, + "Ġbasically": 18226, + "Ġcoales": 18227, + "Ġgravit": 18228, + "fulness": 18229, + "cano": 18230, + "Ġcolitis": 18231, + "Ġchaos": 18232, + "carbons": 18233, + "Once": 18234, + "ĠToward": 18235, + "orf": 18236, + "topic": 18237, + "ĠPlay": 18238, + "ĠCorrespond": 18239, + "ĠSleep": 18240, + "ticularly": 18241, + "cumin": 18242, + "vdots": 18243, + "ĠRhe": 18244, + "Ġultraf": 18245, + "Ġtimescale": 18246, + "ĠDetails": 18247, + "angles": 18248, + "Ġsurrogate": 18249, + "ĠFluid": 18250, + "cz": 18251, + "Ġinitialization": 18252, + "ĠTelescope": 18253, + "rases": 18254, + "ĠStock": 18255, + "ĠCond": 18256, + "Ġimmunodeficiency": 18257, + "Bel": 18258, + "oser": 18259, + "shown": 18260, + "Ġkcal": 18261, + "Equation": 18262, + "protective": 18263, + "Ġcalling": 18264, + "Ġanticipated": 18265, + "Ġambiguity": 18266, + "ĠNode": 18267, + "ĠGD": 18268, + "Ġinlet": 18269, + "Ġbread": 18270, + "Ġexceeded": 18271, + "Ġimmunization": 18272, + "Ġprohib": 18273, + "ytic": 18274, + "Ġboys": 18275, + "tu": 18276, + "Ġtower": 18277, + "Like": 18278, + "ĠAnomal": 18279, + "âĮ": 18280, + "ĠShow": 18281, + "Ġimaged": 18282, + "Ġequil": 18283, + "Ġrendering": 18284, + "obility": 18285, + "Ġgeological": 18286, + "friend": 18287, + "ör": 18288, + "carboxamide": 18289, + "ovolta": 18290, + "Current": 18291, + "ĠSti": 18292, + "ĠMU": 18293, + "Ġvalued": 18294, + "Ġpoison": 18295, + "Ġpractically": 18296, + "Ġrequested": 18297, + "Code": 18298, + "Ġbrings": 18299, + "Ġdimethyl": 18300, + "hyp": 18301, + "cemic": 18302, + "Vol": 18303, + "quanti": 18304, + "Ġexha": 18305, + "Ġresponsibility": 18306, + "ĠControlled": 18307, + "Ġfur": 18308, + "Ġresemb": 18309, + "ĠKaw": 18310, + "Ġevoked": 18311, + "Ġuterine": 18312, + "л": 18313, + "Ġanonymous": 18314, + "ĠChallenges": 18315, + "Ġanchor": 18316, + "ĠAbd": 18317, + "Der": 18318, + "Ġthermally": 18319, + "ĠCAP": 18320, + "oblot": 18321, + "ĠFire": 18322, + "Ġdiagnostics": 18323, + "Ġexecute": 18324, + "alis": 18325, + "roni": 18326, + "ĠHarris": 18327, + "ĠGonz": 18328, + "Ġvig": 18329, + "ĠProfessor": 18330, + "Ġinventory": 18331, + "intensity": 18332, + "ĠNSCLC": 18333, + "Ġinterfere": 18334, + "ysaccharides": 18335, + "Ġregener": 18336, + "ĠAuthors": 18337, + "Ġtranslate": 18338, + "ĠTests": 18339, + "ĠLove": 18340, + "ĠInduced": 18341, + "ennis": 18342, + "ĠGEN": 18343, + "Ġoligonucle": 18344, + "Ġmeter": 18345, + "satisf": 18346, + "hesion": 18347, + "Ġtransporters": 18348, + "BIT": 18349, + "ĠConc": 18350, + "Ġglauc": 18351, + "scores": 18352, + "Ġmerger": 18353, + "GH": 18354, + "Ġstoichi": 18355, + "ĠXia": 18356, + "effects": 18357, + "ĠExploring": 18358, + "dorff": 18359, + "Ġcardinality": 18360, + "ĠKaz": 18361, + "false": 18362, + "ĠHSP": 18363, + "Ġunsupervised": 18364, + "inguish": 18365, + "ischer": 18366, + "Ġrelativity": 18367, + "onormal": 18368, + "oothed": 18369, + "edges": 18370, + "ĠIMP": 18371, + "Ġimpulse": 18372, + "ĠColumbia": 18373, + "Ġparticulate": 18374, + "ĠSupporting": 18375, + "ĠSDSS": 18376, + "voltage": 18377, + "ĠAmazon": 18378, + "Ġepoxy": 18379, + "Call": 18380, + "Bigl": 18381, + "Ġmeets": 18382, + "Ġequatorial": 18383, + "Ġneuros": 18384, + "Ġperitoneal": 18385, + "desc": 18386, + "inputs": 18387, + "Ġexterior": 18388, + "aco": 18389, + "Ġmeal": 18390, + "ĠDaniel": 18391, + "Ġintuitive": 18392, + "Ġcouns": 18393, + "depress": 18394, + "inis": 18395, + "phot": 18396, + "ĠAmin": 18397, + "Ġreservoirs": 18398, + "ĠWhole": 18399, + "Ġcaud": 18400, + "Ġbosonic": 18401, + "Ġreaders": 18402, + "Ġcrim": 18403, + "Ġpathophysiology": 18404, + "argo": 18405, + "these": 18406, + "income": 18407, + "Ġissued": 18408, + "Ġhepatocytes": 18409, + "ĠCi": 18410, + "deriv": 18411, + "upta": 18412, + "tuple": 18413, + "ĠChan": 18414, + "Ġauthentication": 18415, + "ygd": 18416, + "Ġinfin": 18417, + "Ġaccelerate": 18418, + "eptive": 18419, + "Ġhydrogel": 18420, + "aska": 18421, + "ONE": 18422, + "Ġfederal": 18423, + "ographics": 18424, + "Ġmuon": 18425, + "Ġslide": 18426, + "Ġelliptical": 18427, + "atite": 18428, + "Ġcc": 18429, + "ETs": 18430, + "Ġclarity": 18431, + "ocycl": 18432, + "isal": 18433, + "rections": 18434, + "ayan": 18435, + "roweak": 18436, + "ĠSOC": 18437, + "oderm": 18438, + "tun": 18439, + "asm": 18440, + "ĠHir": 18441, + "likelihood": 18442, + "Ġadul": 18443, + "tl": 18444, + "High": 18445, + "Ġalters": 18446, + "plitude": 18447, + "ĠRelease": 18448, + "Ġharmful": 18449, + "late": 18450, + "ounds": 18451, + "ĠFederal": 18452, + "ĠEconomic": 18453, + "Ġrabb": 18454, + "Ġaccommodate": 18455, + "emission": 18456, + "ĠBah": 18457, + "cox": 18458, + "ĠModulation": 18459, + "Ġconstructions": 18460, + "igner": 18461, + "ĠUrban": 18462, + "Ġwake": 18463, + "Ġadversary": 18464, + "wikipedia": 18465, + "Ġsuite": 18466, + "wick": 18467, + "expressed": 18468, + "rod": 18469, + "KD": 18470, + "Ġcomputers": 18471, + "ĠBanglades": 18472, + "Ġpersist": 18473, + "Ġburning": 18474, + "Ġadministrative": 18475, + "Ġplug": 18476, + "ĠRepresentations": 18477, + "ĠScattering": 18478, + "Ġendometrial": 18479, + "Ġdescriptors": 18480, + "Ġcommission": 18481, + "Bar": 18482, + "ighth": 18483, + "ĠMarsh": 18484, + "sampling": 18485, + "Ġhull": 18486, + "icin": 18487, + "Prob": 18488, + "Ġnurse": 18489, + "Ġsham": 18490, + "ĠKerr": 18491, + "Ġprefrontal": 18492, + "Ġfixing": 18493, + "OK": 18494, + "Ġbold": 18495, + "Ġcorollary": 18496, + "cfg": 18497, + "ĠOxford": 18498, + "Ġboron": 18499, + "RB": 18500, + "ĠCab": 18501, + "Bigr": 18502, + "ĠPredict": 18503, + "Ġpeculiar": 18504, + "hidden": 18505, + "isa": 18506, + "iden": 18507, + "appropriate": 18508, + "orh": 18509, + "ellectual": 18510, + "Ġseizures": 18511, + "asser": 18512, + "tilis": 18513, + "handle": 18514, + "iaxial": 18515, + "sym": 18516, + "Ġcarcinomas": 18517, + "sea": 18518, + "spired": 18519, + "Ġabrupt": 18520, + "tests": 18521, + "Ġwelfare": 18522, + "ĠOil": 18523, + "ĠLoad": 18524, + "FLAG": 18525, + "uthal": 18526, + "Ġfacing": 18527, + "American": 18528, + "LAS": 18529, + "Ġirrespective": 18530, + "Ġroutinely": 18531, + "wal": 18532, + "Ġsettlement": 18533, + "ĠAqu": 18534, + "Ġelectronics": 18535, + "Ġhandled": 18536, + "Ġbiologically": 18537, + "smooth": 18538, + "ĠBelongs": 18539, + "tib": 18540, + "Ġtrav": 18541, + "pressive": 18542, + "ournals": 18543, + "к": 18544, + "filename": 18545, + "Ġhelical": 18546, + "Ġbacteri": 18547, + "Ġsatellites": 18548, + "BH": 18549, + "ented": 18550, + "ĠFootball": 18551, + "Ġ": 18552, + "ĠHV": 18553, + "Ġtrip": 18554, + "ĠCKD": 18555, + "rani": 18556, + "Ġcleaning": 18557, + "limit": 18558, + "ĠTCP": 18559, + "Ġscin": 18560, + "Ġsludge": 18561, + "Ġsymbolic": 18562, + "ĠSequencing": 18563, + "adal": 18564, + "ĠPhilipp": 18565, + "ICS": 18566, + "Ġvaginal": 18567, + "Ġcommitment": 18568, + "ĠAwards": 18569, + "trig": 18570, + "Ġguitar": 18571, + "acetate": 18572, + "Ġbet": 18573, + "ClN": 18574, + "Ġagriculture": 18575, + "Ġchief": 18576, + "Ġembol": 18577, + "build": 18578, + "Ġtexts": 18579, + "ĠCooper": 18580, + "lived": 18581, + "ĠDelay": 18582, + "ĠMode": 18583, + "yal": 18584, + "BN": 18585, + "Ġindexed": 18586, + "expr": 18587, + "ERN": 18588, + "vens": 18589, + "Ġpointer": 18590, + "cv": 18591, + "acon": 18592, + "tance": 18593, + "ĠâĪĿ": 18594, + "Ġlowered": 18595, + "Ġmitotic": 18596, + "rhosis": 18597, + "ĠPage": 18598, + "ür": 18599, + "imm": 18600, + "ĠTherapeutic": 18601, + "Ġosteopor": 18602, + "Ġbilinear": 18603, + "ĠCatholic": 18604, + "ĠAlternative": 18605, + "oxidation": 18606, + "Ġinitio": 18607, + "benzo": 18608, + "ĠAdi": 18609, + "person": 18610, + "peritoneal": 18611, + "ĉĉĠ": 18612, + "Ġattraction": 18613, + "Ġdiarrhea": 18614, + "Ġren": 18615, + "ĠISO": 18616, + "imir": 18617, + "Ġterminology": 18618, + "ukey": 18619, + "Ġresonator": 18620, + "Ġsubstituting": 18621, + "Ġharbor": 18622, + "provid": 18623, + "decay": 18624, + "ĠHDAC": 18625, + "ĠAnalytical": 18626, + "Ġpostnatal": 18627, + "Ġundes": 18628, + "Specific": 18629, + "dichlor": 18630, + "ARI": 18631, + "tot": 18632, + "Ġdigit": 18633, + "oping": 18634, + "ĠZinc": 18635, + "Ġlethal": 18636, + "Whitney": 18637, + "Fi": 18638, + "quantum": 18639, + "ĠFailure": 18640, + "Ġsolves": 18641, + "ĠSpaces": 18642, + "earman": 18643, + "Ġgoat": 18644, + "Ġsynapses": 18645, + "Ġresuspended": 18646, + "Ġresident": 18647, + "Ġcompac": 18648, + "Ġcortisol": 18649, + "Ġphotometry": 18650, + "WP": 18651, + "select": 18652, + "Ġcele": 18653, + "orubicin": 18654, + "ĠMultic": 18655, + "ĠJean": 18656, + "Ġclip": 18657, + "Ġsa": 18658, + "oco": 18659, + "geometric": 18660, + "Ġhelic": 18661, + "Ġempirically": 18662, + "Ġmicrofluid": 18663, + "idis": 18664, + "Ġautocor": 18665, + "WF": 18666, + "ĠRespir": 18667, + "radiation": 18668, + "Ġthemes": 18669, + "Ġtaste": 18670, + "ricing": 18671, + "Ġexaminations": 18672, + "ĠSensing": 18673, + "same": 18674, + "DEFAULT": 18675, + "Ġphylogeny": 18676, + "hig": 18677, + "Ġplatelets": 18678, + "ĠHistor": 18679, + "aba": 18680, + "Ġresidential": 18681, + "Ġunbounded": 18682, + "anding": 18683, + "hedron": 18684, + "rys": 18685, + "ĠCCR": 18686, + "Ġconce": 18687, + "Ġparasitic": 18688, + "cb": 18689, + "ĠFeynman": 18690, + "ĠKepler": 18691, + "ô": 18692, + "ĠGil": 18693, + "ĠMATLAB": 18694, + "ben": 18695, + "scope": 18696, + "Ġdiscrimin": 18697, + "Ġjustified": 18698, + "plasma": 18699, + "ĠChoi": 18700, + "Ġroof": 18701, + "PCA": 18702, + "ĠTCR": 18703, + "Ġvoxel": 18704, + "ĠWard": 18705, + "Ġuncor": 18706, + "Stok": 18707, + "Ġspur": 18708, + "TRA": 18709, + "Ġdiagnoses": 18710, + "rophysical": 18711, + "ategories": 18712, + "Ġoverestim": 18713, + "Ġstreaming": 18714, + "ĠRecovery": 18715, + "Ġeverything": 18716, + "LOW": 18717, + "Gener": 18718, + "Ġunbiased": 18719, + "Ġvariances": 18720, + "compact": 18721, + "espan": 18722, + "inj": 18723, + "Ġendoscopic": 18724, + "Ġideals": 18725, + "ĠRice": 18726, + "ĠKaplan": 18727, + "Ġfecal": 18728, + "ferred": 18729, + "ĠCycle": 18730, + "Ġimplanted": 18731, + "Ġwine": 18732, + "PET": 18733, + "Ġassignments": 18734, + "Ġabsol": 18735, + "XT": 18736, + "Ġswimming": 18737, + "MN": 18738, + "ĠGeometric": 18739, + "ĠHealthcare": 18740, + "Ġpowders": 18741, + "ĠGel": 18742, + "Ġdownward": 18743, + "Ġexceeding": 18744, + "ĠHEK": 18745, + "lym": 18746, + "ĠBV": 18747, + "Ġvisco": 18748, + "iet": 18749, + "ĠCOX": 18750, + "ployment": 18751, + "inski": 18752, + "Ġoutdoor": 18753, + "ĠLiterature": 18754, + "anted": 18755, + "methoxyphenyl": 18756, + "ĠMedium": 18757, + "Ġdia": 18758, + "ailand": 18759, + "variance": 18760, + "ĠEvaluating": 18761, + "oxacin": 18762, + "Ġantif": 18763, + "Ġpulp": 18764, + "Ġcorrobor": 18765, + "ĠOt": 18766, + "Ġrabbits": 18767, + "Ru": 18768, + "Ġfunctionals": 18769, + "âĩ": 18770, + "Ġimmersion": 18771, + "Ġcreatin": 18772, + "ĠqRT": 18773, + "Ġcondensed": 18774, + "nr": 18775, + "ĠVA": 18776, + "had": 18777, + "Ġking": 18778, + "oble": 18779, + "Ġexisted": 18780, + "Ġthesis": 18781, + "ubbard": 18782, + "apoptotic": 18783, + "Ġflowering": 18784, + "ĠAdaptation": 18785, + "ĠKalman": 18786, + "trl": 18787, + "Ġment": 18788, + "utation": 18789, + "ĠConv": 18790, + "Ġhistories": 18791, + "Ġenanti": 18792, + "nell": 18793, + "onian": 18794, + "ĠFabric": 18795, + "Ġxx": 18796, + "Ġfell": 18797, + "Ġcytosolic": 18798, + "Ġmud": 18799, + "Ġsuspensions": 18800, + "ĠMicrobial": 18801, + "measured": 18802, + "Ġdownload": 18803, + "Ġinvalid": 18804, + "Ġcapturing": 18805, + "ĠHH": 18806, + "ĠGray": 18807, + "ĠAZ": 18808, + "ĠNash": 18809, + "viation": 18810, + "naire": 18811, + "ortium": 18812, + "ynch": 18813, + "aminergic": 18814, + "Ġwait": 18815, + "Schem": 18816, + "trace": 18817, + "ĠVill": 18818, + "Ġpools": 18819, + "Ġhypoxic": 18820, + "xp": 18821, + "Ġshaded": 18822, + "ORY": 18823, + "turn": 18824, + "interacting": 18825, + "Ġdestroyed": 18826, + "akh": 18827, + "ĠCpG": 18828, + "dotted": 18829, + "ĠTranscript": 18830, + "planar": 18831, + "Ġpreclinical": 18832, + "ĠRepro": 18833, + "ĠSurgery": 18834, + "Stokes": 18835, + "ifdef": 18836, + "Ġdiscriminate": 18837, + "ĠGross": 18838, + "Ġflags": 18839, + "iety": 18840, + "ummy": 18841, + "Ġtransfers": 18842, + "SG": 18843, + "ĠSci": 18844, + "Ġheader": 18845, + "ĠFunding": 18846, + "Ġdetrim": 18847, + "Ġinstabilities": 18848, + "ĠPhylogenetic": 18849, + "ymethyl": 18850, + "ĠAssessing": 18851, + "ROC": 18852, + "elsen": 18853, + "Equal": 18854, + "Ġcas": 18855, + "Ġvertically": 18856, + "Ġvisibility": 18857, + "ĠFTIR": 18858, + "scrib": 18859, + "Ġbursts": 18860, + "ĠDoug": 18861, + "ĠFrancisco": 18862, + "ĠMSC": 18863, + "Ġpredis": 18864, + "established": 18865, + "Ġfaced": 18866, + "ĠWI": 18867, + "Sl": 18868, + "Ġcharts": 18869, + "orthy": 18870, + "izontal": 18871, + "ialysis": 18872, + "Ġtunable": 18873, + "Ġexplosion": 18874, + "Sw": 18875, + "TNF": 18876, + "Ġdiscontinuous": 18877, + "ecture": 18878, + "ciences": 18879, + "mathbbm": 18880, + "look": 18881, + "Ġtachy": 18882, + "Ġbrow": 18883, + "observed": 18884, + "Ġanaest": 18885, + "Sal": 18886, + "qPCR": 18887, + "Ġsees": 18888, + "Ġspacecraft": 18889, + "Ġsales": 18890, + "ĠTrac": 18891, + "Tem": 18892, + "ivest": 18893, + "ĠFc": 18894, + "ĠNews": 18895, + "Ġharvesting": 18896, + "ĠEG": 18897, + "pad": 18898, + "Ġnanowires": 18899, + "Ġpotato": 18900, + "pliers": 18901, + "onin": 18902, + "Ġworm": 18903, + "sue": 18904, + "tie": 18905, + "Ġmasks": 18906, + "Ġthrow": 18907, + "!!": 18908, + "behavi": 18909, + "Ġpine": 18910, + "ogy": 18911, + "TEST": 18912, + "onto": 18913, + "Ġcreatinine": 18914, + "ĠBoston": 18915, + "Ġchair": 18916, + "ploys": 18917, + "oven": 18918, + "Ġentrance": 18919, + "Ġcoch": 18920, + "Ġdyes": 18921, + "Tor": 18922, + "ĠPDE": 18923, + "underset": 18924, + "atasets": 18925, + "Ġternary": 18926, + "choose": 18927, + "five": 18928, + "chloride": 18929, + "onium": 18930, + "Property": 18931, + "Ġtu": 18932, + "Ġadequately": 18933, + "romycin": 18934, + "Ġcooper": 18935, + "ïĽľ": 18936, + "Ġpapill": 18937, + "ĠStreptococcus": 18938, + "ĠCY": 18939, + "Ġgrouping": 18940, + "Ġbioc": 18941, + "ĠCardiac": 18942, + "ĠBook": 18943, + "reference": 18944, + "Ġconfirmation": 18945, + "ivery": 18946, + "Ġwarning": 18947, + "pretation": 18948, + "Ġlove": 18949, + "Ġoscillators": 18950, + "sed": 18951, + "ĠTX": 18952, + "ilent": 18953, + "ĠVas": 18954, + "Ġclamp": 18955, + "Ġahead": 18956, + "acs": 18957, + "Ġdepleted": 18958, + "Ġmethodologies": 18959, + "may": 18960, + "Ġcaffe": 18961, + "Ġsequentially": 18962, + "osacchar": 18963, + "Ġcomprise": 18964, + "Ġchel": 18965, + "Ġinacc": 18966, + "Ġtendon": 18967, + "Sequ": 18968, + "ought": 18969, + "server": 18970, + "ĠPerturb": 18971, + "Ġterrain": 18972, + "curve": 18973, + "ĠArgent": 18974, + "TABLE": 18975, + "Ġimplicitly": 18976, + "Ġenjoy": 18977, + "ĠSitter": 18978, + "Ġmicron": 18979, + "ĠEvans": 18980, + "nsylvan": 18981, + "Ġlooked": 18982, + "spe": 18983, + "volving": 18984, + "ĠLSTM": 18985, + "agnetism": 18986, + "ĠNotch": 18987, + "ĠTal": 18988, + "ĠDEGs": 18989, + "leman": 18990, + "Ġboolean": 18991, + "Ġobey": 18992, + "organization": 18993, + "seen": 18994, + "ĠEnc": 18995, + "schild": 18996, + "ĠOntario": 18997, + "Element": 18998, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 18999, + "mouse": 19000, + "Ġpolyethylene": 19001, + "Ġacetic": 19002, + "sections": 19003, + "uronal": 19004, + "ĠDick": 19005, + "Ġkill": 19006, + "Ġbroadening": 19007, + "Ġfluoride": 19008, + "Ġsaved": 19009, + "Ġdeem": 19010, + "Stream": 19011, + "aced": 19012, + "ĠJeff": 19013, + "QA": 19014, + "Ġscalable": 19015, + "ĠFif": 19016, + "ĠMini": 19017, + "Ġsupergravity": 19018, + "Ġcolloidal": 19019, + "LY": 19020, + "OA": 19021, + "Ġperic": 19022, + "Ġshortly": 19023, + "Ġvap": 19024, + "Ġsplits": 19025, + "move": 19026, + "Ġstimulating": 19027, + "ĠBeijing": 19028, + "Ġpyr": 19029, + "ÏŃ": 19030, + "Ġlexical": 19031, + "âĢł": 19032, + "ÅĦ": 19033, + "itories": 19034, + "olerance": 19035, + "Ġinsulator": 19036, + "ĠLeon": 19037, + "Ġpropagate": 19038, + "ĠElements": 19039, + "yen": 19040, + "Module": 19041, + "ĠWhether": 19042, + "Ġaph": 19043, + "ĠLaure": 19044, + "ĠMutations": 19045, + "Ġhypertrophy": 19046, + "Ġoceanic": 19047, + "ographically": 19048, + "patients": 19049, + "ĠAngeles": 19050, + "Ġphe": 19051, + "Ġsquee": 19052, + "Ġcaroten": 19053, + "fine": 19054, + "Ġsketch": 19055, + "Ġansatz": 19056, + "titution": 19057, + "ĠFus": 19058, + "ĠSug": 19059, + "obacterial": 19060, + "Ħĥ": 19061, + "Related": 19062, + "Ġartist": 19063, + "Ġacryl": 19064, + "lined": 19065, + "rafted": 19066, + "ĠQoS": 19067, + "ĠFeng": 19068, + "search": 19069, + "Ġnanotube": 19070, + "ĠVM": 19071, + "ahl": 19072, + "Ġstride": 19073, + "ĠTag": 19074, + "ĠLar": 19075, + "Ġdesorption": 19076, + "dtype": 19077, + "Ġbug": 19078, + "Ġcaregivers": 19079, + "ĠHun": 19080, + "ĠPractical": 19081, + "Ġoblig": 19082, + "rer": 19083, + "ĠKang": 19084, + "ĠProducts": 19085, + "ometh": 19086, + "ĠHeLa": 19087, + "Ġlaboratories": 19088, + "natural": 19089, + "Ġful": 19090, + "Ġmold": 19091, + "abine": 19092, + "ĠSpring": 19093, + "Ġcobal": 19094, + "Ġhighlighting": 19095, + "ĠPref": 19096, + "cyclic": 19097, + "ĠCONCLUSION": 19098, + "ĠSources": 19099, + "Ġapex": 19100, + "parser": 19101, + "ĠLogic": 19102, + "Ġpond": 19103, + "Ġtold": 19104, + "ĠShap": 19105, + "pergillus": 19106, + "Ġsaying": 19107, + "Ġmutagenesis": 19108, + "ĠmmHg": 19109, + "ĠPAN": 19110, + "Ġsmokers": 19111, + "oday": 19112, + "Ġherein": 19113, + "CMV": 19114, + "ĠPW": 19115, + "Ġredshifts": 19116, + "ĠMinim": 19117, + "yman": 19118, + "ulli": 19119, + "dense": 19120, + "Ġarsenic": 19121, + "ĠEMT": 19122, + "ogaster": 19123, + "carboxylate": 19124, + "sys": 19125, + "Ro": 19126, + "anch": 19127, + "ĠAlpha": 19128, + "ĠTechnical": 19129, + "sv": 19130, + "Ġbones": 19131, + "Ġacceptor": 19132, + "Ġnewborn": 19133, + "private": 19134, + "Ġnanor": 19135, + "ĠSwiss": 19136, + "around": 19137, + "Ġsyntax": 19138, + "ĠKähler": 19139, + "Ġaerial": 19140, + "ĠPale": 19141, + "typedef": 19142, + "namespace": 19143, + "Ġconfounding": 19144, + "viÄĩ": 19145, + "Ġretard": 19146, + "Ġzeta": 19147, + "ĠTum": 19148, + "isch": 19149, + "Ġsulfide": 19150, + "ĠTian": 19151, + "uy": 19152, + "Ġintuition": 19153, + "Ġphospholip": 19154, + "ĠSher": 19155, + "ricts": 19156, + "----------------------------------------------------------------": 19157, + "okines": 19158, + "glucose": 19159, + "toler": 19160, + "iferative": 19161, + "ĠFluor": 19162, + "Ġencourage": 19163, + "Ġresponsive": 19164, + "perturbative": 19165, + "Ġsaddle": 19166, + "lers": 19167, + "ndez": 19168, + "ĠZero": 19169, + "ĠDiet": 19170, + "Ġdevelopers": 19171, + "Syn": 19172, + "Ġconfer": 19173, + "Ġoriginate": 19174, + "ropol": 19175, + "haw": 19176, + "letion": 19177, + "mskip": 19178, + "Ġber": 19179, + "Ġpeat": 19180, + "vially": 19181, + "Ġgranules": 19182, + "ĠÌĥ": 19183, + "Ġpluripot": 19184, + "Ġassimilation": 19185, + "Ġdenominator": 19186, + "abilization": 19187, + "ĠEpidemiology": 19188, + "MIN": 19189, + "eeds": 19190, + "ĠVR": 19191, + "Eval": 19192, + "store": 19193, + "ĠBaseline": 19194, + "Ġcu": 19195, + "ĠSpectra": 19196, + "Ġfractionation": 19197, + "Ġplacing": 19198, + "Ġburied": 19199, + "eleration": 19200, + "Ġalkali": 19201, + "ĠIU": 19202, + "Calc": 19203, + "weak": 19204, + "Ġmorphisms": 19205, + "Ġligase": 19206, + "Ġfs": 19207, + "Ġutilizes": 19208, + "Comput": 19209, + "â": 19210, + "Ġstig": 19211, + "relative": 19212, + "Ġimmature": 19213, + "ĠFrac": 19214, + "api": 19215, + "Ġoutpatient": 19216, + "Ġachievement": 19217, + "Ġstacking": 19218, + "Ġnodules": 19219, + "IND": 19220, + "ĠGPa": 19221, + "Ġpercolation": 19222, + "mspace": 19223, + "Ġbrains": 19224, + "uffle": 19225, + "entropy": 19226, + "Lab": 19227, + "Ġstabilize": 19228, + "ĠRicci": 19229, + "ĠAntimicrobial": 19230, + "personal": 19231, + "Ġfarms": 19232, + "ĠPin": 19233, + "Ġporcine": 19234, + "Ġoccasionally": 19235, + "whe": 19236, + "Ġundergoes": 19237, + "Ġregimens": 19238, + "Ġblade": 19239, + "Ġlinearized": 19240, + "Ġdecon": 19241, + "Ġpacked": 19242, + "Ġfishes": 19243, + "ĠMend": 19244, + "Ġapproaching": 19245, + "Ġballs": 19246, + "Ġproinflammatory": 19247, + "imeric": 19248, + "ĠDirector": 19249, + "Ġsoliton": 19250, + "Ġmosaic": 19251, + "viet": 19252, + "Mean": 19253, + "ĠPad": 19254, + "Ġtriplicate": 19255, + "supported": 19256, + "Ġcart": 19257, + "<<<<": 19258, + "Ġremission": 19259, + "aseous": 19260, + "asticity": 19261, + "ĠMik": 19262, + "ĠStrategy": 19263, + "ramer": 19264, + "ĠPolish": 19265, + "Ġenthal": 19266, + "Ġheterozygous": 19267, + "ĠGravity": 19268, + "Ax": 19269, + "Ġorganizational": 19270, + "Ġmovie": 19271, + "Ġexploratory": 19272, + "WLED": 19273, + "Ġmoiety": 19274, + "decre": 19275, + "ĠStill": 19276, + "Ġ¡": 19277, + "Ġgreenhouse": 19278, + "Ġsuperconductors": 19279, + "enum": 19280, + "elin": 19281, + "Ġoffering": 19282, + "stad": 19283, + "ĠTrich": 19284, + "Ġrepl": 19285, + "Ġrecycling": 19286, + "phor": 19287, + "Ġinelastic": 19288, + "ockey": 19289, + "ĠâĢĻ": 19290, + "Ġsequel": 19291, + "EB": 19292, + "ĠChile": 19293, + "Ġfibrillation": 19294, + "Ġdisulfide": 19295, + "obtained": 19296, + "ubin": 19297, + "Ĥ¬": 19298, + "Ġfacilitating": 19299, + "Ġhopping": 19300, + "Ġmediator": 19301, + "Ġhydration": 19302, + "Ġsparsity": 19303, + "Ġsati": 19304, + "Ġisothermal": 19305, + "Ġreturning": 19306, + "Ġtraveling": 19307, + "Ġing": 19308, + "Ġstent": 19309, + "Ġcapacitor": 19310, + "Ġcompromise": 19311, + "ĠSud": 19312, + "ĠVision": 19313, + "Ġtopologies": 19314, + "opolysaccharide": 19315, + "ĠProfile": 19316, + "ĠRing": 19317, + "Ġdiscrepancies": 19318, + "Dis": 19319, + "ARD": 19320, + "cccc": 19321, + "Ġdirectory": 19322, + "ĠCMOS": 19323, + "owed": 19324, + "illo": 19325, + "ĠInsights": 19326, + "ĠTib": 19327, + "Ġaband": 19328, + "arose": 19329, + "Order": 19330, + "Ġ¬": 19331, + "Ġintracranial": 19332, + "Ġintermediates": 19333, + "Ġhabits": 19334, + "Ġcarp": 19335, + "property": 19336, + "IMAGE": 19337, + "ĠUk": 19338, + "Ġhydrophilic": 19339, + "Wid": 19340, + "Ġabiotic": 19341, + "Ġobservers": 19342, + "Ġchor": 19343, + "ĠConservation": 19344, + "ĠEnhance": 19345, + "ĠAutomated": 19346, + "ĠGlut": 19347, + "iratory": 19348, + "Ġspaw": 19349, + "ĠEfficiency": 19350, + "vast": 19351, + "initi": 19352, + "Ġoptional": 19353, + "ĠScaling": 19354, + "ifold": 19355, + "ĠmtDNA": 19356, + "ĠReconstruction": 19357, + "Ġcountable": 19358, + "ĠGrass": 19359, + "Den": 19360, + "ĠChain": 19361, + "enzyme": 19362, + "Ġwaveforms": 19363, + "Ġpancreas": 19364, + "ĠDetailed": 19365, + "cmd": 19366, + "Ġâİľ": 19367, + "Ġmagneto": 19368, + "ĠFPGA": 19369, + "Ġabsolutely": 19370, + "Ġstimulates": 19371, + "achus": 19372, + "ĠArn": 19373, + "message": 19374, + "ocompatibility": 19375, + "HCl": 19376, + "ĠFish": 19377, + "Ġphenomenological": 19378, + "Ġsalivary": 19379, + "ondo": 19380, + "Ġnotions": 19381, + "fur": 19382, + "UCT": 19383, + "Ġwww": 19384, + "abet": 19385, + "ĠSulf": 19386, + "Fil": 19387, + "dominated": 19388, + "arser": 19389, + "Ġpackages": 19390, + "Ġsplice": 19391, + "Flo": 19392, + "NOWLED": 19393, + "xa": 19394, + "ĠYuan": 19395, + "Ġacetone": 19396, + "ĠVitamin": 19397, + "ĠÎŀ": 19398, + "Ġobsc": 19399, + "Ġchaper": 19400, + "Ġmort": 19401, + "MAN": 19402, + "Ġsubtilis": 19403, + "Ġoptimality": 19404, + "Ġcontinuing": 19405, + "Ġduplication": 19406, + "Ġmultiplying": 19407, + "Ġimmunological": 19408, + "Ġcirrhosis": 19409, + "hospital": 19410, + "ĠProbabilistic": 19411, + "Ġdeletions": 19412, + "Ġcaution": 19413, + "Ġowner": 19414, + "oxorubicin": 19415, + "Ġlaunch": 19416, + "Ġcure": 19417, + "thus": 19418, + "ĠHermitian": 19419, + "canonical": 19420, + "Ġimmunore": 19421, + "formin": 19422, + "Ġbroadband": 19423, + "partum": 19424, + "ophe": 19425, + "ĠBeta": 19426, + "ĠBI": 19427, + "Ġïĺº": 19428, + "Ġjumps": 19429, + "Ġparadox": 19430, + "umped": 19431, + "Ġdoctors": 19432, + "Ġhospitalized": 19433, + "Ġwash": 19434, + "precision": 19435, + "Ġruled": 19436, + "Ġduplicate": 19437, + "ante": 19438, + "Ġneurotrans": 19439, + "Ġïĥ§": 19440, + "Ġtheme": 19441, + "Taking": 19442, + "ĠPlants": 19443, + "following": 19444, + "Ġageing": 19445, + "Ġcongestion": 19446, + "osarcoma": 19447, + "Ġrepository": 19448, + "ĠHess": 19449, + "ĠCatalytic": 19450, + "ĠDV": 19451, + "INK": 19452, + "priv": 19453, + "ĠAna": 19454, + "ĠSLE": 19455, + "ĠThailand": 19456, + "íķ": 19457, + "Ġduty": 19458, + "locations": 19459, + "oter": 19460, + "Ġlysine": 19461, + "Ġindist": 19462, + "Ġagonists": 19463, + "Ack": 19464, + "Ġminimally": 19465, + "Ġetching": 19466, + "ugging": 19467, + "cuda": 19468, + "ndef": 19469, + "Ġreferring": 19470, + "Ġlysates": 19471, + "Ġserotonin": 19472, + "cribing": 19473, + "ĠInterface": 19474, + "dV": 19475, + "Ġdurations": 19476, + "Ġphotod": 19477, + "Ġdating": 19478, + "Ġirreversible": 19479, + "osidase": 19480, + "ĠFROM": 19481, + "within": 19482, + "SNR": 19483, + "Ġarrhyth": 19484, + "ĠRatio": 19485, + "ĠThin": 19486, + "centered": 19487, + "Ġshocks": 19488, + "ĠVers": 19489, + "Ġnoticeable": 19490, + "Ġfoci": 19491, + "Ġorthonormal": 19492, + "ĠâİŁ": 19493, + "Ġluminescence": 19494, + "ĠSUSY": 19495, + "internal": 19496, + "ĠTour": 19497, + "Ġabbrevi": 19498, + "ĠMAL": 19499, + "vertex": 19500, + "Ġemploys": 19501, + "INS": 19502, + "Ġimmunohistochemistry": 19503, + "Ġheparin": 19504, + "Ġidiopathic": 19505, + "Ġimmobilized": 19506, + "ishe": 19507, + "phth": 19508, + "thin": 19509, + "ĠStorage": 19510, + "Ġperovskite": 19511, + "Prot": 19512, + "ĠDepending": 19513, + "Ġblends": 19514, + "Ġpredator": 19515, + "Ġdisplaying": 19516, + "Ġvesicle": 19517, + "ĠKra": 19518, + "Ġlane": 19519, + "Ġmultilayer": 19520, + "Ġhomozygous": 19521, + "cosh": 19522, + "Ġsuperficial": 19523, + "Ġil": 19524, + "ĠKR": 19525, + "ĠBrun": 19526, + "ĠEW": 19527, + "opa": 19528, + "ĠCartesian": 19529, + "ĠCytoplas": 19530, + "ĠPennsylvan": 19531, + "bands": 19532, + "Ġangiotensin": 19533, + "ĠLattice": 19534, + "GI": 19535, + "jee": 19536, + "Ġenlarged": 19537, + "enius": 19538, + "ĠIa": 19539, + "oux": 19540, + "Ġgent": 19541, + "Ġcarbonyl": 19542, + "chers": 19543, + "Ġhypothe": 19544, + "Ġmicrosp": 19545, + "Ġaffective": 19546, + "Ġaxons": 19547, + "ei": 19548, + "yptoph": 19549, + "ĠJon": 19550, + "queue": 19551, + "ĠGauge": 19552, + "menopausal": 19553, + "ĠDas": 19554, + "ĠEssential": 19555, + "ĠFault": 19556, + "ĠBil": 19557, + "Ġtestosterone": 19558, + "Ġchambers": 19559, + "dione": 19560, + "Ġelicited": 19561, + "IGN": 19562, + "Ġantioxidants": 19563, + "populations": 19564, + "Ġovary": 19565, + "Ġâĸ": 19566, + "Ġabstraction": 19567, + "Ġhydrocarbons": 19568, + "Ġrectal": 19569, + "Ġtriggering": 19570, + "Ġthoroughly": 19571, + "Run": 19572, + "acteria": 19573, + "information": 19574, + "ĠBed": 19575, + "Ġquenc": 19576, + "Ġunders": 19577, + "ĠScotland": 19578, + "Ġrevolution": 19579, + "Ġpituitary": 19580, + "Ġanthropogenic": 19581, + "focus": 19582, + "Ġmethan": 19583, + "Ġinflow": 19584, + "Ġdeflection": 19585, + "ĠCape": 19586, + "Ġmultidimensional": 19587, + "Ġarrived": 19588, + "ĠSpar": 19589, + "dv": 19590, + "Ġcows": 19591, + "ĠBh": 19592, + "Ġjk": 19593, + "tolyl": 19594, + "Ġeigenstates": 19595, + "Ġpreprocessing": 19596, + "ĠRain": 19597, + "ä¸": 19598, + "inz": 19599, + "Ġmn": 19600, + "REE": 19601, + "atrick": 19602, + "Dev": 19603, + "Ġfulfilled": 19604, + "Ġartic": 19605, + "Ġrealizations": 19606, + "ĠComponent": 19607, + "ĠWS": 19608, + "Ġinfo": 19609, + "printed": 19610, + "atosis": 19611, + "cache": 19612, + "anov": 19613, + "ĠTg": 19614, + "content": 19615, + "junc": 19616, + "ĠCDK": 19617, + "Ġbehaves": 19618, + "ĠKid": 19619, + "difference": 19620, + "ĠPs": 19621, + "ĠUg": 19622, + "Ġstructurally": 19623, + "erebral": 19624, + "ĠSurve": 19625, + "heal": 19626, + "onite": 19627, + "Ġdeleted": 19628, + "itim": 19629, + "Star": 19630, + "ĠSpeech": 19631, + "ĠAstr": 19632, + "gradient": 19633, + "Ġfellow": 19634, + "Ġsyring": 19635, + "NB": 19636, + "ĠNB": 19637, + "Ġcreep": 19638, + "Ġlogging": 19639, + "Ġinten": 19640, + "scalar": 19641, + "ĠAtmospheric": 19642, + "Ġlupus": 19643, + "Ġidentically": 19644, + "processed": 19645, + "signal": 19646, + "ĠClostr": 19647, + "ancers": 19648, + "Ġdb": 19649, + "Ġsubsystem": 19650, + "situ": 19651, + "Ġferroelectric": 19652, + "ĠïĽľ": 19653, + "Ġore": 19654, + "ĠRb": 19655, + "ĠMicrosoft": 19656, + "ĠCoch": 19657, + "ĠActin": 19658, + "Ġnerves": 19659, + "Ġexpertise": 19660, + "otive": 19661, + "ĠPoincaré": 19662, + "ĠRig": 19663, + "Ġpsychosocial": 19664, + "Ġprogenitors": 19665, + "ĠMyr": 19666, + "ĠHug": 19667, + "Ġbiogenesis": 19668, + "Ġincorporates": 19669, + "Ġnevertheless": 19670, + "ĠDecl": 19671, + "observ": 19672, + "Ġmultiplier": 19673, + "Ġresponding": 19674, + "hoff": 19675, + "Ġimpacted": 19676, + "Ġsyndromes": 19677, + "kel": 19678, + "ĠSynt": 19679, + "ĠConcer": 19680, + "ĠAmericans": 19681, + "Ġspaced": 19682, + "umption": 19683, + "ĠThompson": 19684, + "ĠJacobian": 19685, + "Tra": 19686, + "evolution": 19687, + "Ġdidn": 19688, + "Ġpercentile": 19689, + "Ġlid": 19690, + "equivalent": 19691, + "Ġantico": 19692, + "Ġmultiply": 19693, + "Ġpenicillin": 19694, + "Ġresponsiveness": 19695, + "Ġrunoff": 19696, + "alanine": 19697, + "squares": 19698, + "ĠInsulin": 19699, + "rele": 19700, + "ĠLif": 19701, + "ĠMinkowski": 19702, + "Ġblend": 19703, + "ĠPand": 19704, + "Ġtwelve": 19705, + "Ġhybrids": 19706, + "Ġbass": 19707, + "interaction": 19708, + "ĠBangladesh": 19709, + "Ġopens": 19710, + "ĠArts": 19711, + "Ġconcave": 19712, + "Ġpedest": 19713, + "Ġfist": 19714, + "ĠAdults": 19715, + "openia": 19716, + "ENCE": 19717, + "ĠFusion": 19718, + "Ġmicroc": 19719, + "ĠSurgical": 19720, + "ylate": 19721, + "Ġpackaging": 19722, + "OCK": 19723, + "QC": 19724, + "Tri": 19725, + "scan": 19726, + "Ġregards": 19727, + "Ġdiscriminant": 19728, + "Ġindustries": 19729, + "icus": 19730, + "ĠWalker": 19731, + "Ġpeers": 19732, + "synt": 19733, + "Ġhorse": 19734, + "Ġflowing": 19735, + "urred": 19736, + "ĠCRP": 19737, + "ĠCareer": 19738, + "iffiffiffiffiffiffiffiff": 19739, + "ĠMSE": 19740, + "hana": 19741, + "ĠMortality": 19742, + "Ġtumorigenesis": 19743, + "ĠIslam": 19744, + "Ġazimuthal": 19745, + "wen": 19746, + "Ġsys": 19747, + "azin": 19748, + "neighbor": 19749, + "Config": 19750, + "they": 19751, + "Ġsorption": 19752, + "Ġspanned": 19753, + "Ġviewpoint": 19754, + "MOD": 19755, + "Ġthrust": 19756, + "uplex": 19757, + "Ġhistograms": 19758, + "Ġprogrammed": 19759, + "Ġethics": 19760, + "ectable": 19761, + "representation": 19762, + "umns": 19763, + "Ġstreet": 19764, + "ĠSobolev": 19765, + "Ġexcision": 19766, + "ĠRud": 19767, + "quires": 19768, + "Ġowned": 19769, + "Ġthousand": 19770, + "Ġantagonists": 19771, + "UST": 19772, + "Ġdrastically": 19773, + "ĠóµĦ©": 19774, + "ĠDor": 19775, + "ĠMOS": 19776, + "pn": 19777, + "ĠDecre": 19778, + "Dep": 19779, + "Ġsintering": 19780, + "Ġpurple": 19781, + "ethanol": 19782, + "Ġhydrocarbon": 19783, + "ĠFO": 19784, + "leftrightarrow": 19785, + "Ġimmunofluorescence": 19786, + "ĠOM": 19787, + "Ġmaturity": 19788, + "Ġearthquakes": 19789, + "Ġaxon": 19790, + "Ġprobed": 19791, + "ORD": 19792, + "ĠADP": 19793, + "sg": 19794, + "omere": 19795, + "Ġtranscribed": 19796, + "Mar": 19797, + "ĠUtil": 19798, + "ĠIA": 19799, + "Ġcompiled": 19800, + "Ġsupervision": 19801, + "ĠXen": 19802, + "ĠJur": 19803, + "compar": 19804, + "Ġhypertensive": 19805, + "ilized": 19806, + "rae": 19807, + "Conclusion": 19808, + "'''": 19809, + "Double": 19810, + "ĠFas": 19811, + "Ġinsectic": 19812, + "ĠPrem": 19813, + "Pri": 19814, + "ĠCao": 19815, + "ĠQuestionnaire": 19816, + "Ġgathered": 19817, + "GW": 19818, + "ĠNV": 19819, + "ĠLactobacillus": 19820, + "Ġcyclin": 19821, + "Ġreject": 19822, + "Ġskull": 19823, + "Ġaw": 19824, + "ĠCold": 19825, + "Ġmesons": 19826, + "bd": 19827, + "Ġdetrimental": 19828, + "apore": 19829, + "nowled": 19830, + "ĠCXCL": 19831, + "Ġspikes": 19832, + "Ġtent": 19833, + "ĠLength": 19834, + "Ġdoor": 19835, + "Ġflour": 19836, + "ustration": 19837, + "Health": 19838, + "Ġtransparency": 19839, + "Ġdisrupted": 19840, + "Hy": 19841, + "overl": 19842, + "ĠReinforcement": 19843, + "ceptors": 19844, + "ĠKos": 19845, + "retroviral": 19846, + "ĠINT": 19847, + "ĠSor": 19848, + "Ġadopting": 19849, + "Ġendoplasmic": 19850, + "Ġsuit": 19851, + "Ġopioid": 19852, + "Ġintegrin": 19853, + "away": 19854, + "Ġtailored": 19855, + "ĠSoc": 19856, + "Ġquies": 19857, + "Ġhusband": 19858, + "Ġumb": 19859, + "ĠCai": 19860, + "ĠAspergillus": 19861, + "ĠGaN": 19862, + "Ġdistinguishing": 19863, + "Ġextrapolation": 19864, + "Ġcage": 19865, + "Ġscavenging": 19866, + "KF": 19867, + "Tree": 19868, + "ĠConflict": 19869, + "UNC": 19870, + "Ġmanganese": 19871, + "days": 19872, + "ÃŁ": 19873, + "ĠLive": 19874, + "sd": 19875, + "ractor": 19876, + "Ġlute": 19877, + "Ġdissimilar": 19878, + "Ġib": 19879, + "ĠVeg": 19880, + "Ġoccurrences": 19881, + "Ġbinomial": 19882, + "Scheme": 19883, + "Ġtape": 19884, + "ĠCant": 19885, + "Ġelectrosp": 19886, + "Cd": 19887, + "made": 19888, + "Ġsevent": 19889, + "shared": 19890, + "Ġaccession": 19891, + "orp": 19892, + "DATA": 19893, + "leted": 19894, + "Vari": 19895, + "Ġrose": 19896, + "tagged": 19897, + "ĠAth": 19898, + "Ġeddy": 19899, + "estone": 19900, + "Ġesters": 19901, + "Ġtyping": 19902, + "ĠStudents": 19903, + "yi": 19904, + "oresistance": 19905, + "inois": 19906, + "Ġglucocortic": 19907, + "iosis": 19908, + "Ġcoronal": 19909, + "Ġsheath": 19910, + "ĠTrack": 19911, + "Ġequilibria": 19912, + "amming": 19913, + "Ġpione": 19914, + "Ġsciences": 19915, + "Ġsuppressing": 19916, + "Ġdeco": 19917, + "ifndef": 19918, + "His": 19919, + "Ġpellet": 19920, + "Linear": 19921, + "orbent": 19922, + "Ġflatten": 19923, + "Ġstraw": 19924, + "Ġalbeit": 19925, + "ĠPredictive": 19926, + "Ġgaze": 19927, + "Ġhydroly": 19928, + "uther": 19929, + "oders": 19930, + "Ġflap": 19931, + "Ġsimplicial": 19932, + "System": 19933, + "Ġstressed": 19934, + "Ġimmunoglobulin": 19935, + "ilia": 19936, + "Ġconsuming": 19937, + "Ġé": 19938, + "galact": 19939, + "Ġadulthood": 19940, + "Ġvorticity": 19941, + "yclic": 19942, + "ovoltaic": 19943, + "ivestock": 19944, + "Ġbeds": 19945, + "ĠPlanning": 19946, + "Ġparameterized": 19947, + "Ġghost": 19948, + "maximum": 19949, + "Ġsuperim": 19950, + "Ġphysicochemical": 19951, + "gp": 19952, + "ongue": 19953, + "Ġprimordial": 19954, + "xff": 19955, + "insula": 19956, + "Mc": 19957, + "Ġminimizes": 19958, + "ĠGravitational": 19959, + "osoma": 19960, + "ignificant": 19961, + "Ġelucidated": 19962, + "Ġsubsurface": 19963, + "significant": 19964, + "Ġrelatives": 19965, + "ferroni": 19966, + "transf": 19967, + "Ġtails": 19968, + "beck": 19969, + "omagnetic": 19970, + "Ġunnecessary": 19971, + "Ġmonomial": 19972, + "delay": 19973, + "Ġsta": 19974, + "ĠSuz": 19975, + "Ġaltering": 19976, + "LOG": 19977, + "ĠLac": 19978, + "Ġranks": 19979, + "hw": 19980, + "ĠNep": 19981, + "Ġneuropath": 19982, + "ĠCompe": 19983, + "Gr": 19984, + "Pati": 19985, + "reduce": 19986, + "ĠMalaysia": 19987, + "ceral": 19988, + "Ġmicrobes": 19989, + "Ġlensing": 19990, + "ĠCalcium": 19991, + "ĠDetermin": 19992, + "ĠCosta": 19993, + "Ġkeeps": 19994, + "printing": 19995, + "ĉĉĉĉĉĉ": 19996, + "chin": 19997, + "exposed": 19998, + "Ġperiodically": 19999, + "Ġrender": 20000, + "ĠCardiovascular": 20001, + "entin": 20002, + "Ġbioavailability": 20003, + "Ġinterpretations": 20004, + "ĠCU": 20005, + "Ġnegoti": 20006, + "Ġantim": 20007, + "Ġdeemed": 20008, + "Ġae": 20009, + "Ġhalos": 20010, + "ĠMichigan": 20011, + "Ġosteoarthritis": 20012, + "diag": 20013, + "ĠBeng": 20014, + "Ġmetagen": 20015, + "Ġparameterization": 20016, + "diagn": 20017, + "ĠMatching": 20018, + "Ġcatalysis": 20019, + "uts": 20020, + "Ġdissemination": 20021, + "Ġoutlet": 20022, + "ĠMoon": 20023, + "ĠGST": 20024, + "sphere": 20025, + "Ġresearcher": 20026, + "ambiguation": 20027, + "Ġraises": 20028, + "Ġflavonoids": 20029, + "ĠMultivariate": 20030, + "Ġaccl": 20031, + "WI": 20032, + "Ġnu": 20033, + "Ġergodic": 20034, + "unique": 20035, + "atinib": 20036, + "Ġresolutions": 20037, + "Ġhouses": 20038, + "DEC": 20039, + "ighed": 20040, + "Ġsixth": 20041, + "Ġpolitician": 20042, + "apache": 20043, + "Ġsolute": 20044, + "Ġaugment": 20045, + "stress": 20046, + "HIV": 20047, + "ĠSets": 20048, + "Ġtransistors": 20049, + "qubit": 20050, + "amines": 20051, + "Ġfarmers": 20052, + "Ġnt": 20053, + "ĠLagrange": 20054, + "Ġvegetables": 20055, + "Ġpret": 20056, + "ĠSynthetic": 20057, + "Ġcones": 20058, + "Ġmedicines": 20059, + "Ġgenomics": 20060, + "Ġexperiencing": 20061, + "agland": 20062, + "Ġgenital": 20063, + "ĠObservatory": 20064, + "ĠSkin": 20065, + "ĠRosen": 20066, + "ĠBritain": 20067, + "genome": 20068, + "ĠEntropy": 20069, + "Ġrac": 20070, + "Go": 20071, + "Ġwalks": 20072, + "criptor": 20073, + "ĠBaker": 20074, + "oker": 20075, + "Ġpropensity": 20076, + "Ġpopularity": 20077, + "restricted": 20078, + "ĠBert": 20079, + "before": 20080, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 20081, + "auto": 20082, + "Rank": 20083, + "ĠRCT": 20084, + "Ġpocket": 20085, + "obut": 20086, + "Ġbenzene": 20087, + "ĠCNT": 20088, + "yptophan": 20089, + "allis": 20090, + "ĠResources": 20091, + "ĠBerlin": 20092, + "Ġscholar": 20093, + "glob": 20094, + "ĠSpeed": 20095, + "ĠXiao": 20096, + "biggl": 20097, + "ANCE": 20098, + "ĠPrime": 20099, + "Phys": 20100, + "idia": 20101, + "Ġmonoc": 20102, + "ĠCommunications": 20103, + "ĠPrecision": 20104, + "ĠPauli": 20105, + "Ġinvestigators": 20106, + "ĠLiang": 20107, + "Ġmeteorological": 20108, + "mog": 20109, + "reens": 20110, + "ubric": 20111, + "Ġrearrangement": 20112, + "orta": 20113, + "Elect": 20114, + "ĠTukey": 20115, + "ĠMis": 20116, + "Ġepiderm": 20117, + "ĠACKNOWLED": 20118, + "wart": 20119, + "Ġexciton": 20120, + "Ġassociative": 20121, + "styrene": 20122, + "Ġlosing": 20123, + "ĠOd": 20124, + "prep": 20125, + "essation": 20126, + "Ġattributable": 20127, + "ĠNavier": 20128, + "anz": 20129, + "Ġcorrectness": 20130, + "oints": 20131, + "ĠRather": 20132, + "Ġassemblies": 20133, + "Ġbridges": 20134, + "OSS": 20135, + "MET": 20136, + "Ġperm": 20137, + "Ġauthorities": 20138, + "Ġiodine": 20139, + "shire": 20140, + "interval": 20141, + "eptid": 20142, + "Ġpotency": 20143, + "Ġrenewable": 20144, + "vard": 20145, + "Ġsurjective": 20146, + "Ġsubsequence": 20147, + "ĠEVs": 20148, + "itching": 20149, + "Ġgenotyping": 20150, + "ĠAccurate": 20151, + "iophene": 20152, + "Gly": 20153, + "plified": 20154, + "ĠDistinct": 20155, + "ACH": 20156, + "Ġspeakers": 20157, + "holm": 20158, + "Ġpros": 20159, + "ĠDevice": 20160, + "mc": 20161, + "ĠDense": 20162, + "ĠVa": 20163, + "rison": 20164, + "Ġacyl": 20165, + "ĠPrincipal": 20166, + "ĠViral": 20167, + "Ġcosine": 20168, + "ĠResidual": 20169, + "Ġefflux": 20170, + "ĠSubjects": 20171, + "Ġrectangle": 20172, + "workers": 20173, + "Ġrotated": 20174, + "Ġbomb": 20175, + "ĠResolution": 20176, + "near": 20177, + "Ġ®": 20178, + "Ġestablishes": 20179, + "amed": 20180, + "Ġcompetence": 20181, + "Glu": 20182, + "ĠDend": 20183, + "ĠHsp": 20184, + "ensation": 20185, + "ĠLead": 20186, + "Ġlogger": 20187, + "sinh": 20188, + "Ġintellectual": 20189, + "former": 20190, + "Ce": 20191, + "Ġmonocyte": 20192, + "hores": 20193, + "Ġdiastolic": 20194, + "Ġlifespan": 20195, + "ĠSilva": 20196, + "arum": 20197, + "Ġtransducer": 20198, + "Ġoutgoing": 20199, + "entation": 20200, + "Ġabsorbing": 20201, + "itage": 20202, + "Ġsynthesize": 20203, + "Ġfeeling": 20204, + "asian": 20205, + "Ġceramics": 20206, + "iph": 20207, + "Ġnonlocal": 20208, + "Part": 20209, + "Ġimmersed": 20210, + "stationary": 20211, + "lecting": 20212, + "Ġwelding": 20213, + "Ġresembles": 20214, + "ĠKat": 20215, + "master": 20216, + "Ġintersect": 20217, + "ĠOlig": 20218, + "ĠTrends": 20219, + "agh": 20220, + "ĠNav": 20221, + "ĠTu": 20222, + "Ġepist": 20223, + "Ġclinics": 20224, + "Ġrepresentatives": 20225, + "Ġgrateful": 20226, + "GPIO": 20227, + "HH": 20228, + "Ġunambig": 20229, + "tuning": 20230, + "Ġnewsp": 20231, + "cohol": 20232, + "################################": 20233, + "%%%%%%%%": 20234, + "represented": 20235, + "ocic": 20236, + "ĠFuk": 20237, + "ĠSund": 20238, + "hasone": 20239, + "Mode": 20240, + "olone": 20241, + "ĠSb": 20242, + "Three": 20243, + "Link": 20244, + "cephal": 20245, + "ĠKap": 20246, + "Ġeliminating": 20247, + "Ġmelanogaster": 20248, + "âŁ": 20249, + "ĠBMD": 20250, + "ISE": 20251, + "ĠBattle": 20252, + "Ġshrinkage": 20253, + "ĠSeven": 20254, + "ĠGlass": 20255, + "romagn": 20256, + "Ġkl": 20257, + "ĠObviously": 20258, + "preserving": 20259, + "ĠPlatform": 20260, + "ĠÌĩ": 20261, + "omavirus": 20262, + "ĠEight": 20263, + "Ġallerg": 20264, + "ĠNanoparticles": 20265, + "aryl": 20266, + "Ġpriors": 20267, + "pattern": 20268, + "Ġlinearity": 20269, + "Ġtruly": 20270, + "Process": 20271, + "Ġdescending": 20272, + "ĠVictoria": 20273, + "cond": 20274, + "ĠICP": 20275, + "orescent": 20276, + "Ġauthority": 20277, + "Ġmock": 20278, + "igmoid": 20279, + "Ġcomorbidities": 20280, + "simple": 20281, + "Ġblo": 20282, + "ĠCompute": 20283, + "Ġgestation": 20284, + "achusetts": 20285, + "Ġphantom": 20286, + "ĠEdward": 20287, + "ĠFBS": 20288, + "factors": 20289, + "ĠEstimates": 20290, + "clear": 20291, + "WB": 20292, + "products": 20293, + "numpy": 20294, + "brief": 20295, + "Ġshop": 20296, + "ĠPoli": 20297, + "ĠRespiratory": 20298, + "Ġsurprisingly": 20299, + "Ġnanocomposite": 20300, + "dividual": 20301, + "Ġholographic": 20302, + "ygdala": 20303, + "roplasty": 20304, + "otactic": 20305, + "ĠPennsylvania": 20306, + "ĠScore": 20307, + "Obj": 20308, + "Ġstories": 20309, + "Ġmaximizing": 20310, + "Ġgelatin": 20311, + "rites": 20312, + "ĠTau": 20313, + "Ġtrypsin": 20314, + "Ġith": 20315, + "Ġfaint": 20316, + "Ġpriming": 20317, + "eworthy": 20318, + "ĠInverse": 20319, + "Ġknots": 20320, + "sharp": 20321, + "Ġtrains": 20322, + "Ġcredit": 20323, + "ĠBelow": 20324, + "pixel": 20325, + "Ġspindle": 20326, + "ĠPast": 20327, + "Ġenumerate": 20328, + "olateral": 20329, + "Ġattending": 20330, + "Ġquantized": 20331, + "Ġhaplotypes": 20332, + "encl": 20333, + "Ġwaven": 20334, + "Ġfurthermore": 20335, + "Ġchallenged": 20336, + "Ġmanufactured": 20337, + "ipheral": 20338, + "Ġinfinites": 20339, + "ĠRand": 20340, + "Ġstaging": 20341, + "agan": 20342, + "Ġperox": 20343, + "trifluor": 20344, + "ĠMcK": 20345, + "ĠFOX": 20346, + "ĠLank": 20347, + "ĠLuo": 20348, + "ĠAnth": 20349, + "ibrio": 20350, + "yel": 20351, + "ĠJi": 20352, + "ĠIO": 20353, + "ĠBridge": 20354, + "ĠRow": 20355, + "Ġcompensated": 20356, + "atsu": 20357, + "Ġhypothetical": 20358, + "Ġterminals": 20359, + "Ġcobalt": 20360, + "mers": 20361, + "ĠMang": 20362, + "NI": 20363, + "ĠRac": 20364, + "ALS": 20365, + "fen": 20366, + "ĠUb": 20367, + "Ġpredation": 20368, + "cadherin": 20369, + "ĠShanghai": 20370, + "Ġtries": 20371, + "Ġsport": 20372, + "acrylate": 20373, + "ĠAlgebraic": 20374, + "aints": 20375, + "Expr": 20376, + "Ġandrogen": 20377, + "Ġwedge": 20378, + "disp": 20379, + "Ġstirred": 20380, + "ĠAle": 20381, + "Ġcock": 20382, + "Four": 20383, + "Ġscanner": 20384, + "Ġplasmon": 20385, + "ĠGender": 20386, + "ĠRecord": 20387, + "ĠInjury": 20388, + "oblastic": 20389, + "ĠFluorescence": 20390, + "Ġantidepress": 20391, + "Ġdefinitive": 20392, + "Ġrepression": 20393, + "ordinates": 20394, + "Ġangiography": 20395, + "ĠHelical": 20396, + "Ġcancellation": 20397, + "release": 20398, + "Ġrelational": 20399, + "ĠAndre": 20400, + "molecule": 20401, + "Ġshaping": 20402, + "ĠDenmark": 20403, + "ĠALS": 20404, + "ĠNW": 20405, + "overrightarrow": 20406, + "Ġcombat": 20407, + "boxes": 20408, + "subject": 20409, + "Ġnanoscale": 20410, + "Ġcanine": 20411, + "Ġsaving": 20412, + "Ġstrategic": 20413, + "Stat": 20414, + "ĠDub": 20415, + "Ġpermitted": 20416, + "ĠTwitter": 20417, + "âĶ": 20418, + "Ġmemories": 20419, + "ĠBusiness": 20420, + "adays": 20421, + "Ġpooling": 20422, + "ĠClusters": 20423, + "imide": 20424, + "ounters": 20425, + "fraction": 20426, + "ĠCliff": 20427, + "Cam": 20428, + "Even": 20429, + "KY": 20430, + "kit": 20431, + "ibrated": 20432, + "Ġaccompanying": 20433, + "anus": 20434, + "Ġbuoy": 20435, + "Ġproliferative": 20436, + "Ġproc": 20437, + "Ġstabilizing": 20438, + "ĠNamely": 20439, + "posp": 20440, + "soon": 20441, + "Ġaberrant": 20442, + "Ġinterstellar": 20443, + "Overall": 20444, + "ĠGn": 20445, + "ĠFeedback": 20446, + "Ġoracle": 20447, + "Ġprenatal": 20448, + "commun": 20449, + "Ġoutbreaks": 20450, + "Ġfertilization": 20451, + "ĠMAG": 20452, + "Ġsinger": 20453, + "ĠMicrowave": 20454, + "ĠParliament": 20455, + "casting": 20456, + "General": 20457, + "algorithm": 20458, + "Ġphrase": 20459, + "Ġavian": 20460, + "ĠPLA": 20461, + "Ġhardly": 20462, + "approximately": 20463, + "ARCH": 20464, + "Ġtransc": 20465, + "Ġdecomp": 20466, + "contin": 20467, + "ĠMilky": 20468, + "Ġherpes": 20469, + "Range": 20470, + "OFF": 20471, + "prisingly": 20472, + "lx": 20473, + "ĠABA": 20474, + "Ġshore": 20475, + "Ġderiving": 20476, + "Ġpellets": 20477, + "nowledg": 20478, + "Item": 20479, + "stranded": 20480, + "built": 20481, + "Glc": 20482, + "quist": 20483, + "ĠSubstrate": 20484, + "Ġtraditionally": 20485, + "ĠMount": 20486, + "ivalence": 20487, + "axation": 20488, + "Ġlocate": 20489, + "Ġgun": 20490, + "Ġvocabulary": 20491, + "ĠPolym": 20492, + "Ġect": 20493, + "Ġmult": 20494, + "Ġsedimentary": 20495, + "Ġautocorrelation": 20496, + "ĠSympt": 20497, + "Ġterritory": 20498, + "Ġexcitatory": 20499, + "Ġvote": 20500, + "Ġhered": 20501, + "acea": 20502, + "ĠFocus": 20503, + "ampling": 20504, + "ffee": 20505, + "Ġprimes": 20506, + "ĠMaking": 20507, + "irs": 20508, + "MPs": 20509, + "Ġlitter": 20510, + "amethasone": 20511, + "ĠkJ": 20512, + "Ġsecretory": 20513, + "Ġcostly": 20514, + "Ġpartnership": 20515, + "ĠBacteria": 20516, + "Ġperoxidation": 20517, + "stroke": 20518, + "ĠSav": 20519, + "ĠBW": 20520, + "Ġconnects": 20521, + "Ġamine": 20522, + "ril": 20523, + "Ġbattle": 20524, + "ĠNotes": 20525, + "ĠProvid": 20526, + "ĠInstitutional": 20527, + "Ġpropri": 20528, + "fan": 20529, + "Ġpun": 20530, + "romb": 20531, + "vities": 20532, + "ĠCAM": 20533, + "ĠIsh": 20534, + "ĠHN": 20535, + "ĠRecomb": 20536, + "sche": 20537, + "Ġsynchrotron": 20538, + "rik": 20539, + "synaptic": 20540, + "ĠGeorgia": 20541, + "??": 20542, + "CY": 20543, + "Ġcorresponded": 20544, + "kinase": 20545, + "ĠITS": 20546, + "Ġproposals": 20547, + "Ġbioge": 20548, + "ĠESR": 20549, + "ĠWen": 20550, + "ĠJa": 20551, + "ĠSevere": 20552, + "ĠAden": 20553, + "ĠCCL": 20554, + "Ġseat": 20555, + "ĠKre": 20556, + "Ġhelping": 20557, + "Ġnets": 20558, + "ĠLep": 20559, + "hedra": 20560, + "opoulos": 20561, + "ĠBak": 20562, + "ansas": 20563, + "Ġrefrig": 20564, + "Ġubiquitous": 20565, + "Ġmatters": 20566, + "Ġsilicate": 20567, + "ĠLastly": 20568, + "ĠTheories": 20569, + "Ġagarose": 20570, + "biggr": 20571, + "transition": 20572, + "ĠDecomposition": 20573, + "bromo": 20574, + "Ġstakeholders": 20575, + "ĠEE": 20576, + "Only": 20577, + "ĠKenya": 20578, + "Ġargon": 20579, + "ĠIdentifying": 20580, + "Ġtournament": 20581, + "clock": 20582, + "ĠCFU": 20583, + "ĠBehavioral": 20584, + "Ġpod": 20585, + "Ġtaxonomy": 20586, + "ĠProduct": 20587, + "ĠAlong": 20588, + "Ġfamilial": 20589, + "Ġdescriptor": 20590, + "vated": 20591, + "ĠVariables": 20592, + "tp": 20593, + "Ġgoods": 20594, + "ĠAST": 20595, + "ĠAnis": 20596, + "Ġspinor": 20597, + "attention": 20598, + "Ġbasket": 20599, + "Struct": 20600, + "Ġimmunohistochemical": 20601, + "engers": 20602, + "CAT": 20603, + "Ġtangential": 20604, + "Cap": 20605, + "ĠPair": 20606, + "Ġviscoelastic": 20607, + "ĠAds": 20608, + "Ġglycosylation": 20609, + "Ġdur": 20610, + "ĠMinimum": 20611, + "Ġrigidity": 20612, + "stats": 20613, + "tillation": 20614, + "ĠDiscrim": 20615, + "ĠLegend": 20616, + "Previous": 20617, + "film": 20618, + "Ġaluminium": 20619, + "Micro": 20620, + "inia": 20621, + "egel": 20622, + "ĠSubcellular": 20623, + "Ġbottleneck": 20624, + "Ġsyll": 20625, + "icle": 20626, + "Ġsheaf": 20627, + "chell": 20628, + "example": 20629, + "ĠSelected": 20630, + "Ġpredators": 20631, + "Ġreper": 20632, + "Ġstrugg": 20633, + "ĠMaria": 20634, + "lyl": 20635, + "LF": 20636, + "Ġexercises": 20637, + "obium": 20638, + "ILITY": 20639, + "corrected": 20640, + "Ġbenchmarks": 20641, + "ĠTol": 20642, + "Ġintercept": 20643, + "ĠCalculation": 20644, + "ĠIndonesia": 20645, + "Ġglioblastoma": 20646, + "KM": 20647, + "ĠSupplemental": 20648, + "Ġcitizens": 20649, + "adren": 20650, + "Ġmultimodal": 20651, + "Ġmosquitoes": 20652, + "iva": 20653, + "ĠFindings": 20654, + "ĠPub": 20655, + "ĠMacroph": 20656, + "Acknowledg": 20657, + "Ġbasins": 20658, + "exact": 20659, + "Ġgrades": 20660, + "Ġfir": 20661, + "iga": 20662, + "ĠPolynomial": 20663, + "ĠLongitudinal": 20664, + "Ġsemiconductors": 20665, + "Top": 20666, + "iptera": 20667, + "Ġlacks": 20668, + "rograph": 20669, + "Ġselects": 20670, + "Ġsweet": 20671, + "Ġbac": 20672, + "Ġdownloaded": 20673, + "aponic": 20674, + "ijk": 20675, + "otonic": 20676, + "normalized": 20677, + "ĠVariability": 20678, + "division": 20679, + "ĠSupers": 20680, + "ilab": 20681, + "Human": 20682, + "Ġleptin": 20683, + "Ġosmotic": 20684, + "Ġhur": 20685, + "ĠSingapore": 20686, + "ĠOPT": 20687, + "ĠSoviet": 20688, + "litaxel": 20689, + "retaceous": 20690, + "ĠOnc": 20691, + "ĠIX": 20692, + "ulas": 20693, + "uent": 20694, + "Ġlymphoid": 20695, + "Tc": 20696, + "Ġrationale": 20697, + "Layer": 20698, + "osities": 20699, + "Ġdesire": 20700, + "ĠAnnual": 20701, + "uba": 20702, + "ĠCompounds": 20703, + "Ġantifungal": 20704, + "Ġcationic": 20705, + "items": 20706, + "acterium": 20707, + "amilies": 20708, + "Ġelongated": 20709, + "ĠMassachusetts": 20710, + "ĠIrish": 20711, + "asso": 20712, + "azo": 20713, + "ĠBurk": 20714, + "robenius": 20715, + "Ġisinstance": 20716, + "bion": 20717, + "Ġgreedy": 20718, + "Ġnicotine": 20719, + "Ġretrieve": 20720, + "Ġsympathetic": 20721, + "quee": 20722, + "Ġfoli": 20723, + "Ġsputter": 20724, + "Ġgrading": 20725, + "determined": 20726, + "Ġabnorm": 20727, + "Ġmanagers": 20728, + "Ġtopical": 20729, + "Ġimmig": 20730, + "ĠDNN": 20731, + "gtr": 20732, + "Ġdetections": 20733, + "ĠObesity": 20734, + "suc": 20735, + "ĠSche": 20736, + "Ġtrunk": 20737, + "Ġtough": 20738, + "ĠBN": 20739, + "Ġru": 20740, + "oxif": 20741, + "Ġaiming": 20742, + "ĠExtracellular": 20743, + "Ġhaplotype": 20744, + "Du": 20745, + "ĠDing": 20746, + "ĠDol": 20747, + "Ġhumid": 20748, + "brom": 20749, + "Ġoffline": 20750, + "Combining": 20751, + "Ġpulsar": 20752, + "Ġpari": 20753, + "partate": 20754, + "imated": 20755, + "Ġwatershed": 20756, + "acrylamide": 20757, + "exec": 20758, + "ĠComposite": 20759, + "Ġdispersive": 20760, + "Ġtons": 20761, + "rometry": 20762, + "ĠJud": 20763, + "aza": 20764, + "Ġchickens": 20765, + "register": 20766, + "nz": 20767, + "Util": 20768, + "ĠVes": 20769, + "eV": 20770, + "ĠRule": 20771, + "substituted": 20772, + "Conv": 20773, + "query": 20774, + "Mac": 20775, + "ĠTar": 20776, + "implies": 20777, + "ĠRates": 20778, + "Ġrins": 20779, + "Ġtimescales": 20780, + "ĠCzech": 20781, + "Such": 20782, + "restimate": 20783, + "ĠMb": 20784, + "ĠFuj": 20785, + "ĠIMD": 20786, + "cit": 20787, + "Ġraising": 20788, + "........": 20789, + "home": 20790, + "asted": 20791, + "Ġocta": 20792, + "Ġcadmium": 20793, + "Ġpsori": 20794, + "roleum": 20795, + "ĠStellar": 20796, + "ĠKinase": 20797, + "ĠGard": 20798, + "ieu": 20799, + "ĠMoS": 20800, + "MG": 20801, + "ĠGSH": 20802, + "Ġhazards": 20803, + "Ġnice": 20804, + "heating": 20805, + "Ġreproducible": 20806, + "genesis": 20807, + "ĠIgM": 20808, + "Ġbeat": 20809, + "onuclease": 20810, + "entralized": 20811, + "ĠLé": 20812, + "Ġdol": 20813, + "Ġdeeply": 20814, + "ractive": 20815, + "Ġglial": 20816, + "iella": 20817, + "Ġinitialized": 20818, + "ĠMethodology": 20819, + "Ġbenthic": 20820, + "omi": 20821, + "ĠAlter": 20822, + "Ordered": 20823, + "ĠLIN": 20824, + "Ġunilateral": 20825, + "Ġcorticoster": 20826, + "LEN": 20827, + "Ġdilute": 20828, + "Ġmetalloprotein": 20829, + "abeth": 20830, + "ampion": 20831, + "Ġmoral": 20832, + "ĠSiC": 20833, + "Ġquadrature": 20834, + "Ġsedimentation": 20835, + "ete": 20836, + "ĠFrag": 20837, + "Ġpeaked": 20838, + "Ġmitigation": 20839, + "Ġsoldi": 20840, + "Ġdoubly": 20841, + "Ġellipso": 20842, + "ĠlncRNAs": 20843, + "Ġâİ¢": 20844, + "ĠSame": 20845, + "ĠSustain": 20846, + "ĠCapacity": 20847, + "Ġsomat": 20848, + "Ġtransistor": 20849, + "Ġassayed": 20850, + "ĠNur": 20851, + "tools": 20852, + "Sing": 20853, + "Ġligament": 20854, + "atever": 20855, + "Ġperce": 20856, + "hence": 20857, + "UX": 20858, + "sent": 20859, + "EGG": 20860, + "third": 20861, + "enders": 20862, + "theoretic": 20863, + "Ġrewards": 20864, + "uto": 20865, + "Ġinstallation": 20866, + "ĠKinetic": 20867, + "ĠInnov": 20868, + "ĠSolving": 20869, + "ĠSymmetry": 20870, + "Ġramp": 20871, + "Ġneuropathy": 20872, + "omerization": 20873, + "Ġcatech": 20874, + "Pred": 20875, + "ĠBoh": 20876, + "EMENT": 20877, + "Ġarmy": 20878, + "ĠYukawa": 20879, + "Ġalignments": 20880, + "ĠDependence": 20881, + "Ġenv": 20882, + "ean": 20883, + "sr": 20884, + "Ġinterpreting": 20885, + "elocity": 20886, + "Ġpsychology": 20887, + "Ġbiofilms": 20888, + "Ġeccentricity": 20889, + "lot": 20890, + "analytic": 20891, + "Ġperiodicity": 20892, + "nings": 20893, + "ĠKent": 20894, + "flag": 20895, + "Ġmp": 20896, + "ĠNich": 20897, + "hire": 20898, + "Ġflare": 20899, + "Ġcitrate": 20900, + "Ġpaste": 20901, + "Ġdelete": 20902, + "zymes": 20903, + "orientation": 20904, + "ĠHY": 20905, + "Ġcommands": 20906, + "Ġstrike": 20907, + "symbol": 20908, + "ĠMind": 20909, + "Ġoptimisation": 20910, + "Ġosteoporosis": 20911, + "ĠInflammation": 20912, + "ĠIntelligence": 20913, + "eh": 20914, + "utum": 20915, + "Ġvec": 20916, + "ellation": 20917, + "ĠBloch": 20918, + "ĠMajorana": 20919, + "enor": 20920, + "ĠNgu": 20921, + "Ġdeuter": 20922, + "opedia": 20923, + "Ġutter": 20924, + "Ġribosome": 20925, + "Ġactors": 20926, + "electronic": 20927, + "ée": 20928, + "Ġfeaturing": 20929, + "agle": 20930, + "Ġperin": 20931, + "ĠCivil": 20932, + "Ġpredefined": 20933, + "lag": 20934, + "ĠJAK": 20935, + "jamin": 20936, + "individual": 20937, + "onc": 20938, + "Ġfishing": 20939, + "ditive": 20940, + "Norm": 20941, + "ĠScanning": 20942, + "vanishing": 20943, + "Ġcessation": 20944, + "ĠHole": 20945, + "ributes": 20946, + "IE": 20947, + "ĠMpc": 20948, + "wegian": 20949, + "Ma": 20950, + "Ġrevisited": 20951, + "ĠPlus": 20952, + "abilized": 20953, + "Ġscanned": 20954, + "ĠExchange": 20955, + "Ġbromide": 20956, + "Life": 20957, + "otroph": 20958, + "ADS": 20959, + "âĭħ": 20960, + "Ġoperative": 20961, + "ĠBERT": 20962, + "Ġplume": 20963, + "Ġpoorer": 20964, + "Ġtrout": 20965, + "Ġmicrotubule": 20966, + "Ġphosphatidyl": 20967, + "radius": 20968, + "ĠMuscle": 20969, + "Ġcarcinogenesis": 20970, + "Ġseeing": 20971, + "uclein": 20972, + "follow": 20973, + "Ġsupplements": 20974, + "olars": 20975, + "specially": 20976, + "Ġcompleting": 20977, + "Ġnaïve": 20978, + "ĠÏ©": 20979, + "clerotic": 20980, + "Disc": 20981, + "ĠFestival": 20982, + "Ġclick": 20983, + "clusive": 20984, + "Ġcatalogue": 20985, + "Ġapps": 20986, + "ĠSED": 20987, + "Ġstacked": 20988, + "Ġtune": 20989, + "ĠDMEM": 20990, + "Ġaerosols": 20991, + "Ġgear": 20992, + "antine": 20993, + "ĠStone": 20994, + "Ġpositives": 20995, + "triang": 20996, + "probability": 20997, + "Ġdecoupling": 20998, + "ĠÍĵ": 20999, + "ĠVin": 21000, + "Ġsurvived": 21001, + "Ġreplicated": 21002, + "utrient": 21003, + "Ġtemperate": 21004, + "Ġensembles": 21005, + "Ġmulticenter": 21006, + "Ġgaseous": 21007, + "idea": 21008, + "classification": 21009, + "ĠOutcome": 21010, + "clonal": 21011, + "Ġdiscontinuity": 21012, + "Ġadvantageous": 21013, + "Ġdistricts": 21014, + "ĠIBM": 21015, + "inguishable": 21016, + "Ġcars": 21017, + "cult": 21018, + "enriched": 21019, + "argin": 21020, + "novae": 21021, + "steady": 21022, + "Ġbuy": 21023, + "piration": 21024, + "Ġpartitioned": 21025, + "Ġinability": 21026, + "pq": 21027, + "Ġbull": 21028, + "odend": 21029, + "Ġassistant": 21030, + "Ġlumen": 21031, + "Ġconverting": 21032, + "PY": 21033, + "zol": 21034, + "utors": 21035, + "ĠNLRP": 21036, + "apply": 21037, + "ĠBonferroni": 21038, + "Ls": 21039, + "Ġtips": 21040, + "ĠLN": 21041, + "rolase": 21042, + "Ġadvis": 21043, + "ĠMetast": 21044, + "Ġsaliva": 21045, + "Ġinhabit": 21046, + "Ġrim": 21047, + "debug": 21048, + "Any": 21049, + "Ġforb": 21050, + "Ġversatile": 21051, + "ĠCompact": 21052, + "voc": 21053, + "ĠIso": 21054, + "ĠJus": 21055, + "bodies": 21056, + "ARM": 21057, + "ĠGWAS": 21058, + "hetized": 21059, + "Ġmicrofluidic": 21060, + "Ġacetonitrile": 21061, + "Ġinhom": 21062, + "Ġparench": 21063, + "Ġinsensitive": 21064, + "Ġagency": 21065, + "poor": 21066, + "ĠAngi": 21067, + "Ġapproached": 21068, + "Ġemulsion": 21069, + "Ġvoluntary": 21070, + "utt": 21071, + "ĠRecurrent": 21072, + "riculum": 21073, + "ê": 21074, + "Ġtall": 21075, + "ĠDepth": 21076, + "Ġff": 21077, + "ĠIncidence": 21078, + "Ġmanifestation": 21079, + "Ġcompromised": 21080, + "iaceae": 21081, + "ĠMIT": 21082, + "otransfer": 21083, + "ĠWD": 21084, + "mov": 21085, + "ĠManual": 21086, + "Medi": 21087, + "Ġinterfering": 21088, + "ĠJacobi": 21089, + "KT": 21090, + "Ġsarcoma": 21091, + "Ġkidneys": 21092, + "Ġodor": 21093, + "Ġti": 21094, + "yday": 21095, + "although": 21096, + "visible": 21097, + "Ġdengue": 21098, + "ĠCAL": 21099, + "strat": 21100, + "ĠVariations": 21101, + "inib": 21102, + "components": 21103, + "ĠTob": 21104, + "ĠAntioxidant": 21105, + "ÍĶ": 21106, + "Ġkiller": 21107, + "Ġsubtracted": 21108, + "ĠEvents": 21109, + "Ġimplements": 21110, + "ĠGAN": 21111, + "Ġprophylaxis": 21112, + "Ġnozz": 21113, + "Ġsmoothed": 21114, + "Ġdecaying": 21115, + "ĠInitially": 21116, + "Ġuncommon": 21117, + "Ġconductor": 21118, + "ĠWOR": 21119, + "avity": 21120, + "ĠXie": 21121, + "ĠAcet": 21122, + "Ġine": 21123, + "ĠBeam": 21124, + "opolymer": 21125, + "ĠXML": 21126, + "ĠWide": 21127, + "Ñĥ": 21128, + "Ġejection": 21129, + "BMI": 21130, + "tc": 21131, + "uez": 21132, + "Ġcerebellar": 21133, + "Ġcatchment": 21134, + "coxon": 21135, + "ĠShannon": 21136, + "Ġcentrality": 21137, + "Ġsafely": 21138, + "probe": 21139, + "ĠLaboratories": 21140, + "Ġnc": 21141, + "Ġspher": 21142, + "Ġprobing": 21143, + "ĠLev": 21144, + "Ġaf": 21145, + "ĠMig": 21146, + "ĠVascular": 21147, + "Ġprogrammes": 21148, + "Ġcontaminants": 21149, + "sequent": 21150, + "Ġbonded": 21151, + "integration": 21152, + "bos": 21153, + "ĠFew": 21154, + "ĠIllinois": 21155, + "She": 21156, + "WC": 21157, + "ĠGPIO": 21158, + "oC": 21159, + "ĠMaternal": 21160, + "ercetin": 21161, + "ĠMassive": 21162, + "Ġenorm": 21163, + "imgur": 21164, + "Ġbidirectional": 21165, + "ĠGraphene": 21166, + "insky": 21167, + "ĠObserve": 21168, + "Ġstops": 21169, + "bio": 21170, + "ĠLines": 21171, + "ĠGill": 21172, + "Ġeigenvector": 21173, + "Space": 21174, + "ĠMining": 21175, + "Ġmelatonin": 21176, + "ĠSET": 21177, + "onsequ": 21178, + "oscale": 21179, + "ĠRaw": 21180, + "Ġreviewers": 21181, + "Ġnanofib": 21182, + "taking": 21183, + "ammad": 21184, + "Ġrecursion": 21185, + "usal": 21186, + "Ġpositron": 21187, + "ĠNIH": 21188, + "ĠINTER": 21189, + "ĠDocument": 21190, + "Ġconstantly": 21191, + "Ġundergone": 21192, + "Ġelectroweak": 21193, + "Ġiteratively": 21194, + "folio": 21195, + "Ġsubfamily": 21196, + "Ġâİ¥": 21197, + "Page": 21198, + "ferm": 21199, + "avir": 21200, + "Ġagencies": 21201, + "Ġpolys": 21202, + "ĠSquare": 21203, + "ymm": 21204, + "Ġhydrogels": 21205, + "almost": 21206, + "arter": 21207, + "Ġankle": 21208, + "Ġrises": 21209, + "Ġmedull": 21210, + "gated": 21211, + "Ġmononuclear": 21212, + "Ġdiscussing": 21213, + "Ġprofessor": 21214, + "transformed": 21215, + "Ġcolours": 21216, + "ragg": 21217, + "emicon": 21218, + "Ġsymmetrical": 21219, + "Ġplacental": 21220, + "Ġli": 21221, + "Ġstudio": 21222, + "sequences": 21223, + "Ġtam": 21224, + "ĠLap": 21225, + "ĠCriteria": 21226, + "Ġhappened": 21227, + "Ġantiferromagnetic": 21228, + "ĠHausdorff": 21229, + "ĠCONCLUSIONS": 21230, + "HER": 21231, + "VR": 21232, + "ĠKor": 21233, + "ĠAPO": 21234, + "Ġprotecting": 21235, + "ĠSOL": 21236, + "ĠBuck": 21237, + "phia": 21238, + "ĠMultim": 21239, + "onine": 21240, + "ulsions": 21241, + "Ġgp": 21242, + "benzamide": 21243, + "ĠNADPH": 21244, + "ĠOhio": 21245, + "ĠMEG": 21246, + "COVID": 21247, + "Ġdisplaced": 21248, + "ĠAbb": 21249, + "Ġbranched": 21250, + "ĠNavy": 21251, + "ĠNrf": 21252, + "ĠODE": 21253, + "achi": 21254, + "ĠTransient": 21255, + "Ġcircumference": 21256, + "Ġbees": 21257, + "iration": 21258, + "Ġfaculty": 21259, + "IGHT": 21260, + "ĠMetabolism": 21261, + "MK": 21262, + "ĠInequ": 21263, + "ĠQualitative": 21264, + "PBS": 21265, + "terminus": 21266, + "kary": 21267, + "ovian": 21268, + "ĠTHz": 21269, + "ĠReliability": 21270, + "furan": 21271, + "Ġcorners": 21272, + "Ġattacker": 21273, + "Ġmarriage": 21274, + "oprecipitation": 21275, + "ĠCry": 21276, + "ĠâĬĻ": 21277, + "Ġevolves": 21278, + "Ġban": 21279, + "Ġdiurnal": 21280, + "ounce": 21281, + "Ġoverw": 21282, + "ĠHoff": 21283, + "Ġextrinsic": 21284, + "amps": 21285, + "ULAR": 21286, + "opher": 21287, + "Ġlighting": 21288, + "Ġarchitectural": 21289, + "hesive": 21290, + "Ġsavings": 21291, + "Ġglaucoma": 21292, + "ozoa": 21293, + "ĠOption": 21294, + "controll": 21295, + "ecker": 21296, + "Ġosteocl": 21297, + "Ġglycine": 21298, + "analyses": 21299, + "ĠAld": 21300, + "ĠSyd": 21301, + "ĠCx": 21302, + "Ġscalars": 21303, + "Ġknowing": 21304, + "Ġremember": 21305, + "ĠEmbry": 21306, + "TEM": 21307, + "ĠBran": 21308, + "FORM": 21309, + "Ġsurviving": 21310, + "Ġglobular": 21311, + "Ġinclusive": 21312, + "sched": 21313, + "UTION": 21314, + "Ġquadrupole": 21315, + "ĠHubbard": 21316, + "Ġaxonal": 21317, + "ĠCosmic": 21318, + "Ġslots": 21319, + "ĠProcedure": 21320, + "agin": 21321, + "ĠLoop": 21322, + "arer": 21323, + "Ġbutter": 21324, + "Ġhistopathological": 21325, + "fusion": 21326, + "ANOVA": 21327, + "Ġclosing": 21328, + "ĠLord": 21329, + "ĠBis": 21330, + "ĠRAM": 21331, + "IDE": 21332, + "Ġjournals": 21333, + "Ġmonkeys": 21334, + "Ġattenuates": 21335, + "Ġsegmented": 21336, + "TOF": 21337, + "otional": 21338, + "polymer": 21339, + "ĠShah": 21340, + "Akt": 21341, + "Wr": 21342, + "lov": 21343, + "Ġpolymorphic": 21344, + "Ġarrangements": 21345, + "UF": 21346, + "lon": 21347, + "Ġdepressed": 21348, + "NAT": 21349, + "ĠOperation": 21350, + "ι": 21351, + "ĠRan": 21352, + "âIJ": 21353, + "Ġthereafter": 21354, + "Ġmyeloma": 21355, + "jor": 21356, + "Ã¥": 21357, + "ĠWinter": 21358, + "ptosis": 21359, + "Dir": 21360, + "verty": 21361, + "ĠFinn": 21362, + "Ġortholog": 21363, + "Ġmonotonically": 21364, + "Ġtectonic": 21365, + "ĠGBM": 21366, + "ĠAO": 21367, + "Ġgenerative": 21368, + "Clearly": 21369, + "Ġtile": 21370, + "ĠRNN": 21371, + "Ġgrounds": 21372, + "GaAs": 21373, + "Ġbee": 21374, + "ĠBoy": 21375, + "ĠTranscriptional": 21376, + "urin": 21377, + "otom": 21378, + "Ġsinusoidal": 21379, + "ĠAy": 21380, + "ĠClinic": 21381, + "utorial": 21382, + "ĠADC": 21383, + "ERIAL": 21384, + "cation": 21385, + "ĠADHD": 21386, + "cyclohex": 21387, + "ĠHawai": 21388, + "astom": 21389, + "Ġmorphologies": 21390, + "Ġrodents": 21391, + "Ġscalability": 21392, + "ROS": 21393, + "aemia": 21394, + "Ġdecompose": 21395, + "Ġpivotal": 21396, + "Ġdiffusivity": 21397, + "Ġcovalent": 21398, + "ĠKD": 21399, + "atalyst": 21400, + "Ġoldest": 21401, + "Ġsuitability": 21402, + "Ġwants": 21403, + "ifts": 21404, + "ĠDistributions": 21405, + "ĠQueen": 21406, + "lich": 21407, + "Ġparse": 21408, + "ĠMHD": 21409, + "Ġrecre": 21410, + "Ġhydroxide": 21411, + "eum": 21412, + "Ġlev": 21413, + "Ġreferral": 21414, + "planes": 21415, + "ĠEgypt": 21416, + "Ġlenti": 21417, + "Ġtransactions": 21418, + "Ġexpense": 21419, + "Ġcysts": 21420, + "Ġabscess": 21421, + "ĠmicroRNAs": 21422, + "effectiveness": 21423, + "ĠDifferentiation": 21424, + "Ġcertif": 21425, + "cience": 21426, + "ĠREL": 21427, + "Ġreadout": 21428, + "ĠQuasi": 21429, + "Ġrounded": 21430, + "otti": 21431, + "efficients": 21432, + "Ġsynchronized": 21433, + "Ġsilico": 21434, + "Ġforecasts": 21435, + "Ġdμ": 21436, + "Ġexotic": 21437, + "ĠOCT": 21438, + "xb": 21439, + "Ġasynchronous": 21440, + "nez": 21441, + "chiat": 21442, + "Ġhaemat": 21443, + "Ġfulfill": 21444, + "ĠMix": 21445, + "ibli": 21446, + "fm": 21447, + "Ġjava": 21448, + "soluble": 21449, + "Ġincompressible": 21450, + "âĨij": 21451, + "CDM": 21452, + "Ġdilation": 21453, + "LYP": 21454, + "ashes": 21455, + "ĠSports": 21456, + "Ġfundament": 21457, + "ĠSaudi": 21458, + "Ġenroll": 21459, + "ĠNaOH": 21460, + "Ġcrustal": 21461, + "ĠInstruments": 21462, + "Ġïģ¡": 21463, + "Result": 21464, + "Ġpreferential": 21465, + "Ġsugars": 21466, + "Ġdimers": 21467, + "ĠEmerging": 21468, + "ère": 21469, + "diabetic": 21470, + "Ġstrengthening": 21471, + "epi": 21472, + "ĠMeg": 21473, + "ĠYour": 21474, + "ĠSetting": 21475, + "lez": 21476, + "ĠBou": 21477, + "Ġhistology": 21478, + "Ġolive": 21479, + "ĠDisorders": 21480, + "Ġdistorted": 21481, + "Ġcompete": 21482, + "cens": 21483, + "ĠAe": 21484, + "ĠGG": 21485, + "Ġquantifying": 21486, + "Ġaur": 21487, + "ĠWright": 21488, + "Ġsuperconductor": 21489, + "eds": 21490, + "stalk": 21491, + "concent": 21492, + "ĠLimited": 21493, + "Ġstyles": 21494, + "design": 21495, + "ĠEllip": 21496, + "PLA": 21497, + "mogorov": 21498, + "ĠRidge": 21499, + "Ġrandomization": 21500, + "aft": 21501, + "icially": 21502, + "ĠBiotechnology": 21503, + "Ġseizure": 21504, + "KI": 21505, + "AVE": 21506, + "receptor": 21507, + "Ġgrammar": 21508, + "Ġcrime": 21509, + "nection": 21510, + "inces": 21511, + "ĠCompton": 21512, + "Ġventricle": 21513, + "Ġredistribution": 21514, + "ynaptic": 21515, + "Parameter": 21516, + "Normal": 21517, + "Pack": 21518, + "ermann": 21519, + "ulants": 21520, + "degenerate": 21521, + "ĠNewtonian": 21522, + "Ġancestral": 21523, + "phrag": 21524, + "Ġimpression": 21525, + "Ġnormalize": 21526, + "Ġambiguous": 21527, + "Ġingredient": 21528, + "ĠClaim": 21529, + "Ġcleaved": 21530, + "ĠApproaches": 21531, + "ĠSPECT": 21532, + "csv": 21533, + "ĠReveals": 21534, + "ĠWaves": 21535, + "Ġdwarfs": 21536, + "ĠProgress": 21537, + "Ġaorta": 21538, + "Ġnig": 21539, + "ĠAdams": 21540, + "ĠMüller": 21541, + "ĠYellow": 21542, + "ĠCord": 21543, + "ĠPhill": 21544, + "ĠFormal": 21545, + "besgue": 21546, + "termin": 21547, + "rn": 21548, + "bn": 21549, + "kine": 21550, + "rit": 21551, + "qi": 21552, + "ĠRoute": 21553, + "enol": 21554, + "ĠASC": 21555, + "ĠPu": 21556, + "mill": 21557, + "umer": 21558, + "Ġsupernova": 21559, + "iative": 21560, + "differenti": 21561, + "Ġtolu": 21562, + "opus": 21563, + "RM": 21564, + "Ġpoverty": 21565, + "ĠXX": 21566, + "ĠïĤ¶": 21567, + "ultry": 21568, + "Optim": 21569, + "Ġglacial": 21570, + "ĠDispers": 21571, + "Ġdifferentiating": 21572, + "ández": 21573, + "project": 21574, + "ĠEliz": 21575, + "scaling": 21576, + "ĠToll": 21577, + "Ġnonempty": 21578, + "Ġpredicate": 21579, + "Ġgyrus": 21580, + "minute": 21581, + "âĸ": 21582, + "ĠHind": 21583, + "ĠLiving": 21584, + "VS": 21585, + "prior": 21586, + "ĠVertical": 21587, + "arks": 21588, + "ĠSFR": 21589, + "ĠVietnam": 21590, + "compare": 21591, + ">>>": 21592, + "Ġbanks": 21593, + "Ġseptic": 21594, + "ĠBif": 21595, + "ĠEPS": 21596, + "ĠIntel": 21597, + "ĠDisorder": 21598, + "PN": 21599, + "ĠNord": 21600, + "tiveness": 21601, + "Ġdrilling": 21602, + "ĠSubject": 21603, + "enario": 21604, + "Ġrms": 21605, + "phones": 21606, + "hang": 21607, + "ĠTechnique": 21608, + "Ġclot": 21609, + "Ġintersections": 21610, + "Ġanions": 21611, + "above": 21612, + "Ġclause": 21613, + "Ġgenu": 21614, + "ozo": 21615, + "rhiz": 21616, + "Ġlobes": 21617, + "ĠBian": 21618, + "Ġexerted": 21619, + "ureth": 21620, + "roma": 21621, + "ĠCharge": 21622, + "ĠSynchron": 21623, + "Ġconting": 21624, + "otherapeutic": 21625, + "gtrsim": 21626, + "ĠResonance": 21627, + "ĠFal": 21628, + "undle": 21629, + "Ġdropout": 21630, + "ĠPerspective": 21631, + "OLOG": 21632, + "atches": 21633, + "ĠSequences": 21634, + "Considering": 21635, + "Ġprospects": 21636, + "Ġaliqu": 21637, + "Ġstrata": 21638, + "Ġanalogs": 21639, + "Ġencouraged": 21640, + "ĠPulmonary": 21641, + "Ġchim": 21642, + "ĠCFT": 21643, + "unar": 21644, + "izz": 21645, + "endocrine": 21646, + "ĠCRE": 21647, + "ĠStroke": 21648, + "âĩĴ": 21649, + "upuncture": 21650, + "translational": 21651, + "ĠGriff": 21652, + "ĠSter": 21653, + "erged": 21654, + "phrine": 21655, + "Ġlivestock": 21656, + "ĠHash": 21657, + "Ġdosing": 21658, + "Ġplasmas": 21659, + "ĠComparisons": 21660, + "Ġencouraging": 21661, + "Ġcomparatively": 21662, + "Ġcharacterisation": 21663, + "Ġascending": 21664, + "ĠFixed": 21665, + "Ġvegetable": 21666, + "especially": 21667, + "ĠLange": 21668, + "ĠCoding": 21669, + "Ġvertebrate": 21670, + "FW": 21671, + "ĠORF": 21672, + "ĠTub": 21673, + "lee": 21674, + "Ġtimely": 21675, + "Ep": 21676, + "ĠâĪĴâĪŀ": 21677, + "Ġliposomes": 21678, + "Ġextremal": 21679, + "ropolitan": 21680, + "ĠCay": 21681, + "ĠBiod": 21682, + "oulli": 21683, + "Dri": 21684, + "ĠRats": 21685, + "Ġcentroid": 21686, + "ospin": 21687, + "rospinal": 21688, + "Ġsolitons": 21689, + "portive": 21690, + "ĠMcG": 21691, + "Bbb": 21692, + "Ġparaffin": 21693, + "lectively": 21694, + "Ġmetastable": 21695, + "Ġdissipative": 21696, + "Ġassemblages": 21697, + "Ġcolonic": 21698, + "Ġsized": 21699, + "Ġcryp": 21700, + "processor": 21701, + "ção": 21702, + "Ġacknowledged": 21703, + "ĠUncertainty": 21704, + "ĠIndustrial": 21705, + "Ġuncont": 21706, + "Ġrefere": 21707, + "ĠNitrogen": 21708, + "Ġlifting": 21709, + "Ġforget": 21710, + "Ġfeelings": 21711, + "Ġdigits": 21712, + "Ġstratig": 21713, + "ypes": 21714, + "Ġcompositional": 21715, + "Ġsupernatants": 21716, + "Ġconflicting": 21717, + "Ġdisadvantage": 21718, + "adelphia": 21719, + "Pd": 21720, + "ĠCoupling": 21721, + "Ġexpenditure": 21722, + "iki": 21723, + "described": 21724, + "ĠRNase": 21725, + "ĠConvex": 21726, + "ĠBax": 21727, + "ungsten": 21728, + "Ġboiling": 21729, + "Ġbasement": 21730, + "ocardial": 21731, + "history": 21732, + "inton": 21733, + "trimethyl": 21734, + "Ġgrafting": 21735, + "ĠHardy": 21736, + "ĠFemale": 21737, + "ĠFollow": 21738, + "ĠEST": 21739, + "tistic": 21740, + "Open": 21741, + "Ġreflux": 21742, + "elements": 21743, + "Ġpolysaccharide": 21744, + "dims": 21745, + "acency": 21746, + "Ġbiore": 21747, + "capac": 21748, + "Ġoverexpressed": 21749, + "either": 21750, + "Ġlaid": 21751, + "Ġincision": 21752, + "Ġassets": 21753, + "inflammation": 21754, + "Ġreconstructions": 21755, + "Ġglomerular": 21756, + "Ġconvey": 21757, + "ĠCXCR": 21758, + "oro": 21759, + "Ġclassifying": 21760, + "Ġcope": 21761, + "Ġpd": 21762, + "linic": 21763, + "Ġchord": 21764, + "ĠAging": 21765, + "Ġpalm": 21766, + "Ġpermittivity": 21767, + "ĠReverse": 21768, + "Ġoffshore": 21769, + "Ġdoubt": 21770, + "imoto": 21771, + "ĠColomb": 21772, + "Ġrodent": 21773, + "ĠElectrochemical": 21774, + "ĠImprovement": 21775, + "inescent": 21776, + "ĠTriton": 21777, + "Ġtransfusion": 21778, + "Ġlocomotion": 21779, + "Ġdangerous": 21780, + "Ġweighed": 21781, + "ĠHSV": 21782, + "techn": 21783, + "ĠDiagram": 21784, + "Ġparietal": 21785, + "six": 21786, + "Ġtitles": 21787, + "ylon": 21788, + "Ġheuristics": 21789, + "Ġjaponic": 21790, + "Ġtranslations": 21791, + "Ġtiters": 21792, + "Ġworms": 21793, + "ĠDPP": 21794, + "Ġcytoskeleton": 21795, + "Mediated": 21796, + "ariance": 21797, + "thel": 21798, + "Ãħ": 21799, + "ĠInflammatory": 21800, + "Ġoscillating": 21801, + "Ġavoids": 21802, + "Define": 21803, + "ĠOlympics": 21804, + "ogel": 21805, + "Ġheme": 21806, + "Ġmicrop": 21807, + "Ġthreats": 21808, + "QCD": 21809, + "XRD": 21810, + "ĠCoupled": 21811, + "Ġlm": 21812, + "ĠHelic": 21813, + "Ġdischarged": 21814, + "Ġrooted": 21815, + "Ġalleviate": 21816, + "Ġcausality": 21817, + "ĠCrow": 21818, + "ĠMack": 21819, + "ĠAirport": 21820, + "Ġchemokine": 21821, + "Ġll": 21822, + "ĠNar": 21823, + "omyces": 21824, + "ethoxyphenyl": 21825, + "ĠDaily": 21826, + "ĠFinland": 21827, + "Ġhorn": 21828, + "ĠOrient": 21829, + "Ġionized": 21830, + "ĠYears": 21831, + "Ġquasipar": 21832, + "Ġpercutaneous": 21833, + "Phase": 21834, + "Ġforeground": 21835, + "ĠANAL": 21836, + "Ġincrements": 21837, + "stan": 21838, + "Ġspeculate": 21839, + "TX": 21840, + "Ġpile": 21841, + "Ġdic": 21842, + "ipy": 21843, + "window": 21844, + "neutral": 21845, + "ĠAtlas": 21846, + "ĠMTT": 21847, + "ĠNy": 21848, + "ĠVIII": 21849, + "ĠFilms": 21850, + "singular": 21851, + "remove": 21852, + "Length": 21853, + "ĠRece": 21854, + "wait": 21855, + "Ġpurchase": 21856, + "ĠWikipedia": 21857, + "ĠLars": 21858, + "Ġsyntactic": 21859, + "Ġactuator": 21860, + "ĠAKT": 21861, + "ĠBry": 21862, + "ĠResult": 21863, + "ĠVariational": 21864, + "Ġjudgment": 21865, + "JECT": 21866, + "ximab": 21867, + "Ġtraced": 21868, + "Ġcardiomyopathy": 21869, + "WN": 21870, + "ĠRodrig": 21871, + "bt": 21872, + "Ġbid": 21873, + "acle": 21874, + "amura": 21875, + "Ġepic": 21876, + "Ġpuzz": 21877, + "ĠSox": 21878, + "Ġinflux": 21879, + "ÃŃn": 21880, + "uloskeletal": 21881, + "Dim": 21882, + "ĠSCC": 21883, + "ĠRAS": 21884, + "mr": 21885, + "UI": 21886, + "Ġjun": 21887, + "ĠSpearman": 21888, + "Ġfairness": 21889, + "etz": 21890, + "ĠPPI": 21891, + "inance": 21892, + "enko": 21893, + "Ġgalact": 21894, + "öm": 21895, + "Ġexceptions": 21896, + "ĠCretaceous": 21897, + "MY": 21898, + "Resp": 21899, + "Ġpep": 21900, + "ĠOrd": 21901, + "STE": 21902, + "Ġhelicity": 21903, + "Ġofficer": 21904, + "Target": 21905, + "ĠNorwegian": 21906, + "Ġdehydration": 21907, + "ĠSIRT": 21908, + "ĠRobinson": 21909, + "ĠBenchmark": 21910, + "viral": 21911, + "Real": 21912, + "Ġdoxorubicin": 21913, + "Ġestimations": 21914, + "ĠCauc": 21915, + "Ġadditives": 21916, + "modes": 21917, + "ĠHend": 21918, + "Ġaccelerating": 21919, + "ĠGordon": 21920, + "ĠMagnet": 21921, + "Ġgonad": 21922, + "Ġpyrolysis": 21923, + "coholic": 21924, + "ĠPKC": 21925, + "SAR": 21926, + "Ġwinding": 21927, + "terious": 21928, + "ĠMountains": 21929, + "ĠSymbol": 21930, + "ĠMatthe": 21931, + "ĠShin": 21932, + "Script": 21933, + "rug": 21934, + "ĠmW": 21935, + "ĠISM": 21936, + "ĠNg": 21937, + "Ġappoint": 21938, + "ĠAIDS": 21939, + "Ġports": 21940, + "differential": 21941, + "ĠJes": 21942, + "ĠNeed": 21943, + "Ġlenses": 21944, + "ĠAMPK": 21945, + "à¤": 21946, + "leaf": 21947, + "ĠBron": 21948, + "Ġprofit": 21949, + "Local": 21950, + "ĠExamination": 21951, + "ĠChief": 21952, + "Ġopinions": 21953, + "ĠRound": 21954, + "formations": 21955, + "Ġcollinear": 21956, + "Ġdigested": 21957, + "lassical": 21958, + "ervative": 21959, + "Ġcephal": 21960, + "Ġdisadvantages": 21961, + "Ġïĥ·": 21962, + "Ġsubtracting": 21963, + "Ġweigh": 21964, + "Bound": 21965, + "DG": 21966, + "Ġinfluential": 21967, + "Ġtoxins": 21968, + "ĠBenjamin": 21969, + "ĠNumbers": 21970, + "crystal": 21971, + "Ġstocks": 21972, + "ĠBour": 21973, + "ĠCompeting": 21974, + "Ġacqu": 21975, + "tRNA": 21976, + "ĠSeparation": 21977, + "Ġtagged": 21978, + "Ġconject": 21979, + "ĠPrince": 21980, + "Ġgrazing": 21981, + "Ġreleases": 21982, + "ĠChallenge": 21983, + "ATPase": 21984, + "Ġemail": 21985, + "insically": 21986, + "ĠRegulatory": 21987, + "Message": 21988, + "Ġslit": 21989, + "Ġpolygon": 21990, + "Ġdoubling": 21991, + "Ġreceivers": 21992, + "Ġtracked": 21993, + "Ġengineer": 21994, + "stained": 21995, + "ĠDanish": 21996, + "shock": 21997, + "ĠMaz": 21998, + "Ġcough": 21999, + "ĠImmunohist": 22000, + "Consequ": 22001, + "armacy": 22002, + "Ġchemo": 22003, + "ĠMH": 22004, + "Ġemerges": 22005, + "Ġannealed": 22006, + "Ġhypothesize": 22007, + "ĠTypically": 22008, + "ĠBang": 22009, + "ĠPuls": 22010, + "Ġgirl": 22011, + "Ġherbiv": 22012, + "ĠANN": 22013, + "Ġseism": 22014, + "ĠCytok": 22015, + "ĠThroughout": 22016, + "Ġadaptations": 22017, + "lang": 22018, + "Ġclonal": 22019, + "umulation": 22020, + "ĠUniform": 22021, + "Ġhi": 22022, + "opent": 22023, + "Ġbutton": 22024, + "tene": 22025, + "Ġproteasome": 22026, + "bred": 22027, + "ĠNelson": 22028, + "racycline": 22029, + "ĠDY": 22030, + "Ġimmunoblot": 22031, + "prol": 22032, + "Ġpic": 22033, + "Ġcompilation": 22034, + "ĠDevices": 22035, + "etermined": 22036, + "ĠFrancis": 22037, + "notation": 22038, + "writing": 22039, + "terase": 22040, + "ĠStephen": 22041, + "amel": 22042, + "ĠChu": 22043, + "alone": 22044, + "Ġexhaust": 22045, + "relevant": 22046, + "ĠStrat": 22047, + "Ġparametrization": 22048, + "ĠBull": 22049, + "ĠRemote": 22050, + "increasing": 22051, + "Ġdd": 22052, + "â̰": 22053, + "yroidism": 22054, + "ilin": 22055, + "ĠHip": 22056, + "ICA": 22057, + "ĠApoptosis": 22058, + "Ġmachining": 22059, + "LDL": 22060, + "Ġgem": 22061, + "ĠFFT": 22062, + "ĠGuang": 22063, + "Ġoriginates": 22064, + "dat": 22065, + "cone": 22066, + "ĠAdoles": 22067, + "ucci": 22068, + "avoid": 22069, + "ulpt": 22070, + "urium": 22071, + "Ġliteracy": 22072, + "Recent": 22073, + "avg": 22074, + "Ġinvited": 22075, + "ĠPeak": 22076, + "ĠEnterobacter": 22077, + "Ġaneurysm": 22078, + "ĠMorris": 22079, + "tida": 22080, + "ĠSER": 22081, + "ĠMichel": 22082, + "ĠIBD": 22083, + "ĠNG": 22084, + "Ġscarce": 22085, + "web": 22086, + "Ġexpresses": 22087, + "Ġschema": 22088, + "Ġlessons": 22089, + "Ġarginine": 22090, + "Ġphotographs": 22091, + "ĠNeurons": 22092, + "ĠATPase": 22093, + "Ġfiller": 22094, + "rapped": 22095, + "Ġrandomness": 22096, + "Ġveins": 22097, + "Ġwounds": 22098, + "ĠApart": 22099, + "Ġracial": 22100, + "Ġnoteworthy": 22101, + "Ġremoves": 22102, + "Ġganglion": 22103, + "Ġlaminar": 22104, + "ĠSSR": 22105, + "Ġpolysaccharides": 22106, + "Ġbuf": 22107, + "Ġendothelium": 22108, + "ĠCAS": 22109, + "ĠGolgi": 22110, + "Ġinheritance": 22111, + "isite": 22112, + "COMP": 22113, + "Ġpt": 22114, + "Ġmeshes": 22115, + "Ġtherapeutics": 22116, + "OST": 22117, + "olinergic": 22118, + "UG": 22119, + "squared": 22120, + "Ġdegrade": 22121, + "uum": 22122, + "Ġretrosp": 22123, + "Loc": 22124, + "ĠJNK": 22125, + "Options": 22126, + "Ġinsulating": 22127, + "Ġspecifies": 22128, + "Ġoven": 22129, + "yy": 22130, + "ĠConver": 22131, + "Ġdisappeared": 22132, + "ĠPrognostic": 22133, + "ĠNguyen": 22134, + "Ġperiphery": 22135, + "bank": 22136, + "Ġimid": 22137, + "Ġassigning": 22138, + "ĠMess": 22139, + "propan": 22140, + "ioma": 22141, + "olyb": 22142, + "Ġepitope": 22143, + "Ġemitting": 22144, + "DIR": 22145, + "ync": 22146, + "Ġimpairments": 22147, + "ĠMicroscopy": 22148, + "ĠFWHM": 22149, + "gray": 22150, + "Ġfing": 22151, + "ucial": 22152, + "plemented": 22153, + "eas": 22154, + "estamp": 22155, + "Ġcrest": 22156, + "ĠMos": 22157, + "Ġneutrons": 22158, + "Ġbroth": 22159, + "Ġheadache": 22160, + "ongevity": 22161, + "Ġreass": 22162, + "ĠPSF": 22163, + "ĠBuch": 22164, + "visor": 22165, + "Ġdenoting": 22166, + "integer": 22167, + "ouin": 22168, + "efficacy": 22169, + "Ġglutamine": 22170, + "Ġpicked": 22171, + "ĠCampbell": 22172, + "ĠKernel": 22173, + "Ġships": 22174, + "lt": 22175, + "ondyl": 22176, + "Ġcredi": 22177, + "Ġpeptid": 22178, + "ĠEstabl": 22179, + "bons": 22180, + "Ġaggl": 22181, + "USE": 22182, + "supp": 22183, + "upsilon": 22184, + "characterized": 22185, + "isheries": 22186, + "May": 22187, + "ARC": 22188, + "Ġroads": 22189, + "Ġdeparture": 22190, + "ĠMAX": 22191, + "ĠTRA": 22192, + "imod": 22193, + "ĠAlber": 22194, + "Ġterminated": 22195, + "ölder": 22196, + "Scalar": 22197, + "hash": 22198, + "ĠMSS": 22199, + "Ġsmoothness": 22200, + "Ġresemble": 22201, + "ĠEffectiveness": 22202, + "rx": 22203, + "ĠEye": 22204, + "Ġfaecal": 22205, + "þ": 22206, + "ĠClostridium": 22207, + "achine": 22208, + "ĠBDNF": 22209, + "Ġcab": 22210, + "ĠWong": 22211, + "ĠDouglas": 22212, + "Ġreperfusion": 22213, + "ĠXi": 22214, + "Ġconfused": 22215, + "ĠPhiladelphia": 22216, + "Ġapple": 22217, + "Ġile": 22218, + "Ġfavored": 22219, + "Ġplaques": 22220, + "Ġtrivially": 22221, + "ĠTypical": 22222, + "Ġcentralized": 22223, + "ĠFacebook": 22224, + "Ġnortheast": 22225, + "Ġnormality": 22226, + "ĠTb": 22227, + "Ġapt": 22228, + "Ġfacet": 22229, + "ĠRenal": 22230, + "clk": 22231, + "Ġligation": 22232, + "ifferenti": 22233, + "Ġputting": 22234, + "Ġintrig": 22235, + "walled": 22236, + "Et": 22237, + "ĠCow": 22238, + "ĠNations": 22239, + "Ġcampus": 22240, + "ĠKinetics": 22241, + "ĠMexican": 22242, + "ERK": 22243, + "Ġlatitudes": 22244, + "ĠRoll": 22245, + "ĠQD": 22246, + "adaptive": 22247, + "Ġquenched": 22248, + "Ġfram": 22249, + "Qi": 22250, + "Ġtongue": 22251, + "edes": 22252, + "Ġascorb": 22253, + "ĠGlucose": 22254, + "ouri": 22255, + "Ġdefeated": 22256, + "ophilus": 22257, + "ralateral": 22258, + "xrightarrow": 22259, + "ĠJup": 22260, + "axes": 22261, + "eger": 22262, + "MIT": 22263, + "ĠMember": 22264, + "ĠNu": 22265, + "Ġtransloc": 22266, + "ĠFlux": 22267, + "ĠColorado": 22268, + "Ġrelying": 22269, + "atrol": 22270, + "Ġcontrasts": 22271, + "centage": 22272, + "Ġleukocyte": 22273, + "Ġcoincidence": 22274, + "Ġcontractions": 22275, + "oga": 22276, + "ANN": 22277, + "ĠAbsorption": 22278, + "Return": 22279, + "reprene": 22280, + "baum": 22281, + "traumatic": 22282, + "incial": 22283, + "Ġautophag": 22284, + "Ġalgorithmic": 22285, + "rimp": 22286, + "Ġdivides": 22287, + "ĠRose": 22288, + "ĠEric": 22289, + "Ġaddiction": 22290, + "plification": 22291, + "Ġdiffusive": 22292, + "ĠVehicle": 22293, + "enerate": 22294, + "tising": 22295, + "Ġstarvation": 22296, + "absorption": 22297, + "ĠAra": 22298, + "Ġgrav": 22299, + "ĠSubunit": 22300, + "Ġamide": 22301, + "Ġenhancer": 22302, + "Ġmerid": 22303, + "ermost": 22304, + "Ġalgal": 22305, + "ĠQueens": 22306, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 22307, + "Ġjudge": 22308, + "ĠGreenland": 22309, + "brace": 22310, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 22311, + "Ġhypergly": 22312, + "Ġemergent": 22313, + "Fisher": 22314, + "ĠLas": 22315, + "Ġsexes": 22316, + "Sep": 22317, + "Ġphrases": 22318, + "ĠSequential": 22319, + "inki": 22320, + "Ġaxioms": 22321, + "study": 22322, + "Ġtiny": 22323, + "Ġcd": 22324, + "catalyzed": 22325, + "asaki": 22326, + "ĠWR": 22327, + "ĠMinimal": 22328, + "Ġsubcellular": 22329, + "Ġphospho": 22330, + "ESI": 22331, + "Ġvow": 22332, + "Ġsupplies": 22333, + "operand": 22334, + "Fix": 22335, + "anian": 22336, + "writer": 22337, + "âζ": 22338, + "Ġwinner": 22339, + "ĠPID": 22340, + "ĠLebesgue": 22341, + "Ġsimplification": 22342, + "ĠRelationships": 22343, + "Ġautomata": 22344, + "ĠContribution": 22345, + "Ġhereditary": 22346, + "errin": 22347, + "ĠBLAST": 22348, + "aea": 22349, + "yleth": 22350, + "ĠTc": 22351, + "adeh": 22352, + "adjuvant": 22353, + "Wave": 22354, + "counter": 22355, + "ĠGupta": 22356, + "ĠGhana": 22357, + "Cho": 22358, + "Ġourselves": 22359, + "Ġevenly": 22360, + "lymph": 22361, + "Ġcerebellum": 22362, + "Ġcopolymers": 22363, + "modular": 22364, + "Ġharder": 22365, + "Ġplease": 22366, + "ĠPSD": 22367, + "Ġlimbs": 22368, + "Ġexploitation": 22369, + "iry": 22370, + "Ġperiodontal": 22371, + "ATCH": 22372, + "Ġmalicious": 22373, + "ĠSlov": 22374, + "HY": 22375, + "Consequently": 22376, + "oren": 22377, + "ĠPare": 22378, + "agine": 22379, + "ĠROI": 22380, + "ĠWhich": 22381, + "ĠNative": 22382, + "amen": 22383, + "reshape": 22384, + "oplankton": 22385, + "Ġartifact": 22386, + "Ġrhin": 22387, + "gpu": 22388, + "Ġundet": 22389, + "Ġsporadic": 22390, + "Ġorally": 22391, + "Ġstepwise": 22392, + "ĠCohort": 22393, + "Ġrhod": 22394, + "cyt": 22395, + "Ġierr": 22396, + "Ġmotors": 22397, + "ĠIgE": 22398, + "calculated": 22399, + "ĠChampionships": 22400, + "pel": 22401, + "ĠFerr": 22402, + "Ġisometric": 22403, + "nutrition": 22404, + "Ġunsaturated": 22405, + "Ġdoll": 22406, + "ĠRMSE": 22407, + "Ġsolitary": 22408, + "approximation": 22409, + "Ġreperto": 22410, + "sight": 22411, + "Ġcranial": 22412, + "ilical": 22413, + "ĠOst": 22414, + "oul": 22415, + "Ġdg": 22416, + "ĠProceed": 22417, + "Ġmilling": 22418, + "sz": 22419, + "Ġmineralization": 22420, + "Ġcigarette": 22421, + "Ġporph": 22422, + "Ġspons": 22423, + "ĠGreece": 22424, + "ipore": 22425, + "accept": 22426, + "ĠPTSD": 22427, + "Å«": 22428, + "Ġcipher": 22429, + "Ġfunctionalized": 22430, + "Poly": 22431, + "Ġabd": 22432, + "flight": 22433, + "ĠSydney": 22434, + "Ġdisaster": 22435, + "ĠHaving": 22436, + "Ġdiesel": 22437, + "ĠGreg": 22438, + "Ġspans": 22439, + "ĠSeasonal": 22440, + "STEM": 22441, + "ierr": 22442, + "ĠIB": 22443, + "Ġlemm": 22444, + "anum": 22445, + "ĠBottom": 22446, + "Ġseal": 22447, + "boost": 22448, + "Ġlegend": 22449, + "bing": 22450, + "abis": 22451, + "Ġchitin": 22452, + "Ġmaximally": 22453, + "Ġimmunosuppressive": 22454, + "âĪĴâĪĴ": 22455, + "Ġabolished": 22456, + "ige": 22457, + "Ġesophag": 22458, + "Ġlasted": 22459, + "Ġcarbohydrates": 22460, + "Ġchips": 22461, + "ĠFernand": 22462, + "far": 22463, + "ĠPoints": 22464, + "calation": 22465, + "ĠRegions": 22466, + "CHK": 22467, + "veratrol": 22468, + "truth": 22469, + "Ġstrange": 22470, + "Interest": 22471, + "sho": 22472, + "ĠInduc": 22473, + "Ġmigraine": 22474, + "ĠVac": 22475, + "ophores": 22476, + "Ġerrone": 22477, + "scriptsize": 22478, + "ĠNeutron": 22479, + "Ġindistinguishable": 22480, + "istine": 22481, + "Ġhelper": 22482, + "specified": 22483, + "Ġjuice": 22484, + "oxal": 22485, + "ĠJung": 22486, + "Ġmagazine": 22487, + "Ġtelephone": 22488, + "ĠPhyt": 22489, + "Ġum": 22490, + "ĠAvailability": 22491, + "ĠTropical": 22492, + "ĠCases": 22493, + "Ġdescend": 22494, + "Har": 22495, + "âĪĹ": 22496, + "ĠâĨĵ": 22497, + "Ks": 22498, + "Ġê": 22499, + "oluble": 22500, + "Ġchampionship": 22501, + "ĠMovement": 22502, + "ĠXY": 22503, + "kappaB": 22504, + "years": 22505, + "memb": 22506, + "quine": 22507, + "Ġletting": 22508, + "Ġbiggest": 22509, + "Ġcards": 22510, + "Ġbiotin": 22511, + "ĠAur": 22512, + "modal": 22513, + "Ġvaccinated": 22514, + "Ġtranslates": 22515, + "ĠPAC": 22516, + "lli": 22517, + "reonine": 22518, + "Ġcurcumin": 22519, + "ĠConstruct": 22520, + "Ġconvinc": 22521, + "ĠNat": 22522, + "Ġamygdala": 22523, + "Ġprotr": 22524, + "ĠSingular": 22525, + "ĠContact": 22526, + "kind": 22527, + "ĠDaw": 22528, + "ogroup": 22529, + "ĠKCl": 22530, + "Ġhygi": 22531, + "erenced": 22532, + "Ġsurveyed": 22533, + "ĠMull": 22534, + "esthetic": 22535, + "Ġmsg": 22536, + "ĠRequire": 22537, + "Ġdistortions": 22538, + "Control": 22539, + "BERT": 22540, + "Ġautonomic": 22541, + "Ġhormonal": 22542, + "Ġstrips": 22543, + "Ġtrophic": 22544, + "ifting": 22545, + "opod": 22546, + "ĠSpontaneous": 22547, + "Ġlogs": 22548, + "OPT": 22549, + "ĠMot": 22550, + "ĠGmb": 22551, + "aharan": 22552, + "ĠPOL": 22553, + "Ġvisceral": 22554, + "blocks": 22555, + "Ġsitting": 22556, + "Ġsine": 22557, + "Ġoncogenic": 22558, + "ERRQ": 22559, + "quinone": 22560, + "Ġsmartphone": 22561, + "ĠTanz": 22562, + "lactam": 22563, + "ĠSignificance": 22564, + "Ġeu": 22565, + "ĠISS": 22566, + "ĠTrig": 22567, + "ĠMaj": 22568, + "tingale": 22569, + "Ġdilat": 22570, + "ennes": 22571, + "ĠBelgium": 22572, + "lev": 22573, + "ĠContr": 22574, + "ĠGalois": 22575, + "ĠCombination": 22576, + "ĠThi": 22577, + "ĠAustria": 22578, + "Prom": 22579, + "Ġelicit": 22580, + "biosis": 22581, + "Ġlymphatic": 22582, + "ĠMurray": 22583, + "ĠXPS": 22584, + "Ġcong": 22585, + "screen": 22586, + "tide": 22587, + "amoyl": 22588, + "ĠMcD": 22589, + "Ġretired": 22590, + "mixed": 22591, + "ELD": 22592, + "ĠMaps": 22593, + "ĠVE": 22594, + "cession": 22595, + "numer": 22596, + "idated": 22597, + "ĠBishop": 22598, + "Ġneonates": 22599, + "Ġlandsl": 22600, + "ĠFractional": 22601, + "Ġspecifying": 22602, + "ĠJr": 22603, + "Ġnanowire": 22604, + "Ġconsultation": 22605, + "language": 22606, + "Ġpricing": 22607, + "ĠLimitations": 22608, + "ĠPediatric": 22609, + "ĠDimension": 22610, + "Ġpreparing": 22611, + "Lag": 22612, + "segment": 22613, + "Ġspend": 22614, + "athe": 22615, + "Ġweap": 22616, + "ĠJos": 22617, + "textit": 22618, + "outputs": 22619, + "ordering": 22620, + "Ġplacenta": 22621, + "ationally": 22622, + "ĠKun": 22623, + "Ġoutstanding": 22624, + "Ġthicknesses": 22625, + "ĠChIP": 22626, + "deoxy": 22627, + "ĠZo": 22628, + "ĠDeveloping": 22629, + "Ġstringent": 22630, + "iency": 22631, + "perse": 22632, + "Ġpend": 22633, + "ĠDevelopmental": 22634, + "Ġextern": 22635, + "Ġinverter": 22636, + "ĠDAPI": 22637, + "lectivity": 22638, + "Ġtablets": 22639, + "Ġprogester": 22640, + "ĠïģŃ": 22641, + "Ġanswered": 22642, + "entary": 22643, + "ORS": 22644, + "Ġdir": 22645, + "Ġdeleterious": 22646, + "Ġdopaminergic": 22647, + "Random": 22648, + "diss": 22649, + "Ġmonolayers": 22650, + "Ġintegrand": 22651, + "ĠComponents": 22652, + "ĠPerc": 22653, + "agit": 22654, + "ARN": 22655, + "esophageal": 22656, + "ivan": 22657, + "neider": 22658, + "ĠStarting": 22659, + "PORT": 22660, + "yellow": 22661, + "Ġregisters": 22662, + "pairs": 22663, + "Ġethnicity": 22664, + "Ġboy": 22665, + "auti": 22666, + "Ġchromium": 22667, + "POS": 22668, + "vature": 22669, + "ayashi": 22670, + "Ġinappropriate": 22671, + "ĠSNA": 22672, + "Domain": 22673, + "ĠPrice": 22674, + "Ġmacular": 22675, + "Ġoverload": 22676, + "ĠUnified": 22677, + "Ġattach": 22678, + "ĠScottish": 22679, + "maps": 22680, + "agl": 22681, + "emi": 22682, + "Ġseam": 22683, + "ĠAnalog": 22684, + "dated": 22685, + "uo": 22686, + "Ġplated": 22687, + "Ġasset": 22688, + "Ġscreens": 22689, + "Ġspurious": 22690, + "Besides": 22691, + "Ġbaselines": 22692, + "heads": 22693, + "Ġcoat": 22694, + "ĠRemoval": 22695, + "Ġinfinitesimal": 22696, + "ĠTransformation": 22697, + "Ġcommens": 22698, + "Float": 22699, + "AUC": 22700, + "ĠLay": 22701, + "Ġintron": 22702, + "ĠDetecting": 22703, + "ĠHerein": 22704, + "ĠAssociations": 22705, + "Ġprogesterone": 22706, + "Bacteria": 22707, + "Ġsentiment": 22708, + "ĠPhenomen": 22709, + "matter": 22710, + "Ġcylinders": 22711, + "Ġtoluene": 22712, + "Ġspatiotemporal": 22713, + "Ġlanding": 22714, + "ĠCoronavirus": 22715, + "ĠBerry": 22716, + "ĠBragg": 22717, + "Ġregistry": 22718, + "Ġenthalpy": 22719, + "tica": 22720, + "razine": 22721, + "Ġcargo": 22722, + "otation": 22723, + "Ġcontradicts": 22724, + "Ġpesticides": 22725, + "ĠFischer": 22726, + "Ġmechanically": 22727, + "ĠInterfer": 22728, + "ĠCyp": 22729, + "ĠKas": 22730, + "Ġmetres": 22731, + "Ġantiretroviral": 22732, + "Ġtravers": 22733, + "selection": 22734, + "ĠWA": 22735, + "Ġdoublet": 22736, + "meta": 22737, + "ENTR": 22738, + "sonic": 22739, + "Ġmarking": 22740, + "ĠOverex": 22741, + "Ġpyruvate": 22742, + "Ġextrusion": 22743, + "Ġingestion": 22744, + "Ġcocaine": 22745, + "ĠFellow": 22746, + "CNTs": 22747, + "BG": 22748, + "ĠMorphological": 22749, + "Ġdefence": 22750, + "ĠYosh": 22751, + "mitter": 22752, + "rystallization": 22753, + "STRACT": 22754, + "Ġinflammasome": 22755, + "ĠGd": 22756, + "Ġshaft": 22757, + "Ġeruption": 22758, + "ĠOxide": 22759, + "ifolds": 22760, + "ĠGam": 22761, + "ĠGap": 22762, + "command": 22763, + "ĠIgA": 22764, + "Ġshortening": 22765, + "assembled": 22766, + "isopropyl": 22767, + "Ġalumina": 22768, + "ĠATM": 22769, + "Ġct": 22770, + "Ġspinning": 22771, + "ĠPetsc": 22772, + "prefix": 22773, + "Ġperpetuity": 22774, + "PRE": 22775, + "Ġfruct": 22776, + "GHz": 22777, + "elike": 22778, + "enyl": 22779, + "Ġwherein": 22780, + "UK": 22781, + "visual": 22782, + "lipidemia": 22783, + "reduction": 22784, + "anin": 22785, + "olas": 22786, + "Ġamplic": 22787, + "ĠSAT": 22788, + "Ġmodulator": 22789, + "forth": 22790, + "rl": 22791, + "Ġcrew": 22792, + "ĠiP": 22793, + "Ġxi": 22794, + "ADD": 22795, + "ĠAlexand": 22796, + "constrained": 22797, + "ratory": 22798, + "ĠkW": 22799, + "ĠMDR": 22800, + "ĠlncRNA": 22801, + "Mill": 22802, + "ĠMgO": 22803, + "circuit": 22804, + "Ġpersonalized": 22805, + "ĠOperator": 22806, + "stock": 22807, + "ĠPSA": 22808, + "ensable": 22809, + "Ġlean": 22810, + "yield": 22811, + "Ġopacity": 22812, + "ĠCommons": 22813, + "Ġsummed": 22814, + "ucker": 22815, + "ecke": 22816, + "epithelial": 22817, + "Ġasking": 22818, + "uese": 22819, + "ĠFlav": 22820, + "Ġlactic": 22821, + "Ġlubric": 22822, + "Ġisn": 22823, + "regions": 22824, + "support": 22825, + "Below": 22826, + "ĠNom": 22827, + "Ġhyal": 22828, + "ikh": 22829, + "ban": 22830, + "ĠBG": 22831, + "rometer": 22832, + "indic": 22833, + "opharyngeal": 22834, + "ITION": 22835, + "ĠPropagation": 22836, + "ĠPlace": 22837, + "ĠCircuit": 22838, + "ĠCOL": 22839, + "Green": 22840, + "Ir": 22841, + "lav": 22842, + "ĠdS": 22843, + "ĠMoment": 22844, + "Ġinducible": 22845, + "Ġdischarges": 22846, + "habdi": 22847, + "ĠExperience": 22848, + "Ġsg": 22849, + "Ġoutward": 22850, + "Ġportable": 22851, + "ĠOperators": 22852, + "Av": 22853, + "ĠDQ": 22854, + "ostatin": 22855, + "Ġeosinophil": 22856, + "Ġstriatum": 22857, + "ĠConsensus": 22858, + "Ġimperfect": 22859, + "NOT": 22860, + "ĠDemocratic": 22861, + ";;": 22862, + "Body": 22863, + "dii": 22864, + "Ho": 22865, + "ĠRailway": 22866, + "ĠUganda": 22867, + "Ġunpaired": 22868, + "friendly": 22869, + "Ġreprogramming": 22870, + "Alternative": 22871, + "RG": 22872, + "imet": 22873, + "enez": 22874, + "ĠHypothesis": 22875, + "Ġton": 22876, + "ĠCombin": 22877, + "ĠDelivery": 22878, + "Last": 22879, + "Ġowners": 22880, + "razole": 22881, + "ĠKob": 22882, + "Ġformats": 22883, + "Ġpolyclonal": 22884, + "Ġidentifier": 22885, + "ILL": 22886, + "Ġsurgeon": 22887, + "Ġpostp": 22888, + "ĠGenerative": 22889, + "ĠMall": 22890, + "abc": 22891, + "ĠHaz": 22892, + "Ġsmoothly": 22893, + "Ġcrystallographic": 22894, + "ĠFDA": 22895, + "Ġcoexistence": 22896, + "ionized": 22897, + "Ġcompiler": 22898, + "ĠArter": 22899, + "Ġappearances": 22900, + "amiltonian": 22901, + "Ġencapsulated": 22902, + "atia": 22903, + "wi": 22904, + "reb": 22905, + "Ġwafer": 22906, + "ubs": 22907, + "ĠUE": 22908, + "ĠGSK": 22909, + "Ġviv": 22910, + "Ġflooding": 22911, + "ĠGyr": 22912, + "Ġstably": 22913, + "Ġdislocations": 22914, + "Ġescap": 22915, + "ĠPhysiological": 22916, + "tidal": 22917, + "yme": 22918, + "ĠMaxim": 22919, + "iterator": 22920, + "ordant": 22921, + "Ġattentional": 22922, + "Ġcatalyzed": 22923, + "ĠTryp": 22924, + "PIN": 22925, + "ĠCorrelations": 22926, + "Ġhydrological": 22927, + "Ġnose": 22928, + "export": 22929, + "Ġdext": 22930, + "ĠBenef": 22931, + "ĠBiosystems": 22932, + "ĠPars": 22933, + "Ġreadings": 22934, + "Ġinstrumentation": 22935, + "ĠIQ": 22936, + "RIC": 22937, + "Ġgrafts": 22938, + "overs": 22939, + "ĠMedic": 22940, + "Ġmonod": 22941, + "Ġuniformity": 22942, + "ĠATLAS": 22943, + "Ġmasked": 22944, + "Ri": 22945, + "ĠPhysic": 22946, + "Ġimposing": 22947, + "ĠParad": 22948, + "imetic": 22949, + "Ġdemanding": 22950, + "unks": 22951, + "Ġfolds": 22952, + "ĠAnc": 22953, + "Ġvolatility": 22954, + "Ġbringing": 22955, + "acil": 22956, + "ĠNMDA": 22957, + "reduced": 22958, + "tii": 22959, + "Ġnorthwest": 22960, + "ĠBessel": 22961, + "ventions": 22962, + "Ġconsolidation": 22963, + "Meier": 22964, + "Ġmicrof": 22965, + "Ġqualified": 22966, + "Ġinsignificant": 22967, + "ĠMorphology": 22968, + "Ġpointwise": 22969, + "Ġlearns": 22970, + "Ġguard": 22971, + "CHECK": 22972, + "phonon": 22973, + "ĠEnhancement": 22974, + "Ġzonal": 22975, + "ERG": 22976, + "Start": 22977, + "Ġhistoric": 22978, + "ĠPure": 22979, + "ĠGmbH": 22980, + "glu": 22981, + "Ġpatterning": 22982, + "Ġstick": 22983, + "uminosity": 22984, + "Dataset": 22985, + "Ġoverride": 22986, + "ĠSteel": 22987, + "Ġfuels": 22988, + "mechanical": 22989, + "Ġautologous": 22990, + "Ġdepartments": 22991, + "ĠBlo": 22992, + "Ġimported": 22993, + "Ġrestrictive": 22994, + "eigen": 22995, + "ĠRome": 22996, + "ĠÌĬ": 22997, + "Ġepitopes": 22998, + "Ġlabelling": 22999, + "Ġownership": 23000, + "ĠEspecially": 23001, + "Ġcoffee": 23002, + "ĠGRB": 23003, + "Head": 23004, + "ĠVent": 23005, + "esare": 23006, + "ĠParticles": 23007, + "UNCTION": 23008, + "jj": 23009, + "uents": 23010, + "elic": 23011, + "ĠTat": 23012, + "ĠFle": 23013, + "Ġgating": 23014, + "Ġrefuge": 23015, + "Additionally": 23016, + "Ġrhs": 23017, + "Ġmaybe": 23018, + "ĠFang": 23019, + "Ġadvent": 23020, + "otransferase": 23021, + "should": 23022, + "Ġproteomic": 23023, + "Ġlegitim": 23024, + "PERIM": 23025, + "ĠGiant": 23026, + "Ġgraphics": 23027, + "onomical": 23028, + "scatter": 23029, + "Ġsuggestive": 23030, + "plots": 23031, + "Ġmultidrug": 23032, + "Ġabsorber": 23033, + "XS": 23034, + "consuming": 23035, + "Ġsustainability": 23036, + "opre": 23037, + "fix": 23038, + "Ġvolcano": 23039, + "ĠTypes": 23040, + "ĠCreate": 23041, + "Ġchooses": 23042, + "Ġstirring": 23043, + "Ġsurgeons": 23044, + "dS": 23045, + "Ġcharacterizes": 23046, + "Ġadjustments": 23047, + "texttt": 23048, + "etra": 23049, + "Ġclassifications": 23050, + "spots": 23051, + "Ġâϝ": 23052, + "erex": 23053, + "dehyd": 23054, + "ĠBrig": 23055, + "ĠSuperconduc": 23056, + "Ġgrants": 23057, + "ĠCen": 23058, + "ĠYin": 23059, + "ĠReactions": 23060, + "description": 23061, + "transcription": 23062, + "important": 23063, + "Ġhemodynamic": 23064, + "ĠYi": 23065, + "ĠGolden": 23066, + "kk": 23067, + "alb": 23068, + "Ġrooms": 23069, + "Ġsegreg": 23070, + "Ġsumming": 23071, + "Ġsuccession": 23072, + "Ġfollicular": 23073, + "Ġtackle": 23074, + "Down": 23075, + "Ġevaluates": 23076, + "atica": 23077, + "annual": 23078, + "ĠAlbert": 23079, + "Ġtal": 23080, + "orbital": 23081, + "fted": 23082, + "variables": 23083, + "Ġwetland": 23084, + "outheastern": 23085, + "MEM": 23086, + "ĠBrill": 23087, + "ĠSodium": 23088, + "ĠAlexa": 23089, + "umed": 23090, + "BUG": 23091, + "arine": 23092, + "Ġrevenue": 23093, + "habditis": 23094, + "Ġdissol": 23095, + "amplitude": 23096, + "Ġartists": 23097, + "Ġnormalised": 23098, + "Ġfluctuating": 23099, + "Ġaspar": 23100, + "ĠFi": 23101, + "olates": 23102, + "ispanic": 23103, + "Ġacetylation": 23104, + "ĠConcentration": 23105, + "Ġthro": 23106, + "shots": 23107, + "Ġnarrative": 23108, + "ĠWaals": 23109, + "ammonium": 23110, + "ureau": 23111, + "------------": 23112, + "Ġresearches": 23113, + "Ġbaby": 23114, + "Ġsharply": 23115, + "ÙĦ": 23116, + "ĠCel": 23117, + "CX": 23118, + "uminal": 23119, + "Ġgermline": 23120, + "ĠTransformer": 23121, + "pseud": 23122, + "HG": 23123, + "Ka": 23124, + "ĠSMC": 23125, + "ĠNutrition": 23126, + "Ġbarc": 23127, + "ĠWrite": 23128, + "Ġproteases": 23129, + "Ġsweep": 23130, + "ĠKolmogorov": 23131, + "morph": 23132, + "inducible": 23133, + "Ġexciting": 23134, + "lein": 23135, + "ĠHass": 23136, + "Ġproductive": 23137, + "mesh": 23138, + "ĠCMS": 23139, + "Ġheavier": 23140, + "Ġmeetings": 23141, + "ĠCopper": 23142, + "Ġvirtue": 23143, + "asant": 23144, + "ĠDEN": 23145, + "Ġinherently": 23146, + "rio": 23147, + "Ġhoused": 23148, + "Ġintraoperative": 23149, + "Ġcrown": 23150, + "conditions": 23151, + "ANG": 23152, + "YSIS": 23153, + "iman": 23154, + "Ġnmol": 23155, + "ĠRetrieval": 23156, + "algae": 23157, + "Ġkappa": 23158, + "deep": 23159, + "inence": 23160, + "ĠCarcinoma": 23161, + "Ġchromatographic": 23162, + "Ġascribed": 23163, + "Ġleverage": 23164, + "ĠKK": 23165, + "omyel": 23166, + "pet": 23167, + "ĠNJ": 23168, + "comm": 23169, + "Ġannually": 23170, + "gran": 23171, + "Ġaval": 23172, + "ĠNish": 23173, + "Ġevac": 23174, + "Ġmultif": 23175, + "Ġfunds": 23176, + "enny": 23177, + "ĠMong": 23178, + "ĠException": 23179, + "paths": 23180, + "ymen": 23181, + "hpp": 23182, + "Ġrestricting": 23183, + "saturated": 23184, + "âĻ": 23185, + "Ġlearners": 23186, + "ĠLanka": 23187, + "inities": 23188, + "ĠGDP": 23189, + "Ġspeciation": 23190, + "Ġensured": 23191, + "Ġneutralizing": 23192, + "Ġballoon": 23193, + "Comparison": 23194, + "ĠCalibration": 23195, + "ĠInfluenza": 23196, + "Ġvapour": 23197, + "XA": 23198, + "tracking": 23199, + "ĠICD": 23200, + "fluoro": 23201, + "ĠDamage": 23202, + "Ġpra": 23203, + "Ġconceived": 23204, + "ĠCosmological": 23205, + "Ġloose": 23206, + "inositol": 23207, + "ĠClifford": 23208, + "owa": 23209, + "Ġoffsets": 23210, + "document": 23211, + "Ġenormous": 23212, + "Ġphotoelectron": 23213, + "record": 23214, + "esticular": 23215, + "Ġvocals": 23216, + "Ġconsciousness": 23217, + "Ġtrem": 23218, + "Ġlandscapes": 23219, + "ĠFundamental": 23220, + "tebrate": 23221, + "Ġvertebral": 23222, + "Ġregenerative": 23223, + "Ġtroposp": 23224, + "Integr": 23225, + "Ġassociates": 23226, + "oved": 23227, + "ussed": 23228, + "aws": 23229, + "ĠSide": 23230, + "Ġinterconnected": 23231, + "Ġsuperfamily": 23232, + "ĠCook": 23233, + "loader": 23234, + "Ġpython": 23235, + "ĠCounter": 23236, + "books": 23237, + "Ġïģ²": 23238, + "breaking": 23239, + "gy": 23240, + "Ġcarbox": 23241, + "Ġedited": 23242, + "otyped": 23243, + "Ġduoden": 23244, + "anne": 23245, + "Ġanastom": 23246, + "ginate": 23247, + "ĠBiosciences": 23248, + "rage": 23249, + "ĠChiral": 23250, + "Ġsimplifies": 23251, + "Ġtestis": 23252, + "ström": 23253, + "ials": 23254, + "Ġmicelles": 23255, + "correct": 23256, + "ĠGenetics": 23257, + "along": 23258, + "Rem": 23259, + "resistance": 23260, + "Ġdrink": 23261, + "orbed": 23262, + "ĠTreat": 23263, + "ĠSho": 23264, + "shows": 23265, + "ér": 23266, + "Ġmimics": 23267, + "occup": 23268, + "eclam": 23269, + "ONG": 23270, + "Ġmarketing": 23271, + "ĠFinding": 23272, + "Ġendometri": 23273, + "âĶĢ": 23274, + "strained": 23275, + "ĠMuch": 23276, + "Ġexons": 23277, + "ĠHil": 23278, + "TD": 23279, + "ĠWW": 23280, + "ĠVic": 23281, + "enda": 23282, + "Ġfactory": 23283, + "ĠHepG": 23284, + "ĠStatic": 23285, + "blastoma": 23286, + "wd": 23287, + "raisal": 23288, + "ĠBasis": 23289, + "Ins": 23290, + "ĠUnsupervised": 23291, + "elo": 23292, + "oselective": 23293, + "Ġaccomplish": 23294, + "ĠProspective": 23295, + "Ġuncorrelated": 23296, + "ĠGate": 23297, + "icycl": 23298, + "Ġurgent": 23299, + "ĠPathways": 23300, + "Ġoblique": 23301, + "ĠIndividuals": 23302, + "Ġinitiative": 23303, + "Ġcatast": 23304, + "jections": 23305, + "Ġautosomal": 23306, + "ĠPhilip": 23307, + "Ġcomprehension": 23308, + "mM": 23309, + "pain": 23310, + "ĠmicroM": 23311, + "Ġencounters": 23312, + "goto": 23313, + "Ġladder": 23314, + "Ġoccupy": 23315, + "ĠSurfaces": 23316, + "Doc": 23317, + "ugby": 23318, + "Ġexamines": 23319, + "osynthesis": 23320, + "ĠKEGG": 23321, + "glass": 23322, + "slice": 23323, + "propagation": 23324, + "stry": 23325, + "Ġillustrating": 23326, + "imi": 23327, + "Ġspores": 23328, + "Ġastrophysical": 23329, + "Ġenclosed": 23330, + "Ġinferences": 23331, + "Ġbijection": 23332, + "Ġeveryday": 23333, + "Ġalternatively": 23334, + "reaction": 23335, + "iants": 23336, + "contact": 23337, + "Ġging": 23338, + "ĠBias": 23339, + "Ġautomaton": 23340, + "background": 23341, + "Ġneighbouring": 23342, + "Ġdetects": 23343, + "porate": 23344, + "ĠSharma": 23345, + "Hydro": 23346, + "Ġsacc": 23347, + "ĠFiber": 23348, + "ĠChlam": 23349, + "Ġbuffers": 23350, + "Applying": 23351, + "lceil": 23352, + "emph": 23353, + "ĠGSE": 23354, + "metry": 23355, + "Ġimmunost": 23356, + "ĠHistorical": 23357, + "ĠDrag": 23358, + "Ġtransplanted": 23359, + "Ġfrail": 23360, + "Ġanthocyan": 23361, + "inte": 23362, + "ĠBhat": 23363, + "ĠOg": 23364, + "Ġsteering": 23365, + "benzene": 23366, + "****************************************************************": 23367, + "Ġsynthet": 23368, + "Act": 23369, + "Ġcin": 23370, + "Ġherbal": 23371, + "Ġdyn": 23372, + "Ġhyperplasia": 23373, + "header": 23374, + "Ġcalculates": 23375, + "ĠDifference": 23376, + "Ġbats": 23377, + "ductivity": 23378, + "Ġconformations": 23379, + "city": 23380, + "Ġseparates": 23381, + "ĠCDC": 23382, + "ĠPrism": 23383, + "ĠBehaviour": 23384, + "ĠKelly": 23385, + "ĠSey": 23386, + "ĠÃł": 23387, + "LEX": 23388, + "gkin": 23389, + "strom": 23390, + "Ġvom": 23391, + "ĠWin": 23392, + "ĠWigner": 23393, + "Ġcontralateral": 23394, + "ĠMinor": 23395, + "Ġstereo": 23396, + "ĠApproximately": 23397, + "LED": 23398, + "say": 23399, + "ĠJS": 23400, + "Ġalcohols": 23401, + "Ġsan": 23402, + "Ġhardening": 23403, + "IFN": 23404, + "Ġretrospectively": 23405, + "Ġgeneralised": 23406, + "Ġtibial": 23407, + "ĠWeek": 23408, + "Ġaryl": 23409, + "ĠPeninsula": 23410, + "Ġdeterminations": 23411, + "Ġphotovoltaic": 23412, + "Ġsuggestion": 23413, + "Jac": 23414, + "ĠVitro": 23415, + "Ġcyclo": 23416, + "Ġfibrous": 23417, + "disambiguation": 23418, + "program": 23419, + "Ġguest": 23420, + "ĠDust": 23421, + "rceil": 23422, + "Ġpowered": 23423, + "Ġcardiomyocytes": 23424, + "heat": 23425, + "ylic": 23426, + "Ġpresentations": 23427, + "Ġtransmitting": 23428, + "WD": 23429, + "added": 23430, + "Initial": 23431, + "Del": 23432, + "ĠVelocity": 23433, + "Ġmole": 23434, + "Ġoval": 23435, + "Ġplankton": 23436, + "their": 23437, + "ĠQED": 23438, + "volutions": 23439, + "Ġmandatory": 23440, + "Ġrepulsive": 23441, + "ĉĠĠ": 23442, + "Ġpostulated": 23443, + "ĠCortex": 23444, + "ĠCarb": 23445, + "CHKERRQ": 23446, + "Ġoverlay": 23447, + "ĠFarm": 23448, + "enorhabditis": 23449, + "Ġposed": 23450, + "Ġinstanti": 23451, + "ZT": 23452, + "ĠVisualization": 23453, + "ĠGAPDH": 23454, + "lecom": 23455, + "ochron": 23456, + "ĠBj": 23457, + "ĠTrib": 23458, + "Ġbyte": 23459, + "Ġsuperimposed": 23460, + "Ġundi": 23461, + "Ġaccelerator": 23462, + "criptions": 23463, + "ĠSmooth": 23464, + "Ġzip": 23465, + "nesota": 23466, + "ĠEFF": 23467, + "ĠCole": 23468, + "ĠBru": 23469, + "rend": 23470, + "utz": 23471, + "Ġdiagnose": 23472, + "basis": 23473, + "diamond": 23474, + "ĠInn": 23475, + "ĠMedian": 23476, + "Ġmarginally": 23477, + "Ġlemmas": 23478, + "rectomy": 23479, + "Ġdialogue": 23480, + "ĠBrid": 23481, + "Ġå": 23482, + "oxane": 23483, + "aris": 23484, + "Ġmunicipality": 23485, + "Ġproducers": 23486, + "Regarding": 23487, + "ĠFV": 23488, + "ideal": 23489, + "exponential": 23490, + "Label": 23491, + "ĠFrobenius": 23492, + "Ġell": 23493, + "ĠLTE": 23494, + "Ġlipase": 23495, + "rp": 23496, + "Ġdm": 23497, + "otri": 23498, + "cloud": 23499, + "ĠAgent": 23500, + "MSCs": 23501, + "osom": 23502, + "hydropy": 23503, + "neurons": 23504, + "Ġsolvable": 23505, + "ducting": 23506, + "Ġrendered": 23507, + "Ġattractor": 23508, + "Ġbrac": 23509, + "Ãģ": 23510, + "Ġhosted": 23511, + "ĠOct": 23512, + "Ġguiding": 23513, + "Ġdigestive": 23514, + "js": 23515, + "Ġintent": 23516, + "flux": 23517, + "Ġbiosynthetic": 23518, + "Ġelections": 23519, + "ĠWilcoxon": 23520, + "Ġspectrophotometer": 23521, + "Ġimpairs": 23522, + "Ġabdomen": 23523, + "kb": 23524, + "ĠWho": 23525, + "ASSERT": 23526, + "Ġeluted": 23527, + "Ġmaximization": 23528, + "Ġcollector": 23529, + "ĠPreviously": 23530, + "aq": 23531, + "ambo": 23532, + "ĠOz": 23533, + "Cur": 23534, + "Ġcaffeine": 23535, + "Mass": 23536, + "pal": 23537, + "piece": 23538, + "ouville": 23539, + "ĠMeyer": 23540, + "uta": 23541, + "chan": 23542, + "ĠKS": 23543, + "omotor": 23544, + "ĠGPR": 23545, + "Ġeval": 23546, + "ĠCooperative": 23547, + "oglycan": 23548, + "Ġnozzle": 23549, + "ĠShel": 23550, + "Ġinterchange": 23551, + "Ġundergrad": 23552, + "Ġexplanatory": 23553, + "Ġphagocytosis": 23554, + "Ġctx": 23555, + "hess": 23556, + "Ġuniversality": 23557, + "ĠKilling": 23558, + "onsin": 23559, + "Ġlasting": 23560, + "ĠImm": 23561, + "Ġconcordance": 23562, + "yma": 23563, + "Ġautumn": 23564, + "Ġbarley": 23565, + "Ġconsequent": 23566, + "isi": 23567, + "Ġconjugates": 23568, + "Ġtaught": 23569, + "Ġcovariate": 23570, + "Ġadolescence": 23571, + "Ġvillages": 23572, + "Ġeigenfunctions": 23573, + "Ġtemporally": 23574, + "ĠMinnesota": 23575, + "yrate": 23576, + "iesis": 23577, + "definite": 23578, + "Ġalphabet": 23579, + "ĠYun": 23580, + "ĠMAR": 23581, + "Ġsealed": 23582, + "ronectin": 23583, + "ĠSepar": 23584, + "nx": 23585, + "CAA": 23586, + "Ġreception": 23587, + "ucky": 23588, + "ĠPTEN": 23589, + "ĠMorgan": 23590, + "Ġdiodes": 23591, + "Ġmetformin": 23592, + "Ġsynthes": 23593, + "ĠParticip": 23594, + "ĠJersey": 23595, + "Ġamphib": 23596, + "chel": 23597, + "Ġlamp": 23598, + "ĠHels": 23599, + "ĠFN": 23600, + "Ġexcav": 23601, + "isecond": 23602, + "intro": 23603, + "Ġnoncommutative": 23604, + "Ġsubsystems": 23605, + "summ": 23606, + "Ġcontrasting": 23607, + "ĠSilicon": 23608, + "ĠPartition": 23609, + "GlcNAc": 23610, + "Ġdiscern": 23611, + "ĠBounds": 23612, + "ĠRah": 23613, + "Ġapproximating": 23614, + "ĠHypert": 23615, + "ĠDil": 23616, + "Ġcompactness": 23617, + "Ġcaught": 23618, + "ĠImprove": 23619, + "ĠToronto": 23620, + "ĠBiomark": 23621, + "ĠBag": 23622, + "ĠInvent": 23623, + "Ġelaborate": 23624, + "ĠMott": 23625, + "ABC": 23626, + "ĠGraham": 23627, + "Ġpoultry": 23628, + "ĠConjecture": 23629, + "ĠAlgebras": 23630, + "ĠNLO": 23631, + "apsing": 23632, + "pathy": 23633, + "ĠElizabeth": 23634, + "ĠTit": 23635, + "ĠSCI": 23636, + "anton": 23637, + "Ġvoting": 23638, + "mathrel": 23639, + "ĠFord": 23640, + "igibility": 23641, + "Ġallergy": 23642, + "acoustic": 23643, + "ĠDyn": 23644, + "ĠDSC": 23645, + "ĠGRO": 23646, + "ĠThirty": 23647, + "Ġanalysing": 23648, + "ĠEmpire": 23649, + "fire": 23650, + "Ġpathologic": 23651, + "Ġpatent": 23652, + "Ġheard": 23653, + "ĠFront": 23654, + "isconsin": 23655, + "hypert": 23656, + "uzumab": 23657, + "ĠMutation": 23658, + "Ġbiliary": 23659, + "Ġsuperfluid": 23660, + "ĠWC": 23661, + "ustom": 23662, + "ĠActivities": 23663, + "Ġpolypeptide": 23664, + "heets": 23665, + "Ġborders": 23666, + "early": 23667, + "Ġorthogon": 23668, + "Ġbulge": 23669, + "ï£": 23670, + "Ġconical": 23671, + "ĠLept": 23672, + "Ġelectrolytes": 23673, + "Ġ«": 23674, + "regulating": 23675, + "Ġviolated": 23676, + "âĺ": 23677, + "ALT": 23678, + "ĠWorks": 23679, + "ĠHepat": 23680, + "urgical": 23681, + "obar": 23682, + "ĠReactive": 23683, + "possibly": 23684, + "ĠAdsorption": 23685, + "ĠRio": 23686, + "anoic": 23687, + "ĠâĨij": 23688, + "Ġintriguing": 23689, + "Ġom": 23690, + "hertz": 23691, + "ĠApproximate": 23692, + "ĠParent": 23693, + "Ġcoin": 23694, + "expand": 23695, + "в": 23696, + "Ġnonparametric": 23697, + "extern": 23698, + "aeus": 23699, + "glycerol": 23700, + "Ġcp": 23701, + "Ġbatches": 23702, + "Ġnanomaterials": 23703, + "Use": 23704, + "ĠVivo": 23705, + "Rh": 23706, + "Ġtiles": 23707, + "Ġdepict": 23708, + "Ġsouthwest": 23709, + "ĠCasimir": 23710, + "layered": 23711, + "ĠLeaf": 23712, + "fem": 23713, + "bered": 23714, + "Ġsubalgebra": 23715, + "Ġdetachment": 23716, + "ĠLeuk": 23717, + "olus": 23718, + "ĠRick": 23719, + "Ġabortion": 23720, + "Ġclarified": 23721, + "Ġganglia": 23722, + "QS": 23723, + "oising": 23724, + "ĠForward": 23725, + "ĠPeripheral": 23726, + "shifted": 23727, + "bula": 23728, + "ramolecular": 23729, + "ĠFEM": 23730, + "ĠProton": 23731, + "AME": 23732, + "Ġschedules": 23733, + "Ġaa": 23734, + "ĠUDP": 23735, + "stere": 23736, + "Ġmorphine": 23737, + "Ġspecialist": 23738, + "ĠAndroid": 23739, + "Identif": 23740, + "Ġunexpl": 23741, + "Ġheterozyg": 23742, + "Ġfid": 23743, + "pyridyl": 23744, + "ĠWy": 23745, + "phosphor": 23746, + "Ġfriendly": 23747, + "Ġmicrol": 23748, + "ĠSplit": 23749, + "agner": 23750, + "cribe": 23751, + "Ġmoth": 23752, + "ĠEuro": 23753, + "igs": 23754, + "ĠConditional": 23755, + "ĠStewart": 23756, + "properties": 23757, + "ASC": 23758, + "ĠTraditional": 23759, + "ĠPortugal": 23760, + "Ġearned": 23761, + "Ġcathe": 23762, + "Create": 23763, + "iciencies": 23764, + "Ġsphing": 23765, + "xml": 23766, + "Ġimmunomod": 23767, + "Ġcommute": 23768, + "Ġselenium": 23769, + "anges": 23770, + "hook": 23771, + "denoted": 23772, + "Ġjustify": 23773, + "ĠPool": 23774, + "Ġguinea": 23775, + "Ġcontra": 23776, + "Ġfolded": 23777, + "Ġlisting": 23778, + "ĠLG": 23779, + "ĠLane": 23780, + "Ġsurely": 23781, + "vet": 23782, + "fluorophenyl": 23783, + "Ġcorona": 23784, + "ĠAbund": 23785, + "ĠObjects": 23786, + "Ġtrough": 23787, + "cht": 23788, + "Ġdish": 23789, + "ithi": 23790, + "ĠMatlab": 23791, + "worm": 23792, + "Ġproteomics": 23793, + "Ġintermolecular": 23794, + "ĠPeters": 23795, + "Ġmirrors": 23796, + "quinoline": 23797, + "artens": 23798, + "ĠJewish": 23799, + "kB": 23800, + "ĠDegradation": 23801, + "Ġreleasing": 23802, + "VEGF": 23803, + "Ġsubpopulations": 23804, + "ĠTraffic": 23805, + "Ġproline": 23806, + "ĠHf": 23807, + "Ġadren": 23808, + "birth": 23809, + "Ġsender": 23810, + "Ġatlas": 23811, + "Ġworkplace": 23812, + "Ġreflectivity": 23813, + "ĠExistence": 23814, + "cls": 23815, + "Ġfiner": 23816, + "Ġbreastfeeding": 23817, + "onectin": 23818, + "Ġcogn": 23819, + "ellate": 23820, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 23821, + "byte": 23822, + "Ġsket": 23823, + "NULL": 23824, + "systems": 23825, + "ĠBranch": 23826, + "ĠProposed": 23827, + "learn": 23828, + "Ġtolerant": 23829, + "Ġvertebrates": 23830, + "Ġmultilevel": 23831, + "ĠPAH": 23832, + "Ġaudience": 23833, + "ĠWL": 23834, + "nitrop": 23835, + "ĠCt": 23836, + "Ġsativa": 23837, + "eight": 23838, + "Ġmeg": 23839, + "ocell": 23840, + "Ġstating": 23841, + "dominant": 23842, + "bytes": 23843, + "Ġpu": 23844, + "ĠBatter": 23845, + "otaxis": 23846, + "ĠEBV": 23847, + "Ġnanocrystals": 23848, + "Ġmonopole": 23849, + "Ġdiaphrag": 23850, + "ĠVel": 23851, + "Appendix": 23852, + "atten": 23853, + "impl": 23854, + "Ġlandmark": 23855, + "enclature": 23856, + "ĠSTAR": 23857, + "Ġprostagland": 23858, + "oprotective": 23859, + "Ġloadings": 23860, + "ĠPresence": 23861, + "ĠNSF": 23862, + "resses": 23863, + "FU": 23864, + "ilers": 23865, + "Ġerythrocytes": 23866, + "trac": 23867, + "islation": 23868, + "ĠNight": 23869, + "Ġsteroids": 23870, + "tiz": 23871, + "ĠDMA": 23872, + "Ġric": 23873, + "Ġsalient": 23874, + "ĠFur": 23875, + "special": 23876, + "Ġbioinformatics": 23877, + "ignant": 23878, + "ĠEXPERIM": 23879, + "avorable": 23880, + "disk": 23881, + "Ġcurriculum": 23882, + "imidazol": 23883, + "higher": 23884, + "Ġdesigner": 23885, + "ĠStrength": 23886, + "Ġcytosol": 23887, + "ĠChannels": 23888, + "Land": 23889, + "spar": 23890, + "Expression": 23891, + "Ġdaytime": 23892, + "mercial": 23893, + "vbox": 23894, + "inar": 23895, + "ieving": 23896, + "cein": 23897, + "ĠNCBI": 23898, + "RAN": 23899, + "¸Ģ": 23900, + "Hig": 23901, + "ĠDHA": 23902, + "Ġsubscript": 23903, + "Ġ¢": 23904, + "orange": 23905, + "Ġknows": 23906, + "ĠNAF": 23907, + "produced": 23908, + "epid": 23909, + "Ġdexamethasone": 23910, + "Ġformaldehyde": 23911, + "yll": 23912, + "Ġectopic": 23913, + "ĠVerification": 23914, + "activating": 23915, + "ĠIG": 23916, + "ĠPav": 23917, + "Ġtrading": 23918, + "Ġgraduate": 23919, + "ĠFIR": 23920, + "encil": 23921, + "every": 23922, + "Ġradiological": 23923, + "ĠMammalian": 23924, + "MES": 23925, + "inium": 23926, + "ĠSAS": 23927, + "ĠWH": 23928, + "Override": 23929, + "ĠScheduling": 23930, + "ĠBes": 23931, + "ĠYao": 23932, + "Ġglad": 23933, + "ĠStandards": 23934, + "Ġprovinces": 23935, + "eners": 23936, + "Ġnr": 23937, + "Ġtranspos": 23938, + "ĠCarib": 23939, + "Ġfauna": 23940, + "umi": 23941, + "reset": 23942, + "Ġsupra": 23943, + "Ġdivisions": 23944, + "Ġbiodegrad": 23945, + "metrics": 23946, + "ografts": 23947, + "Ġfunctors": 23948, + "Ġsupportive": 23949, + "Ġcaudal": 23950, + "Ġexerts": 23951, + "Ġcub": 23952, + "odimer": 23953, + "Ġairborne": 23954, + "Ġdelivering": 23955, + "Ġmultivariable": 23956, + "Ġfurnace": 23957, + "Ġremnant": 23958, + "Ġinco": 23959, + "ĠElectromagnetic": 23960, + "mapping": 23961, + "Ġdeclines": 23962, + "cold": 23963, + "ĠSeed": 23964, + "conversion": 23965, + "Ġglycogen": 23966, + "dT": 23967, + "awi": 23968, + "APP": 23969, + "Hol": 23970, + "atalysts": 23971, + "ĠSatellite": 23972, + "garis": 23973, + "card": 23974, + "ĠBreak": 23975, + "ĠAgainst": 23976, + "ddot": 23977, + "Ġpruning": 23978, + "ĠCaenorhabditis": 23979, + "Ġsucceeded": 23980, + "ubert": 23981, + "ĠÏħ": 23982, + "IDs": 23983, + "Ġasymptotics": 23984, + "Ġautoanti": 23985, + "ĠScalar": 23986, + "Ġnematode": 23987, + "hd": 23988, + "Ġgyn": 23989, + "istocene": 23990, + "Ġunderground": 23991, + "ĠEthical": 23992, + "Ġsial": 23993, + "ĠMigration": 23994, + "cope": 23995, + "Ġstigma": 23996, + "Ġeleven": 23997, + "Ġcoloring": 23998, + "initions": 23999, + "ĠJay": 24000, + "oba": 24001, + "ĠLDA": 24002, + "Ġbuilds": 24003, + "gences": 24004, + "ĠEcology": 24005, + "scheme": 24006, + "ĠUltras": 24007, + "Ġmediation": 24008, + "ĠTaq": 24009, + "Ġflying": 24010, + "ĠEquilibrium": 24011, + "ophosphate": 24012, + "ĠArgentina": 24013, + "psia": 24014, + "ttes": 24015, + "Ġdisparity": 24016, + "Ġadvertis": 24017, + "aggreg": 24018, + "ISA": 24019, + "odem": 24020, + "ĠRational": 24021, + "Ġsilent": 24022, + "divided": 24023, + "Pan": 24024, + "JA": 24025, + "claim": 24026, + "Ġradioactive": 24027, + "Ġpink": 24028, + "Ġconverse": 24029, + "ĠMell": 24030, + "enib": 24031, + "ruskal": 24032, + "slope": 24033, + "henol": 24034, + "ĠPon": 24035, + "partition": 24036, + "SMGR": 24037, + "titled": 24038, + "ĠInterference": 24039, + "tosecond": 24040, + "Ġseq": 24041, + "Ġtransitive": 24042, + "ĠWid": 24043, + "reviewed": 24044, + "×¥": 24045, + "ĠVC": 24046, + "recall": 24047, + "ogeneic": 24048, + "ĠOverexpression": 24049, + "Ġcommitted": 24050, + "Ġsynapse": 24051, + "Short": 24052, + "ĠNeutral": 24053, + "icles": 24054, + "ISM": 24055, + "Ġintrinsically": 24056, + "Ġmicrosatellite": 24057, + "RN": 24058, + "ĠâĪĥ": 24059, + "detection": 24060, + "Ġcodimension": 24061, + "Ġdrawbacks": 24062, + "ĠTurner": 24063, + "Ġsputtering": 24064, + "Ġdismut": 24065, + "Ġhypogly": 24066, + "Ġspeak": 24067, + "JD": 24068, + "Ġsul": 24069, + "Ġperinatal": 24070, + "Ġink": 24071, + "iest": 24072, + "Ġofficers": 24073, + "tick": 24074, + "Ġretaining": 24075, + "ĠNET": 24076, + "Ġexchanges": 24077, + "Ġanyone": 24078, + "ĠEndothelial": 24079, + "send": 24080, + "injection": 24081, + "ĠPeru": 24082, + "Ġclades": 24083, + "uctuations": 24084, + "Ġsulphate": 24085, + "pio": 24086, + "Ġphysi": 24087, + "ĠMiy": 24088, + "ĠBAS": 24089, + "arius": 24090, + "Ġlipopolysaccharide": 24091, + "Ġneurodegeneration": 24092, + "ĠTurkish": 24093, + "Ġophthal": 24094, + "Ġacted": 24095, + "entre": 24096, + "Ġshaking": 24097, + "Ġchloroplast": 24098, + "ĠSid": 24099, + "regnancy": 24100, + "asion": 24101, + "ĠHs": 24102, + "Ġinitiating": 24103, + "Ġflexural": 24104, + "Ϫ": 24105, + "Ġparac": 24106, + "Ġinterlayer": 24107, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 24108, + "cause": 24109, + "ractions": 24110, + "Ġvaluation": 24111, + "SYSMGR": 24112, + "ĠGarcia": 24113, + "arrays": 24114, + "Ġcasting": 24115, + "ĠPFN": 24116, + "ĠLanc": 24117, + "ĠGlob": 24118, + "Ġdenti": 24119, + "Ġportfolio": 24120, + "ĠHolocene": 24121, + "ĠMATERIAL": 24122, + "Ġsarc": 24123, + "Lear": 24124, + "Ġtin": 24125, + "ĠClear": 24126, + "below": 24127, + "Ġadvection": 24128, + "Ġoverlaps": 24129, + "Ġarthroplasty": 24130, + "compute": 24131, + "Ġglycolysis": 24132, + "hept": 24133, + "lora": 24134, + "frames": 24135, + "ĠHern": 24136, + "proto": 24137, + "Ġswine": 24138, + "Ġjejun": 24139, + "Ġrepeating": 24140, + "ancreatic": 24141, + "ĠCollins": 24142, + "ĠPrinciple": 24143, + "Ġnanof": 24144, + "Ġadjacency": 24145, + "Ġsynov": 24146, + "chet": 24147, + "ĠAlmost": 24148, + "Ġintrusion": 24149, + "Ġechocardiography": 24150, + "liferation": 24151, + "Ġquiescent": 24152, + "ĠMuk": 24153, + "Ġlifetimes": 24154, + "graded": 24155, + "Ġoverwhel": 24156, + "zel": 24157, + "Ġnitride": 24158, + "Ġdisturbed": 24159, + "Ġfastest": 24160, + "grability": 24161, + "Ġtolerated": 24162, + "frag": 24163, + "ĠExtension": 24164, + "anoate": 24165, + "iferous": 24166, + "Ġhydrodynamics": 24167, + "IONAL": 24168, + "ĠToday": 24169, + "ĠExpansion": 24170, + "Ġvenom": 24171, + "ĠHepatitis": 24172, + "ño": 24173, + "onation": 24174, + "synuclein": 24175, + "Ġbasketball": 24176, + "clusions": 24177, + "Ġsettled": 24178, + "IQR": 24179, + "ĠCra": 24180, + "Ġautomation": 24181, + "ĠHealthy": 24182, + "ĠPortuguese": 24183, + "ĠAbelian": 24184, + "Ġgad": 24185, + "ĠHG": 24186, + "ĠRoth": 24187, + "Ġconsume": 24188, + "FG": 24189, + "inals": 24190, + "ĠMCMC": 24191, + "Ġpregnancies": 24192, + "DES": 24193, + "portional": 24194, + "ĠBiochemical": 24195, + "Ġmissions": 24196, + "ĠAntibody": 24197, + "ĠBCG": 24198, + "ĠLAS": 24199, + "marine": 24200, + "DMA": 24201, + "Ġlongevity": 24202, + "ĠDry": 24203, + "ĠRao": 24204, + "Ġinterferometer": 24205, + "Ġdiscretized": 24206, + "osensory": 24207, + "sit": 24208, + "etta": 24209, + "tainer": 24210, + "otherwise": 24211, + "AKT": 24212, + "ĠFaculty": 24213, + "Ġascertain": 24214, + "ĠSimulated": 24215, + "Ġpayload": 24216, + "OUT": 24217, + "Ġsuffers": 24218, + "Ġtungsten": 24219, + "ĠAnxiety": 24220, + "ĠHeterogeneous": 24221, + "lingual": 24222, + "Ġpherom": 24223, + "bors": 24224, + "linux": 24225, + "Ġmonkey": 24226, + "£": 24227, + "url": 24228, + "ĠAcross": 24229, + "ĠAKI": 24230, + "Ġopp": 24231, + "ocalization": 24232, + "Ġmorphogenesis": 24233, + "gic": 24234, + "ĠPCM": 24235, + "Ġoligomers": 24236, + "Ġexhaustive": 24237, + "ĠGIS": 24238, + "Ġpristine": 24239, + "ĠActiv": 24240, + "ĠScilab": 24241, + "ĠAcoustic": 24242, + "ĠPick": 24243, + "integral": 24244, + "Ġphilosophy": 24245, + "ĠDeng": 24246, + "ĠHab": 24247, + "scape": 24248, + "ĠEmergency": 24249, + "Ġepi": 24250, + "ĠBET": 24251, + "ricket": 24252, + "Ġannulus": 24253, + "Ġlysosomal": 24254, + "Ġstrands": 24255, + "CAP": 24256, + "ĠAmino": 24257, + "ĠStri": 24258, + "ependence": 24259, + "Ġfootprint": 24260, + "ĠFatty": 24261, + "ĠNaz": 24262, + "nest": 24263, + "ĠExplicit": 24264, + "planetary": 24265, + "lead": 24266, + "Ġgrip": 24267, + "need": 24268, + "ATT": 24269, + "ERV": 24270, + "ĠTargeted": 24271, + "CRP": 24272, + "Ġparamagnetic": 24273, + "ĠTyr": 24274, + "ĠMicroRNA": 24275, + "hline": 24276, + "gh": 24277, + "pit": 24278, + "ĠIsolated": 24279, + "jectory": 24280, + "Ġcleaned": 24281, + "oste": 24282, + "Ġpathologies": 24283, + "propylene": 24284, + "ĠReason": 24285, + "ĠINFO": 24286, + "RAY": 24287, + "Values": 24288, + "Ġalive": 24289, + "Ġbiof": 24290, + "ewicz": 24291, + "Ġcracking": 24292, + "google": 24293, + "locked": 24294, + "crop": 24295, + "eca": 24296, + "urane": 24297, + "SVM": 24298, + "utta": 24299, + "ĠMetric": 24300, + "ĠEncycl": 24301, + "ĠModule": 24302, + "Ġwarranted": 24303, + "Ġmultidisciplinary": 24304, + "ĠElastic": 24305, + "labelled": 24306, + "ĠSchwarzschild": 24307, + "ĠPCC": 24308, + "major": 24309, + "video": 24310, + "Ġstoring": 24311, + "ĠMake": 24312, + "ako": 24313, + "ĠJia": 24314, + "Ġtoroidal": 24315, + "ĠHMM": 24316, + "Ġmasking": 24317, + "Again": 24318, + "Ġnephropathy": 24319, + "gf": 24320, + "Ġdominating": 24321, + "erkin": 24322, + "ĠFabrication": 24323, + "ĠFel": 24324, + "DEF": 24325, + "culture": 24326, + "ĠIra": 24327, + "ĠREG": 24328, + "ilingual": 24329, + "Ġmuss": 24330, + "plain": 24331, + "zh": 24332, + "iston": 24333, + "ĠÎ¥": 24334, + "minimal": 24335, + "cmp": 24336, + "GaN": 24337, + "Ġmonotonic": 24338, + "Ġinvolution": 24339, + "Ġwhatever": 24340, + "ĠInstrument": 24341, + "imple": 24342, + "ĠPCI": 24343, + "ĠNeuronal": 24344, + "Ġfacets": 24345, + "Ġhemodialysis": 24346, + "apatite": 24347, + "ĠKil": 24348, + "ontally": 24349, + "Ġinserting": 24350, + "ĠRIP": 24351, + "Ġconnective": 24352, + "ĠFederation": 24353, + "nut": 24354, + "ĠGun": 24355, + "inuous": 24356, + "Mor": 24357, + "ĠWisconsin": 24358, + "Ġmush": 24359, + "ITS": 24360, + "Ġeject": 24361, + "ĠBPS": 24362, + "ĠHorn": 24363, + "ĠEmbedding": 24364, + "Ġraces": 24365, + "ĠJam": 24366, + "Ġposture": 24367, + "ĠInvol": 24368, + "ĠIMDb": 24369, + "ĠPlease": 24370, + "proportion": 24371, + "ĠInterleukin": 24372, + "Ġarte": 24373, + "Ġsubsp": 24374, + "oderma": 24375, + "Find": 24376, + "imit": 24377, + "ĠClin": 24378, + "Hel": 24379, + "FILE": 24380, + "original": 24381, + "ervoir": 24382, + "Ġpleural": 24383, + "clipse": 24384, + "encer": 24385, + "inaries": 24386, + "Ġvictory": 24387, + "Ġinvestigates": 24388, + "ĠImportance": 24389, + "ĠMIN": 24390, + "Ġphonons": 24391, + "integrated": 24392, + "Ġexchanged": 24393, + "ystis": 24394, + "Ġmigrate": 24395, + "Rob": 24396, + "eland": 24397, + "proof": 24398, + "ĠIntegral": 24399, + "Ġmergers": 24400, + "Ġpolyphenols": 24401, + "ĠFully": 24402, + "Ġuro": 24403, + "Ġhomogenous": 24404, + "Ġrecognizing": 24405, + "ĠSignals": 24406, + "vat": 24407, + "igms": 24408, + "Ġaccuracies": 24409, + "Substituting": 24410, + "Ġpoisoning": 24411, + "Ġshrimp": 24412, + "ĠHölder": 24413, + "ĠTanzania": 24414, + "JS": 24415, + "MENT": 24416, + "ĠTopology": 24417, + "Ġinvers": 24418, + "ĠDU": 24419, + "Ġuniaxial": 24420, + "ĠSEC": 24421, + "party": 24422, + "Ġcontrollable": 24423, + "Ġfum": 24424, + "ostics": 24425, + "Ġmanifested": 24426, + "Ġpropagated": 24427, + "Ġsuffix": 24428, + "ĠCAN": 24429, + "ĠPret": 24430, + "keeping": 24431, + "Assuming": 24432, + "Ġsuture": 24433, + "Ġpest": 24434, + "Ġgamet": 24435, + "ĠAlignment": 24436, + "esarean": 24437, + "tum": 24438, + "Ġrefine": 24439, + "Ġpopulated": 24440, + "Ġestu": 24441, + "ĠDefense": 24442, + "ĠPrivacy": 24443, + "ĠWein": 24444, + "ĠSenate": 24445, + "Ġazimuth": 24446, + "ĠProfessional": 24447, + "Ġlabour": 24448, + "Ġseminal": 24449, + "ĠIntervention": 24450, + "ĠOlder": 24451, + "AU": 24452, + "Wind": 24453, + "dynamical": 24454, + "ĠVeter": 24455, + "ación": 24456, + "Ġcooking": 24457, + "Ġâīª": 24458, + "Ġbead": 24459, + "Ġdensely": 24460, + "Ġpalliative": 24461, + "mort": 24462, + "ĠAAV": 24463, + "ĠRyan": 24464, + "Prim": 24465, + "galax": 24466, + "muir": 24467, + "sters": 24468, + "ĠSalt": 24469, + "queeze": 24470, + "ĠPlateau": 24471, + "Ġí": 24472, + "Ġlighter": 24473, + "ordinary": 24474, + "formaldehyde": 24475, + "ĠWer": 24476, + "Ġbark": 24477, + "Ġhomogenized": 24478, + "Ġpyramidal": 24479, + "Ġinert": 24480, + "ĠAPC": 24481, + "ĠMicros": 24482, + "ĠProteobacteria": 24483, + "ĠPurification": 24484, + "Ġparametrized": 24485, + "Ġille": 24486, + "accuracy": 24487, + "embedding": 24488, + "Ġtoughness": 24489, + "Ġisometry": 24490, + "backs": 24491, + "ĠFIG": 24492, + "ĠRon": 24493, + "ĠESP": 24494, + "Ġmicroglial": 24495, + "interp": 24496, + "ĠIntegrating": 24497, + "ĠReducing": 24498, + "Ġhearts": 24499, + "Ġseriously": 24500, + "Ġspecially": 24501, + "CTRL": 24502, + "ĠSurprisingly": 24503, + "Ġhyperplane": 24504, + "polynomial": 24505, + "Ġreconc": 24506, + "Ġpharmacokinetic": 24507, + "Mart": 24508, + "ĠBright": 24509, + "mable": 24510, + "Ġionizing": 24511, + "Ġtrich": 24512, + "zymatic": 24513, + "Ġleptons": 24514, + "etting": 24515, + "ĠHex": 24516, + "Ġneurop": 24517, + "Ġadipocytes": 24518, + "Ġrods": 24519, + "Ġsupercritical": 24520, + "Ġsuccin": 24521, + "Ġanter": 24522, + "ĠNAC": 24523, + "ĠSubsequent": 24524, + "IGH": 24525, + "Ġsoutheast": 24526, + "Ġendowed": 24527, + "Ġconverging": 24528, + "Ġspatio": 24529, + "Ġcelebr": 24530, + "helix": 24531, + "Ġaccessions": 24532, + "Ġimmobilization": 24533, + "ĠEQ": 24534, + "spatial": 24535, + "Ġinformal": 24536, + "Ġdere": 24537, + "ĠEnzyme": 24538, + "ĠBBC": 24539, + "ĠEPR": 24540, + "Ġelectrically": 24541, + "Ġleukocytes": 24542, + "Ġalanine": 24543, + "Ġmitogen": 24544, + "Ġintramolecular": 24545, + "ĠNI": 24546, + "Ġprokary": 24547, + "ISO": 24548, + "Ġdodec": 24549, + "ĠTrade": 24550, + "ĠDai": 24551, + "ccc": 24552, + "ĠWalter": 24553, + "ĠNeither": 24554, + "Ġvulgaris": 24555, + "Ġlongitude": 24556, + "ĠIntro": 24557, + "option": 24558, + "ĠQC": 24559, + "ĠâĿ": 24560, + "protection": 24561, + "ĠIMF": 24562, + "aprote": 24563, + "Ġlinker": 24564, + "Ġfounder": 24565, + "Ġaspiration": 24566, + "clusters": 24567, + "ĠPay": 24568, + "ĠRoles": 24569, + "Ġacyclic": 24570, + "overing": 24571, + "Ġremind": 24572, + "ĠTong": 24573, + "ĠAtten": 24574, + "Ġengineers": 24575, + "Ġdysregulation": 24576, + "ĠFourth": 24577, + "Ġfilename": 24578, + "ĠCool": 24579, + "protected": 24580, + "Ġnilpotent": 24581, + "ĠHK": 24582, + "clone": 24583, + "ĠStadium": 24584, + "ais": 24585, + "osamine": 24586, + "ABILITY": 24587, + "rovascular": 24588, + "ĠAH": 24589, + "ĠConcept": 24590, + "Ġcerebrospinal": 24591, + "owitz": 24592, + "Ġresolving": 24593, + "Ġwings": 24594, + "ĠEGF": 24595, + "ĠCommand": 24596, + "iazep": 24597, + "Ġbeef": 24598, + "Ġspines": 24599, + "Ġpriorities": 24600, + "Ġattempting": 24601, + "Ġtelomere": 24602, + "BQU": 24603, + "Ġviolations": 24604, + "LB": 24605, + "omnia": 24606, + "osm": 24607, + "irq": 24608, + "Ġdiversification": 24609, + "alt": 24610, + "ĠBRAF": 24611, + "Ġorganisation": 24612, + "die": 24613, + "Ġautoreg": 24614, + "icked": 24615, + "ĠEcological": 24616, + "ĠTrain": 24617, + "ĠPY": 24618, + "Ġmusculoskeletal": 24619, + "Ġhorizons": 24620, + "Ġomega": 24621, + "Ġquasars": 24622, + "eption": 24623, + "Ġerad": 24624, + "Ġluminal": 24625, + "Interestingly": 24626, + "Ġpayment": 24627, + "cnt": 24628, + "Ġdipl": 24629, + "Ġrecognised": 24630, + "Cat": 24631, + "ĠChl": 24632, + "Ġmillions": 24633, + "Ġdisappearance": 24634, + "GAP": 24635, + "Ġradiographic": 24636, + "Ġpostpartum": 24637, + "developed": 24638, + "xual": 24639, + "Ġhed": 24640, + "idered": 24641, + "ĠCertain": 24642, + "Ġdysplasia": 24643, + "________": 24644, + "ĠHalf": 24645, + "Ġasymmetries": 24646, + "ĠAlcohol": 24647, + "Sum": 24648, + "Ġfm": 24649, + "Ġchap": 24650, + "Ġpretreated": 24651, + "ĠGallery": 24652, + "Ġoutperform": 24653, + "Ġbreeds": 24654, + "Ġtied": 24655, + "Ġdiffeomorphism": 24656, + "Ġcausative": 24657, + "Ġcollectively": 24658, + "Ġsuboptimal": 24659, + "Ġinsulation": 24660, + "Ġmanipulate": 24661, + "Ġkilomet": 24662, + "Ġrepulsion": 24663, + "Ġchloroform": 24664, + "Ġbean": 24665, + "Ġhero": 24666, + "rophysics": 24667, + "ĠPeptide": 24668, + "Ġoutlier": 24669, + "Derived": 24670, + "isser": 24671, + "ĠInfant": 24672, + "sulfonyl": 24673, + "Ġrecursively": 24674, + "Hu": 24675, + "ĠKoh": 24676, + "pyridine": 24677, + "Ġsquad": 24678, + "Ġthirty": 24679, + "Ġspoken": 24680, + "ĠZar": 24681, + "othermic": 24682, + "Ġcalcification": 24683, + "ĠHelsinki": 24684, + "Ġbeach": 24685, + "ĠFDR": 24686, + "Ġprobiotic": 24687, + "Ġfinishing": 24688, + "ymmetrical": 24689, + "Ġvacancy": 24690, + "Ġthrombo": 24691, + "Compared": 24692, + "AST": 24693, + "sted": 24694, + "otherap": 24695, + "Ġiodide": 24696, + "Ġtt": 24697, + "alignment": 24698, + "Ġmicrovascular": 24699, + "Ġinitialize": 24700, + "ĠANALYSIS": 24701, + "Ġtopographic": 24702, + "ĠReporting": 24703, + "Ġunderestimated": 24704, + "puted": 24705, + "Ġatherosclerotic": 24706, + "Qiagen": 24707, + "gut": 24708, + "ĠCortical": 24709, + "Ġdisrupt": 24710, + "este": 24711, + "Ġglue": 24712, + "Ġnarrower": 24713, + "Ġinpatient": 24714, + "Ġscholars": 24715, + "Ġbc": 24716, + "ĠPsychological": 24717, + "ĠHamiltonians": 24718, + "Ġhonor": 24719, + "tibular": 24720, + "Ġinsertions": 24721, + "oscope": 24722, + "Ġpharmacokinetics": 24723, + "Ġmathematically": 24724, + "Ġfork": 24725, + "ipital": 24726, + "ĠArgs": 24727, + "abolism": 24728, + "Ġâİł": 24729, + "ĠRobot": 24730, + "ĠCasc": 24731, + "Ġleaching": 24732, + "ĠLack": 24733, + "Ġendocytosis": 24734, + "Ġtris": 24735, + "Ġsensitivities": 24736, + "Ġlicensed": 24737, + "Ġsponge": 24738, + "carbonyl": 24739, + "feat": 24740, + "Ġprecl": 24741, + "Ġwaist": 24742, + "tifications": 24743, + "Ġoliv": 24744, + "binary": 24745, + "atri": 24746, + "ĠBiot": 24747, + "TZ": 24748, + "Ġfake": 24749, + "ĠMosc": 24750, + "ĠHPS": 24751, + "ĠVoltage": 24752, + "ĠâİĿ": 24753, + "ĠAhmed": 24754, + "ĠSexual": 24755, + "dehydes": 24756, + "ĠCot": 24757, + "Ġmagma": 24758, + "oxylin": 24759, + "ÐĪ": 24760, + "amethyl": 24761, + "ĠLOS": 24762, + "diphenyl": 24763, + "experimental": 24764, + "Ġpluripotent": 24765, + "agittal": 24766, + "walk": 24767, + "Ġplasmonic": 24768, + "Ġcontracts": 24769, + "Ġexped": 24770, + "ĠArabia": 24771, + "Ġshoots": 24772, + "ĠRAN": 24773, + "ustrated": 24774, + "Ġconvexity": 24775, + "ĠmJ": 24776, + "ĠAbsolute": 24777, + "ĠSEL": 24778, + "MIP": 24779, + "ĠActually": 24780, + "sole": 24781, + "QI": 24782, + "ĠTGFβ": 24783, + "Ġâİŀ": 24784, + "Ġrearrangements": 24785, + "Ġcuring": 24786, + "expensive": 24787, + "ceptibility": 24788, + "Ġours": 24789, + "ĠKidney": 24790, + "Ġassigns": 24791, + "Ġvoxels": 24792, + "oreal": 24793, + "Ġevening": 24794, + "hus": 24795, + "ĠãĢ": 24796, + "oradi": 24797, + "ĠCorrection": 24798, + "Ġnanofibers": 24799, + "Ġcantile": 24800, + "bigoplus": 24801, + "uminous": 24802, + "eclampsia": 24803, + "ĠCult": 24804, + "ECH": 24805, + "atology": 24806, + "Ġji": 24807, + "cryp": 24808, + "ĠAspects": 24809, + "eni": 24810, + "Ġsemis": 24811, + "IRS": 24812, + "ĠPho": 24813, + "encoding": 24814, + "ĠJustice": 24815, + "ococci": 24816, + "Ġhypothalamic": 24817, + "ractable": 24818, + "ĠOrb": 24819, + "Simons": 24820, + "Ġmanipulated": 24821, + "attribute": 24822, + "onov": 24823, + "orously": 24824, + "endar": 24825, + "uder": 24826, + "insert": 24827, + "Ġlysed": 24828, + "ĠHodge": 24829, + "Ġfootballer": 24830, + "Device": 24831, + "ĠLeast": 24832, + "Ġstratum": 24833, + "Ġmitral": 24834, + "Ġsell": 24835, + "ĠMuc": 24836, + "glycer": 24837, + "oj": 24838, + "Ġpathogenicity": 24839, + "ĠDeclaration": 24840, + "opause": 24841, + "ĠArticle": 24842, + "Ġrinsed": 24843, + "ĠLévy": 24844, + "rement": 24845, + "Ġants": 24846, + "ĠDic": 24847, + "ĠkPa": 24848, + "urry": 24849, + "motion": 24850, + "client": 24851, + "Ġaccessory": 24852, + "Ġdepolarization": 24853, + "namely": 24854, + "Ġdisparities": 24855, + "Ġfavourable": 24856, + "ĠTibet": 24857, + "Ġoocyte": 24858, + "istration": 24859, + "Ġunresolved": 24860, + "criptive": 24861, + "physics": 24862, + "Ġbenzo": 24863, + "Ġcrystallinity": 24864, + "Ġpayoff": 24865, + "Ġumbilical": 24866, + "osil": 24867, + "ĠSystemic": 24868, + "ĠSTM": 24869, + "Ġstabilizer": 24870, + "USA": 24871, + "ĠJensen": 24872, + "Aug": 24873, + "ĠHat": 24874, + "AGG": 24875, + "underbrace": 24876, + "Ġmanipulations": 24877, + "ĠManc": 24878, + "nedy": 24879, + "Ġscratch": 24880, + "Cherry": 24881, + "osaccharides": 24882, + "Ġprecipitate": 24883, + "quarters": 24884, + "icul": 24885, + "Ġoptimally": 24886, + "many": 24887, + "Ġneoplasms": 24888, + "Ġinward": 24889, + "aryng": 24890, + "Ġmoll": 24891, + "ĠWel": 24892, + "ĠWiley": 24893, + "Ġnewspaper": 24894, + "Ġinhabitants": 24895, + "ĠSuccess": 24896, + "Ġbridging": 24897, + "Ġdisconnected": 24898, + "Ġhygiene": 24899, + "Dist": 24900, + "Ġscripts": 24901, + "Ġmesoporous": 24902, + "Ġrestricts": 24903, + "actone": 24904, + "Ġaquifer": 24905, + "ĠïĤ·": 24906, + "Ġplex": 24907, + "Ġpresumed": 24908, + "Ġips": 24909, + "ĠMilitary": 24910, + "Ġjudged": 24911, + "Ġald": 24912, + "Ġsequest": 24913, + "compared": 24914, + "ULATION": 24915, + "adapted": 24916, + "Ġinstructed": 24917, + "pulse": 24918, + "Ġcusp": 24919, + "matching": 24920, + "carrier": 24921, + "Ġenforce": 24922, + "ĠInterview": 24923, + "ometrics": 24924, + "Ġnullptr": 24925, + "Ġflavour": 24926, + "ĠPareto": 24927, + "ĠBER": 24928, + "Ġuv": 24929, + "Ġcrash": 24930, + "ĠCann": 24931, + "ĠMineral": 24932, + "ĠOlympic": 24933, + "Ġpolycrystalline": 24934, + "lett": 24935, + "Tables": 24936, + "requent": 24937, + "Ġsedentary": 24938, + "unsaturated": 24939, + "ĠBernoulli": 24940, + "Ġadmissions": 24941, + "itorial": 24942, + "acute": 24943, + "Ġadditions": 24944, + "weet": 24945, + "ALE": 24946, + "ĠManip": 24947, + "tokens": 24948, + "preced": 24949, + "dk": 24950, + "consider": 24951, + "Ġïĺ¹": 24952, + "Ġwrites": 24953, + "cardia": 24954, + "ctomy": 24955, + "omatous": 24956, + "Symbol": 24957, + "usten": 24958, + "Ġproteolytic": 24959, + "categories": 24960, + "Ġfic": 24961, + "Ġswing": 24962, + "Ġpassenger": 24963, + "Ġoverlapped": 24964, + "ifi": 24965, + "Ġmutational": 24966, + "ĠJosephson": 24967, + "Ġregret": 24968, + "ĠArk": 24969, + "ĠCFD": 24970, + "Ġmaneu": 24971, + "encoded": 24972, + "textsc": 24973, + "Ġdecompositions": 24974, + "ĠDeb": 24975, + "Ġmandibular": 24976, + "dU": 24977, + "ĠPIC": 24978, + "Ġtranscriptomic": 24979, + "Ġtelescop": 24980, + "ĠSantos": 24981, + "oE": 24982, + "ĠMCP": 24983, + "Ġindigenous": 24984, + "Ġmicrospheres": 24985, + "Ġcodew": 24986, + "zip": 24987, + "Ġfingers": 24988, + "Ġcampaigns": 24989, + "¸Ģł": 24990, + "Ġaccidents": 24991, + "ĠTools": 24992, + "Planck": 24993, + "»": 24994, + "eder": 24995, + "ingham": 24996, + "oxidase": 24997, + "Ġancestor": 24998, + "whose": 24999, + "Ġphospholipid": 25000, + "Ġconversation": 25001, + "ĠHof": 25002, + "cortical": 25003, + "glycos": 25004, + "Ġmanufacturers": 25005, + "opulmonary": 25006, + "Ġinclined": 25007, + "ĠBethe": 25008, + "Ġspending": 25009, + "ĠFusarium": 25010, + "uitively": 25011, + "Ġfemur": 25012, + "ĠLinks": 25013, + "Ġnitrite": 25014, + "Main": 25015, + "Ġflora": 25016, + "ĠPhD": 25017, + "ĠWriting": 25018, + "ĠHessian": 25019, + "Ġμs": 25020, + "ools": 25021, + "Ġvictims": 25022, + "ĠRew": 25023, + "ansen": 25024, + "Ear": 25025, + "Ġorn": 25026, + "Ġthermoelectric": 25027, + "ENSE": 25028, + "ĠWeighted": 25029, + "holes": 25030, + "Ġcen": 25031, + "Ġacuity": 25032, + "Ġvacancies": 25033, + "ĠDuke": 25034, + "Ġpaclitaxel": 25035, + "Ġconverts": 25036, + "bourne": 25037, + "ĠACS": 25038, + "osi": 25039, + "Ġcriminal": 25040, + "ĠIb": 25041, + "unes": 25042, + "ĠNanoc": 25043, + "Post": 25044, + "ĠMDS": 25045, + "Ġeconomics": 25046, + "Ġthoughts": 25047, + "Ġneuroprotective": 25048, + "Ġintersects": 25049, + "cers": 25050, + "atid": 25051, + "usa": 25052, + "ĠAns": 25053, + "Ġafterwards": 25054, + "ĠOFDM": 25055, + "ĠCMV": 25056, + "ĠCum": 25057, + "ATG": 25058, + "ĠImageNet": 25059, + "ĠAttack": 25060, + "ogeneities": 25061, + "Ġcounseling": 25062, + "ĠCONTR": 25063, + "ález": 25064, + "ĠDh": 25065, + "ĠGV": 25066, + "Ġpositional": 25067, + "Ġgang": 25068, + "ĠInteractive": 25069, + "wig": 25070, + "ĠTrace": 25071, + "ĠDSS": 25072, + "Ġsynthetase": 25073, + "ĠGalile": 25074, + "usually": 25075, + "ĠBass": 25076, + "ardless": 25077, + "Ġexecuting": 25078, + "KP": 25079, + "ĠNepal": 25080, + "READ": 25081, + "ĠLock": 25082, + "ohydro": 25083, + "rotation": 25084, + "dil": 25085, + "roscopically": 25086, + "reperfusion": 25087, + "Ġdishes": 25088, + "ĠProceedings": 25089, + "ĠNPC": 25090, + "Ġmonsoon": 25091, + "ĠLemmas": 25092, + "ĠChandra": 25093, + "Ġreactors": 25094, + "Ġtryptophan": 25095, + "ĠVT": 25096, + "ĠDEM": 25097, + "Ġlegislation": 25098, + "mk": 25099, + "Ġtoric": 25100, + "ĠPrograms": 25101, + "ĠPubMed": 25102, + "ĠrDNA": 25103, + "Ġposts": 25104, + "ĠâİĽ": 25105, + "Ġshedding": 25106, + "tolerant": 25107, + "Ġvoids": 25108, + "ĠCaribbean": 25109, + "CODE": 25110, + "Tube": 25111, + "ALSE": 25112, + "Ġchlorine": 25113, + "Ġcoerc": 25114, + "ĠRhiz": 25115, + "ĠKirk": 25116, + "ĠÃĸ": 25117, + "rout": 25118, + "icides": 25119, + "agu": 25120, + "ĠKw": 25121, + "Ġcru": 25122, + "Observe": 25123, + "ĠRevis": 25124, + "Ġanonym": 25125, + "Ġprerequ": 25126, + "ocortical": 25127, + "Ġrestaur": 25128, + "ĠPopulations": 25129, + "dst": 25130, + "Ġfort": 25131, + "regs": 25132, + "ĠPolarization": 25133, + "Ġpancreatitis": 25134, + "aph": 25135, + "threat": 25136, + "ften": 25137, + "ĠAlaska": 25138, + "ĠFlexible": 25139, + "Ġrepertoire": 25140, + "kan": 25141, + "mathchoice": 25142, + "Ġmitosis": 25143, + "Ġeat": 25144, + "utin": 25145, + "Ġrt": 25146, + "Ġdummy": 25147, + "ĠCys": 25148, + "ĠGor": 25149, + "earchers": 25150, + "HPLC": 25151, + "Ġbay": 25152, + "ĠNielsen": 25153, + "ĠRoc": 25154, + "iani": 25155, + "icit": 25156, + "rague": 25157, + "Ġcourts": 25158, + "testing": 25159, + "Ġamplify": 25160, + "Ġtuples": 25161, + "proliferative": 25162, + "ĠParas": 25163, + "Ġmagnets": 25164, + "Ġchemokines": 25165, + "ĠMitchell": 25166, + "ĠPetri": 25167, + "holtz": 25168, + "ych": 25169, + "matrices": 25170, + "Ġcorrecting": 25171, + "ĠPCa": 25172, + "ynamically": 25173, + "ĠNAFLD": 25174, + "Ġeffluent": 25175, + "itum": 25176, + "Ġthrows": 25177, + "ĠGuid": 25178, + "ochromatic": 25179, + "ĠFro": 25180, + "idad": 25181, + "romagnetism": 25182, + "Herm": 25183, + "ĠSpi": 25184, + "ĠQuas": 25185, + "domains": 25186, + "Ġquadrant": 25187, + "ĠSOX": 25188, + "ĠGovernor": 25189, + "Ġamenable": 25190, + "held": 25191, + "ĠCul": 25192, + "Ġunderwater": 25193, + "ĠKron": 25194, + "ĠSpati": 25195, + "anoyl": 25196, + "CU": 25197, + "ovir": 25198, + "Ġdemographics": 25199, + "Within": 25200, + "ĠMé": 25201, + "textsf": 25202, + "ĠLabel": 25203, + "Ġgenuine": 25204, + "Ġhill": 25205, + "ĠLaz": 25206, + "Ġtesticular": 25207, + "ĠBrow": 25208, + "ICATION": 25209, + "¡": 25210, + "ĠAIC": 25211, + "ancomycin": 25212, + "strual": 25213, + "Ġarrested": 25214, + "ĠSom": 25215, + "ĠIHC": 25216, + "ĠPose": 25217, + "ĠMö": 25218, + "istar": 25219, + "ĠPAM": 25220, + "ĠHCT": 25221, + "Ġtypedef": 25222, + "ĠMorse": 25223, + "ĠLeishman": 25224, + "limb": 25225, + "Ġspheroid": 25226, + "osely": 25227, + "ĠGuinea": 25228, + "renew": 25229, + "Ġpsoriasis": 25230, + "ista": 25231, + "ĠChung": 25232, + "orthogonal": 25233, + "ĠShear": 25234, + "ĠMuslim": 25235, + "ĠPict": 25236, + "Integer": 25237, + "Ġspacer": 25238, + "Ly": 25239, + "Ġdermal": 25240, + "Ġoncology": 25241, + "Ġdp": 25242, + "Ġphotoluminescence": 25243, + "regon": 25244, + "aminase": 25245, + "Ġáºĭ": 25246, + "Instance": 25247, + "verb": 25248, + "Ġmethylated": 25249, + "ĠGem": 25250, + "istently": 25251, + "ĠMgCl": 25252, + "ĠElevated": 25253, + "⣩": 25254, + "onstruct": 25255, + "Ġsnapshot": 25256, + "enem": 25257, + "ĠDisk": 25258, + "Ġhydrostatic": 25259, + "Ġïĥª": 25260, + "vor": 25261, + "ĠIE": 25262, + "ĠLY": 25263, + "ORF": 25264, + "Ġfoil": 25265, + "male": 25266, + "Ġdepended": 25267, + "sparse": 25268, + "Ġmetas": 25269, + "Ġtextures": 25270, + "Ġstacks": 25271, + "MHz": 25272, + "Ġfn": 25273, + "Ġultrac": 25274, + "ĠShould": 25275, + "Vec": 25276, + "nine": 25277, + "infinite": 25278, + "ĠLawrence": 25279, + "ĠInventory": 25280, + "ĠProstate": 25281, + "Ġgesture": 25282, + "ĠSuzuki": 25283, + "Abs": 25284, + "ricane": 25285, + "ĠPeriodic": 25286, + "Myc": 25287, + "ifiable": 25288, + "Ġinefficient": 25289, + "Ġcollapsed": 25290, + "Ġtopologically": 25291, + "Ġpreferable": 25292, + "Ġbronchial": 25293, + "uston": 25294, + "Ġflexion": 25295, + "ourney": 25296, + "translation": 25297, + "Ġepitaxial": 25298, + "Ġirradiance": 25299, + "Ġneighbours": 25300, + "switch": 25301, + "Ġactuators": 25302, + "SOD": 25303, + "mir": 25304, + "dies": 25305, + "ikawa": 25306, + "ĠALL": 25307, + "ĠRSV": 25308, + "ĠHEP": 25309, + "Ġendurance": 25310, + "connection": 25311, + "Ġgestures": 25312, + "odontic": 25313, + "ĠUnc": 25314, + "Ġdismutase": 25315, + "Having": 25316, + "mix": 25317, + "Ġneurogenesis": 25318, + "Ġmyocardium": 25319, + "ĠRussell": 25320, + "Hist": 25321, + "ĠSPI": 25322, + "triazol": 25323, + "agulant": 25324, + "ĠRequired": 25325, + "ĠshRNA": 25326, + "ĠArthur": 25327, + "Ġspawning": 25328, + "dried": 25329, + "Ġrectif": 25330, + "ĠÃī": 25331, + "Ġosteogenic": 25332, + "replace": 25333, + "Ġgaining": 25334, + "Ġneutralization": 25335, + "ĠHartree": 25336, + "Ġfollicles": 25337, + "Ġreligion": 25338, + "Ġduplex": 25339, + "Ġtransients": 25340, + "amped": 25341, + "Ġmicrotubules": 25342, + "interest": 25343, + "Ġsteels": 25344, + "Batch": 25345, + "Ġdenaturation": 25346, + "ĠPhillips": 25347, + "Ġquiet": 25348, + "ĠBureau": 25349, + "ĠRare": 25350, + "Ġquercetin": 25351, + "aults": 25352, + "Ġelution": 25353, + "uka": 25354, + "ĠInterpretation": 25355, + "RV": 25356, + "ĠESC": 25357, + "ĠKom": 25358, + "arettes": 25359, + "ĠïģĦ": 25360, + "Ġtradition": 25361, + "Ġdissected": 25362, + "Neigh": 25363, + "Ġsheaves": 25364, + "Ġbelonged": 25365, + "ĠHistoric": 25366, + "ĠOE": 25367, + "Ġjson": 25368, + "lemma": 25369, + "ĠYAP": 25370, + "odext": 25371, + "interface": 25372, + "Ġextremity": 25373, + "crossing": 25374, + "precedented": 25375, + "according": 25376, + "Ġconstructive": 25377, + "ĠStimulation": 25378, + "ĠHFD": 25379, + "Ġwavenumber": 25380, + "Ġhrs": 25381, + "Ġpapillomavirus": 25382, + "Ġvomiting": 25383, + "Ġreactivation": 25384, + "ometrically": 25385, + "ĠDimensions": 25386, + "objects": 25387, + "orton": 25388, + "ĠMathem": 25389, + "ĠOlive": 25390, + "Ġcrosstalk": 25391, + "partite": 25392, + "opathies": 25393, + "ĠCNTs": 25394, + "rousal": 25395, + "Ġcrowd": 25396, + "ĠLangmuir": 25397, + "ĠTox": 25398, + "echanics": 25399, + "imus": 25400, + "ĠShock": 25401, + "tanh": 25402, + "ĠBrillouin": 25403, + "Ġtransferring": 25404, + "Ġellipse": 25405, + "ĠAddition": 25406, + "ĠRural": 25407, + "Ġgeodesics": 25408, + "GEM": 25409, + "ĠPOS": 25410, + "ĠMission": 25411, + "ocarp": 25412, + "ĠJane": 25413, + "Lie": 25414, + "freq": 25415, + "opot": 25416, + "ĠVibrio": 25417, + "ĠObj": 25418, + "erts": 25419, + "ĠTrials": 25420, + "CFT": 25421, + "ĠCodes": 25422, + "μg": 25423, + "Reference": 25424, + "ĠFung": 25425, + "ĠSuppression": 25426, + "hog": 25427, + "Ġresistive": 25428, + "Chi": 25429, + "intered": 25430, + "Ġpostmenopausal": 25431, + "Statistical": 25432, + "ĠEdwards": 25433, + "Ġses": 25434, + "Ġfarming": 25435, + "quartile": 25436, + "cooled": 25437, + "Ġnanop": 25438, + "ĠProbing": 25439, + "ĠBernard": 25440, + "uni": 25441, + "ieties": 25442, + "ĠMarket": 25443, + "osum": 25444, + "ĠMessage": 25445, + "Ġaxiom": 25446, + "cg": 25447, + "ĠMoving": 25448, + "Resolution": 25449, + "Ġadsorbent": 25450, + "Ġmultin": 25451, + "Ġineffective": 25452, + "propag": 25453, + "hardt": 25454, + "Saharan": 25455, + "Wil": 25456, + "ĠIvan": 25457, + "irubin": 25458, + "Ġtrabec": 25459, + "alli": 25460, + "ĠCDCl": 25461, + "Ġsew": 25462, + "ĠIss": 25463, + "Ġaggression": 25464, + "ĠJuan": 25465, + "Ġdispersions": 25466, + "Ġauxin": 25467, + "FET": 25468, + "lp": 25469, + "reach": 25470, + "ĠPGE": 25471, + "chestr": 25472, + "Ġlecture": 25473, + "ĠDonald": 25474, + "slip": 25475, + "ĠHbA": 25476, + "ĠSecure": 25477, + "ĠBeh": 25478, + "Ġdamages": 25479, + "WH": 25480, + "alkyl": 25481, + "Ha": 25482, + "ĠThanks": 25483, + "Ġsensitization": 25484, + "Ġwaterm": 25485, + "Ġtwins": 25486, + "Ġcultivar": 25487, + "Ġzeolite": 25488, + "Variable": 25489, + "ĠBent": 25490, + "Ġantisense": 25491, + "ĠHansen": 25492, + "repreneur": 25493, + "ĠSNe": 25494, + "ĠEMG": 25495, + "Ġreacted": 25496, + "Ġoverflow": 25497, + "Ġformalin": 25498, + "ĠUsually": 25499, + "olybden": 25500, + "Ġacad": 25501, + "ATURE": 25502, + "Ġwaveguides": 25503, + "Ġchunk": 25504, + "Ġmodifies": 25505, + "Ġeryt": 25506, + "ĠZhong": 25507, + "Ġgranule": 25508, + "Ġcs": 25509, + "ĠGrade": 25510, + "Ġlandmarks": 25511, + "uristic": 25512, + "Ġamines": 25513, + "ĠIntrinsic": 25514, + "Ġerroneous": 25515, + "Ġlockdown": 25516, + "ypti": 25517, + "Child": 25518, + "Ġuniversities": 25519, + "Ġparasit": 25520, + "Ġignition": 25521, + "Tim": 25522, + "araj": 25523, + "ravel": 25524, + "ĠLands": 25525, + "ĠCircular": 25526, + "Ġrotate": 25527, + "Patients": 25528, + "ĠWB": 25529, + "Ġmyelin": 25530, + "ĠWeiss": 25531, + "Ġdipolar": 25532, + "Ġfollicle": 25533, + "ĠWatson": 25534, + "ĠIncor": 25535, + "Ġfoundations": 25536, + "ĠPip": 25537, + "Ġpressing": 25538, + "Ġforbidden": 25539, + "avan": 25540, + "ĠmAb": 25541, + "union": 25542, + "ĠFresh": 25543, + "ĠCorp": 25544, + "floxacin": 25545, + "coordinate": 25546, + "Ġshunt": 25547, + "Ġconstituted": 25548, + "aniline": 25549, + "Ġtweets": 25550, + "ĠChow": 25551, + "Ġmobilization": 25552, + "zyk": 25553, + "EST": 25554, + "neigh": 25555, + "ĠMeng": 25556, + "ĠResNet": 25557, + "ĠJet": 25558, + "Ġluminous": 25559, + "Ġstressors": 25560, + "does": 25561, + "trifluoromethyl": 25562, + "Ġconcert": 25563, + "ĠChoice": 25564, + "phim": 25565, + "alcoholic": 25566, + "ochem": 25567, + "iltered": 25568, + "Ġpredictable": 25569, + "Ġtran": 25570, + "ĠPra": 25571, + "Ġvalves": 25572, + "Ġautonomy": 25573, + "regulate": 25574, + "ĠBeach": 25575, + "ĠOntology": 25576, + "Ġisofl": 25577, + "Ġquoted": 25578, + "ĠLex": 25579, + "thy": 25580, + "Ġcomplaints": 25581, + "ĠTrees": 25582, + "Ġopposing": 25583, + "ĠAcceler": 25584, + "contrast": 25585, + "Ġcompeted": 25586, + "OE": 25587, + "ĠRoche": 25588, + "issance": 25589, + "Ġpeace": 25590, + "ĠAim": 25591, + "Ġinfertility": 25592, + "ĠAntarctica": 25593, + "thien": 25594, + "Summ": 25595, + "Ġjudgments": 25596, + "amides": 25597, + "Ġspill": 25598, + "Ġhereafter": 25599, + "ĠConstit": 25600, + "computer": 25601, + "Ġbegun": 25602, + "ocentric": 25603, + "Ġpumps": 25604, + "medium": 25605, + "chol": 25606, + "metallic": 25607, + "Ġflares": 25608, + "Ġpetroleum": 25609, + "Ġwithd": 25610, + "ĠTheatre": 25611, + "Ġunlabeled": 25612, + "Ġregularized": 25613, + "osteric": 25614, + "ĠPFS": 25615, + "Ġunem": 25616, + "Ġpresently": 25617, + "Ġbuffered": 25618, + "affinity": 25619, + "ĠDemographic": 25620, + "ĠKondo": 25621, + "Ġcenturies": 25622, + "Ġmigratory": 25623, + "arynx": 25624, + "Associated": 25625, + "anilino": 25626, + "grown": 25627, + "ĠExecutive": 25628, + "ĠEk": 25629, + "ĠHemat": 25630, + "ĠPlayer": 25631, + "ĠCHD": 25632, + "flex": 25633, + "ĠSever": 25634, + "altham": 25635, + "impro": 25636, + "anet": 25637, + "ocyst": 25638, + "ĠAster": 25639, + "COL": 25640, + "ĠSimilarity": 25641, + "ĠHoward": 25642, + "Ġmulticast": 25643, + "ĠEnsemble": 25644, + "ìĹ": 25645, + "olys": 25646, + "ĠGenomics": 25647, + "Ġresonators": 25648, + "Ġfistula": 25649, + "onen": 25650, + "users": 25651, + "Ġhypo": 25652, + "rogens": 25653, + "Ġmedal": 25654, + "ĠMIP": 25655, + "Ġvoltam": 25656, + "Ġappreciated": 25657, + "ĠPé": 25658, + "ĠGaia": 25659, + "Ġbuckling": 25660, + "Ġcongruence": 25661, + "furyl": 25662, + "ĠEpstein": 25663, + "Ġcascades": 25664, + "gold": 25665, + "Ġanhyd": 25666, + "Ġgraduated": 25667, + "Memory": 25668, + "ĠIndustry": 25669, + "ĠSchneider": 25670, + "Ġemployee": 25671, + "ĠCorn": 25672, + "MAC": 25673, + "rove": 25674, + "ropod": 25675, + "service": 25676, + "ĠOxidation": 25677, + "Ġenumeration": 25678, + "mad": 25679, + "ĠClose": 25680, + "ĠModular": 25681, + "Ġprogeny": 25682, + "Ġgt": 25683, + "reading": 25684, + "ĠIndic": 25685, + "opathologic": 25686, + "ĠPFNGL": 25687, + "XL": 25688, + "cis": 25689, + "ĠMike": 25690, + "ĠBBB": 25691, + "ĠExtreme": 25692, + "ĠChoose": 25693, + "Ġhorizontally": 25694, + "ĠASSERT": 25695, + "Ġglucocorticoid": 25696, + "Bay": 25697, + "Ġpdf": 25698, + "Ġcontainers": 25699, + "ĠLOC": 25700, + "ĠYield": 25701, + "oprote": 25702, + "Ġfructose": 25703, + "ĠICC": 25704, + "Ġdecid": 25705, + "rimidine": 25706, + "Ġfragmented": 25707, + "Ġisomorphisms": 25708, + "м": 25709, + "Ġintegrates": 25710, + "Ġfibration": 25711, + "ĠâĬ¤": 25712, + "Ġxenograft": 25713, + "nucleon": 25714, + "ĠCSP": 25715, + "Ġsut": 25716, + "ĠSpir": 25717, + "Ġdissoci": 25718, + "ĠTBI": 25719, + "ĠForces": 25720, + "Ġhypersurface": 25721, + "Ġmyosin": 25722, + "ĠQueensland": 25723, + "Neg": 25724, + "ĠURL": 25725, + "bind": 25726, + "Applied": 25727, + "ĠDob": 25728, + "ĠKE": 25729, + "Ġmemor": 25730, + "ĠArabic": 25731, + "ĠLateral": 25732, + "ĠStart": 25733, + "nose": 25734, + "tibility": 25735, + "asters": 25736, + "Ġusability": 25737, + "Ġincenti": 25738, + "ymn": 25739, + "ĠAnalytic": 25740, + "Pet": 25741, + "ĠMask": 25742, + "World": 25743, + "brand": 25744, + "Ġeliminates": 25745, + "Ġmerit": 25746, + "ĠPhilippines": 25747, + "ĠBCL": 25748, + "ĠOri": 25749, + "Ġparadigms": 25750, + "ĠInters": 25751, + "rizona": 25752, + "Ġconception": 25753, + "Ġrelied": 25754, + "ĠJoe": 25755, + "ĠApple": 25756, + "Ġlightweight": 25757, + "mortem": 25758, + "olig": 25759, + "Ġviz": 25760, + "Ġstones": 25761, + "Ġkeywords": 25762, + "ĠSecretary": 25763, + "TN": 25764, + "older": 25765, + "ĠIntestinal": 25766, + "Ġpossessed": 25767, + "Ġmonotonicity": 25768, + "emitting": 25769, + "ĠDefining": 25770, + "ĠParticularly": 25771, + "Ġautomorphisms": 25772, + "Ġerythemat": 25773, + "ĠWaters": 25774, + "ĠCyclic": 25775, + "maximal": 25776, + "xty": 25777, + "ĠSad": 25778, + "Ġuranium": 25779, + "Ġhypothalamus": 25780, + "ĠSUMO": 25781, + "Ġdealt": 25782, + "Ġkits": 25783, + "Ġpainting": 25784, + "ĠSier": 25785, + "chool": 25786, + "ODO": 25787, + "surfaces": 25788, + "ĠPneum": 25789, + "organized": 25790, + "ĠCPT": 25791, + "Ġinsoluble": 25792, + "ĠCoherent": 25793, + "Ġrecessive": 25794, + "Ġbivariate": 25795, + "Ġedit": 25796, + "Ġnationwide": 25797, + "MODE": 25798, + "chest": 25799, + "ĠSLC": 25800, + "Ġintraperitoneal": 25801, + "ĠDisordered": 25802, + "Ġinsufficiency": 25803, + "iev": 25804, + "iazole": 25805, + "Write": 25806, + "ĠDATA": 25807, + "toral": 25808, + "Ġqualities": 25809, + "Ġpossessing": 25810, + "ĠMats": 25811, + "Ġretinopathy": 25812, + "ĠBK": 25813, + "Ġnovelty": 25814, + "ceans": 25815, + "Ġreserves": 25816, + "ĠNADH": 25817, + "Ġisotherm": 25818, + "Ġsoldiers": 25819, + "pb": 25820, + "iterpen": 25821, + "ĠAgents": 25822, + "zu": 25823, + "Ġunwanted": 25824, + "Ġhyperparameters": 25825, + "ecan": 25826, + "ĠSES": 25827, + "ĠFG": 25828, + "ĠNavig": 25829, + "Ġtriangulation": 25830, + "Ġnetworking": 25831, + "Ġpolystyrene": 25832, + "Ġinductively": 25833, + "breviations": 25834, + "Ġneuromuscular": 25835, + "ĠLinux": 25836, + "studied": 25837, + "ĠBeing": 25838, + "Ġdeficiencies": 25839, + "ĠMatrices": 25840, + "Ġwearing": 25841, + "Ġhadrons": 25842, + "amyl": 25843, + "Ġdiscourse": 25844, + "ochlor": 25845, + "ĠMelan": 25846, + "ĠLan": 25847, + "VL": 25848, + "Ġmunicipal": 25849, + "Ġenrollment": 25850, + "ĠSymmetric": 25851, + "Ġdisciplines": 25852, + "ĠBaron": 25853, + "Research": 25854, + "Ġmagnetite": 25855, + "omide": 25856, + "polarization": 25857, + "leys": 25858, + "Ġseemingly": 25859, + "hepatic": 25860, + "Ġclo": 25861, + "ĠQuatern": 25862, + "Ġcompetit": 25863, + "Requ": 25864, + "gauge": 25865, + "Ġhydrochloride": 25866, + "dropout": 25867, + "panel": 25868, + "Ġaspirin": 25869, + "ĠRUN": 25870, + "Ġribbon": 25871, + "Ġinaccurate": 25872, + "ĠPall": 25873, + "ducers": 25874, + "Throughout": 25875, + "Ġcellul": 25876, + "Ġsuspect": 25877, + "Ġallelic": 25878, + "Ġsnake": 25879, + "ordinated": 25880, + "ĠAutophagy": 25881, + "Ġeig": 25882, + "Ġrif": 25883, + "ĠKennedy": 25884, + "Ġbottle": 25885, + "ĠYouth": 25886, + "awed": 25887, + "linearity": 25888, + "uker": 25889, + "ĠOX": 25890, + "extension": 25891, + "Ġward": 25892, + "ĠComplexes": 25893, + "Ġbiosensor": 25894, + "ĠCartan": 25895, + "dn": 25896, + "Ġsonic": 25897, + "Ġindexing": 25898, + "Ġdv": 25899, + "reliable": 25900, + "pk": 25901, + "RENT": 25902, + "Ġtanks": 25903, + "ĠHet": 25904, + "ĠWing": 25905, + "ĠCuO": 25906, + "Ġprintf": 25907, + "Ġluminosities": 25908, + "course": 25909, + "Ġscram": 25910, + "Ġsampler": 25911, + "Ġmultipliers": 25912, + "Default": 25913, + "odil": 25914, + "intr": 25915, + "sequencing": 25916, + "Ġtransmissions": 25917, + "ĠWhit": 25918, + "ĠOpportun": 25919, + "Ġinternally": 25920, + "Ġacknowledges": 25921, + "ĠEdition": 25922, + "Ġarteri": 25923, + "Ġalbedo": 25924, + "ĠNucleotide": 25925, + "Ġyes": 25926, + "ĠRelativistic": 25927, + "Ġvotes": 25928, + "ĠFormulation": 25929, + "uscitation": 25930, + "Ġconcurrently": 25931, + "uin": 25932, + "Ġnoninvasive": 25933, + "Ġprimates": 25934, + "μl": 25935, + "Ġsubtropical": 25936, + "gun": 25937, + "ĠSoutheast": 25938, + "ön": 25939, + "Ġequator": 25940, + "Ġworkshop": 25941, + "Ġschist": 25942, + "undant": 25943, + "ĠMODIS": 25944, + "tar": 25945, + "Ġaeg": 25946, + "Ġplotting": 25947, + "ĠDET": 25948, + "Manager": 25949, + "uned": 25950, + "oxifen": 25951, + "ĠInver": 25952, + "Ġxanth": 25953, + "ĠServer": 25954, + "Ġstretched": 25955, + "Global": 25956, + "Core": 25957, + "ĠWeber": 25958, + "yard": 25959, + "Ġexplores": 25960, + "ĠBiography": 25961, + "SNP": 25962, + "ĠNeutrino": 25963, + "Ġkilometres": 25964, + "Ġcommutes": 25965, + "Ġacceptability": 25966, + "ĠAntibodies": 25967, + "icol": 25968, + "Ġmuseum": 25969, + "Ġdenit": 25970, + "Ġextrapolated": 25971, + "Ġacetylcholine": 25972, + "Token": 25973, + "ĠFock": 25974, + "onde": 25975, + "Ġdiscriminative": 25976, + "ĠMant": 25977, + "Ġessence": 25978, + "celand": 25979, + "ĠChair": 25980, + "Ġintegrative": 25981, + "ĠSPD": 25982, + "henium": 25983, + "arbonate": 25984, + "BASE": 25985, + "regulates": 25986, + "patch": 25987, + "Ġdib": 25988, + "Ġantisymmetric": 25989, + "Ġwearable": 25990, + "Edge": 25991, + "rets": 25992, + "Ġperceive": 25993, + "ĠMagnesium": 25994, + "adows": 25995, + "Ġdisposal": 25996, + "Ġairport": 25997, + "ausea": 25998, + "fits": 25999, + "Ġnecro": 26000, + "ĠSIN": 26001, + "ĠDuc": 26002, + "ĠReading": 26003, + "bys": 26004, + "Ġreflective": 26005, + "his": 26006, + "ometries": 26007, + "Ġvirial": 26008, + "Ġartificially": 26009, + "children": 26010, + "ĠUltrasound": 26011, + "VIEW": 26012, + "Ġsculpt": 26013, + "Ġsurf": 26014, + "Ġsexually": 26015, + "Ġgeometrically": 26016, + "Ġdivisors": 26017, + "Ġinitiatives": 26018, + "acci": 26019, + "Ġkeratinocytes": 26020, + "aR": 26021, + "arot": 26022, + "Ġïĥ¨": 26023, + "computed": 26024, + "ĠTCGA": 26025, + "psychological": 26026, + "ĠMAN": 26027, + "ĠMPC": 26028, + "ticing": 26029, + "limiting": 26030, + "amins": 26031, + "Ġsurfactants": 26032, + "ĠSerb": 26033, + "Ġrhythms": 26034, + "ĠRouting": 26035, + "wang": 26036, + "Ġmicrostructures": 26037, + "ophytes": 26038, + "Ġanalgesic": 26039, + "FOR": 26040, + "qual": 26041, + "Ġpublish": 26042, + "ĠTiming": 26043, + "porous": 26044, + "ranging": 26045, + "eron": 26046, + "ĠZi": 26047, + "ĠMarshall": 26048, + "Width": 26049, + "Ġisomers": 26050, + "Ġ·": 26051, + "phenoxy": 26052, + "Ġureth": 26053, + "robl": 26054, + "Ġmentioning": 26055, + "ozyme": 26056, + "ĠLud": 26057, + "Ġopposition": 26058, + "Ġabandoned": 26059, + "Ġroutines": 26060, + "ĠHST": 26061, + "mutex": 26062, + "coded": 26063, + "eating": 26064, + "tert": 26065, + "emiconductor": 26066, + "dw": 26067, + "Ġbaryons": 26068, + "Ġleucine": 26069, + "otron": 26070, + "Ġendos": 26071, + "Ġreproduces": 26072, + "Ġanalgesia": 26073, + "Ġimmunoreactivity": 26074, + "ĠPrep": 26075, + "ĠGarcÃŃa": 26076, + "Ġincoherent": 26077, + "aned": 26078, + "lepton": 26079, + "andra": 26080, + "ulae": 26081, + "ĠHidden": 26082, + "FV": 26083, + "Ġgeneralizes": 26084, + "ĠStevens": 26085, + "ĠFoster": 26086, + "Ġfreshly": 26087, + "Ġhf": 26088, + "Denote": 26089, + "oes": 26090, + "ĠDin": 26091, + "Ġdetox": 26092, + "Ġdecoupled": 26093, + "Ġseparations": 26094, + "ucleotide": 26095, + "Ġelectrophysiological": 26096, + "ĠBALB": 26097, + "QTL": 26098, + "ĠACh": 26099, + "ĠRele": 26100, + "quez": 26101, + "MnO": 26102, + "ectures": 26103, + "Ġischa": 26104, + "Ġinsulators": 26105, + "cellulose": 26106, + "ĠFLAG": 26107, + "ombic": 26108, + "ĠUsed": 26109, + "jiang": 26110, + "expansion": 26111, + "ĠRepeat": 26112, + "ĠReserve": 26113, + "abelian": 26114, + "ĠHunting": 26115, + "GRO": 26116, + "lyte": 26117, + "ĠBark": 26118, + "Ġcreative": 26119, + "Ġbend": 26120, + "elerated": 26121, + "dish": 26122, + "Ġhighway": 26123, + "Ġcrossings": 26124, + "just": 26125, + "ono": 26126, + "ullivan": 26127, + "ĠDead": 26128, + "Ġtradeoff": 26129, + "eon": 26130, + "ogical": 26131, + "experiment": 26132, + "Ġconfers": 26133, + "ĠDot": 26134, + "Ġcoils": 26135, + "Ġaxion": 26136, + "ĠIRS": 26137, + "ĠÅ©": 26138, + "Ġglacier": 26139, + "ĠMoscow": 26140, + "ĠSpringer": 26141, + "Ġinvis": 26142, + "ĠArnold": 26143, + "University": 26144, + "attern": 26145, + "peror": 26146, + "ĠLimits": 26147, + "Ġincompatible": 26148, + "rather": 26149, + "ĠTes": 26150, + "Ġfailing": 26151, + "Ġthickening": 26152, + "Ġestradiol": 26153, + "asse": 26154, + "Ġnecessit": 26155, + "Ġsacrificed": 26156, + "ĠSear": 26157, + "ĠNorthe": 26158, + "raisebox": 26159, + "ĠSlow": 26160, + "ĠMunic": 26161, + "Ġlearner": 26162, + "igenic": 26163, + "Ġdermatitis": 26164, + "uten": 26165, + "Ġdeer": 26166, + "Ġhistamine": 26167, + "Lat": 26168, + "Mal": 26169, + "illy": 26170, + "Ġgeochemical": 26171, + "Ġspermatozoa": 26172, + "Ġvinyl": 26173, + "emet": 26174, + "Ġeffectors": 26175, + "ĠEncyclopedia": 26176, + "Ġordinal": 26177, + "Ġcontroversy": 26178, + "ĠPerspectives": 26179, + "oviruses": 26180, + "marked": 26181, + "ĠSPE": 26182, + "ĠNutri": 26183, + "Ġadhere": 26184, + "ĠHighway": 26185, + "Ġdistillation": 26186, + "MRT": 26187, + "pletion": 26188, + "Ġannihil": 26189, + "Ġwavefunction": 26190, + "Ġconfigured": 26191, + "Ġmethionine": 26192, + "Low": 26193, + "sensor": 26194, + "ĠSnow": 26195, + "Sample": 26196, + "Ġdefinitely": 26197, + "ĠMeth": 26198, + "rypt": 26199, + "Ġprompted": 26200, + "Ġmonolith": 26201, + "ĠEnvironments": 26202, + "tm": 26203, + "ĠCOD": 26204, + "oris": 26205, + "equations": 26206, + "âĺĨ": 26207, + "ĠNeighbor": 26208, + "Ġimagine": 26209, + "ĠUsers": 26210, + "ĠCamera": 26211, + "ĠModification": 26212, + "ĠAttacks": 26213, + "Ġinhalation": 26214, + "áº": 26215, + "Ġventil": 26216, + "ĠNU": 26217, + "ĠContrast": 26218, + "Ġconfining": 26219, + "Service": 26220, + "Wallis": 26221, + "ĠATR": 26222, + "Ġsubduction": 26223, + "Ġïģ¢": 26224, + "Ġtitration": 26225, + "Roche": 26226, + "viv": 26227, + "Ġbears": 26228, + "bola": 26229, + "Ġblinded": 26230, + "measures": 26231, + "ĠStack": 26232, + "occurrence": 26233, + "Ġpermeation": 26234, + "lar": 26235, + "eptors": 26236, + "ĠDIF": 26237, + "corrhiz": 26238, + "ĠVisc": 26239, + "figurable": 26240, + "Ġscheduler": 26241, + "Ġoccasions": 26242, + "amboo": 26243, + "Ġamp": 26244, + "gain": 26245, + "ĠCit": 26246, + "Ġpreceded": 26247, + "Ġtactile": 26248, + "Ġïĥ¦": 26249, + "generic": 26250, + "Ġretrograde": 26251, + "Ġfans": 26252, + "Ġfisher": 26253, + "Ġlights": 26254, + "eeper": 26255, + "Ġundesirable": 26256, + "wald": 26257, + "embol": 26258, + "Ġwrist": 26259, + "Ġauthorized": 26260, + "Ġchondrocytes": 26261, + "ĠEPA": 26262, + "neu": 26263, + "ĠOperations": 26264, + "Ġcheap": 26265, + "Ġanionic": 26266, + "ĠOregon": 26267, + "cot": 26268, + "reason": 26269, + "existence": 26270, + "ĠFinancial": 26271, + "olybdenum": 26272, + "cus": 26273, + "ĠNON": 26274, + "Ġlocked": 26275, + "Bit": 26276, + "Sil": 26277, + "mixing": 26278, + "ĠSites": 26279, + "aproteobacteria": 26280, + "ĠInner": 26281, + "Ġcarc": 26282, + "Ġbiotic": 26283, + "ĠFlag": 26284, + "Ġmagic": 26285, + "kinetic": 26286, + "icted": 26287, + "Ġbulb": 26288, + "supset": 26289, + "pez": 26290, + "derivative": 26291, + "ĠeIF": 26292, + "ĠRough": 26293, + "directional": 26294, + "exit": 26295, + "axy": 26296, + "xtures": 26297, + "phimurium": 26298, + "ĠTFs": 26299, + "athin": 26300, + "Ġorch": 26301, + "Ġspectro": 26302, + "ductase": 26303, + "quinolin": 26304, + "Ġgrasp": 26305, + "Ġparsing": 26306, + "Ġdifficile": 26307, + "ĠLDH": 26308, + "ĠJupiter": 26309, + "ĠFIF": 26310, + "ĠPrize": 26311, + "Ġintentions": 26312, + "session": 26313, + "powered": 26314, + "ĠBam": 26315, + "phasic": 26316, + "Ġignoring": 26317, + "ĠRichardson": 26318, + "principles": 26319, + "Ġofficially": 26320, + "Ct": 26321, + "Ġincon": 26322, + "ĠRegulates": 26323, + "Ġmisc": 26324, + "ĠEZ": 26325, + "Ġsynonym": 26326, + "Ġunfolding": 26327, + "ĠDEC": 26328, + "ĠRX": 26329, + "PDF": 26330, + "Ġbranes": 26331, + "typically": 26332, + "Ġcages": 26333, + "ifolia": 26334, + "ugu": 26335, + "ollen": 26336, + "Ġtablet": 26337, + "ĠSah": 26338, + "ĠPVD": 26339, + "Ġalert": 26340, + "Ġformerly": 26341, + "ĠKRAS": 26342, + "sun": 26343, + "Ġdeacetyl": 26344, + "Mer": 26345, + "Ġskewed": 26346, + "ĠPleistocene": 26347, + "ĠBetter": 26348, + "ĠHud": 26349, + "ĠBrook": 26350, + "Ġpts": 26351, + "ĠHU": 26352, + "omo": 26353, + "agrass": 26354, + "Ġenvironmentally": 26355, + "Ġhonest": 26356, + "ĠNine": 26357, + "Ġpigments": 26358, + "links": 26359, + "ĠTOP": 26360, + "ĠCytoplasm": 26361, + "Gib": 26362, + "Ġaccessing": 26363, + "mias": 26364, + "Ġexplosive": 26365, + "Ġreside": 26366, + "artan": 26367, + "Ġtransitional": 26368, + "Ġunprecedented": 26369, + "Ġrom": 26370, + "ĠTNFα": 26371, + "Ġprecipitated": 26372, + "Ġtie": 26373, + "ISS": 26374, + "Ġthicker": 26375, + "ĠLatent": 26376, + "ĠValueError": 26377, + "dq": 26378, + "dma": 26379, + "Ġchromatic": 26380, + "ĠSubsection": 26381, + "ĠFACS": 26382, + "Ġrenormalized": 26383, + "Prop": 26384, + "mTOR": 26385, + "ĠHCO": 26386, + "Ġoverlo": 26387, + "bsiella": 26388, + "ylobacter": 26389, + "Ġneuroimaging": 26390, + "Ġassemblage": 26391, + "Ġexpands": 26392, + "ĠîĪ": 26393, + "ĠFun": 26394, + "Ġcitation": 26395, + "IKV": 26396, + "Ġtroops": 26397, + "inistic": 26398, + "Ġcubes": 26399, + "Ġfont": 26400, + "ĠHos": 26401, + "geries": 26402, + "Ġsuccessively": 26403, + "Ġdecoherence": 26404, + "Springer": 26405, + "hin": 26406, + "atine": 26407, + "ĠâĪ¥": 26408, + "SAS": 26409, + "ét": 26410, + "ĠSediment": 26411, + "uously": 26412, + "ĠWars": 26413, + "indicated": 26414, + "Ġflask": 26415, + "AIDS": 26416, + "Ġcra": 26417, + "ĠLot": 26418, + "Ġprimal": 26419, + "Ġjustice": 26420, + "zag": 26421, + "Ġmaxillary": 26422, + "Ġgeneralizations": 26423, + "uela": 26424, + "Ġtagging": 26425, + "Ġpupil": 26426, + "Ġinexpensive": 26427, + "Ġwatch": 26428, + "ĠAMD": 26429, + "ĠFir": 26430, + "Ġneuroblastoma": 26431, + "Ġmaximizes": 26432, + "ĠObserved": 26433, + "mixture": 26434, + "Ġopportunistic": 26435, + "trial": 26436, + "ahan": 26437, + "Ġïģ¬": 26438, + "Ġcatar": 26439, + "ĠControls": 26440, + "ĠNewman": 26441, + "Ġmicrostructural": 26442, + "borns": 26443, + "Ġoxygenation": 26444, + "ĠMacro": 26445, + "ĠJak": 26446, + "plicating": 26447, + "Ġoligodend": 26448, + "Ġresorption": 26449, + "Ġdorm": 26450, + "Ġsolvers": 26451, + "ĠKruskal": 26452, + "ĠRevolution": 26453, + "ĠGastro": 26454, + "Driven": 26455, + "Ġtiter": 26456, + "Ġori": 26457, + "ĠPCL": 26458, + "Ġwetlands": 26459, + "Ġarticular": 26460, + "CCA": 26461, + "enoic": 26462, + "Ġtrick": 26463, + "operiod": 26464, + "ĠCochrane": 26465, + "aday": 26466, + "ĠCerebral": 26467, + "Ġmodulators": 26468, + "ĠSSC": 26469, + "Ġactivations": 26470, + "Ġadapting": 26471, + "ĠScalable": 26472, + "none": 26473, + "pip": 26474, + "Ġprivi": 26475, + "ĠPseudo": 26476, + "Ġdisappears": 26477, + "ĠEur": 26478, + "Ġunconstrained": 26479, + "Ġsubmit": 26480, + "Ġreputation": 26481, + "atar": 26482, + "ĠBai": 26483, + "arians": 26484, + "ĠIntracellular": 26485, + "trees": 26486, + "Ġwetting": 26487, + "ĠFrances": 26488, + "Ġeligibility": 26489, + "folder": 26490, + "ĠStaff": 26491, + "oki": 26492, + "Ġstrengthened": 26493, + "ĠCob": 26494, + "teral": 26495, + "ĠYeast": 26496, + "bye": 26497, + "decoder": 26498, + "Ġrainbow": 26499, + "perturbed": 26500, + "vc": 26501, + "Ġsupplemental": 26502, + "Ġbirths": 26503, + "WO": 26504, + "conc": 26505, + "stitution": 26506, + "hybrid": 26507, + "Ġki": 26508, + "Ġhypere": 26509, + "ĠSMA": 26510, + "formula": 26511, + "Ġundefined": 26512, + "naphth": 26513, + "Ġdeclining": 26514, + "Ġshielding": 26515, + "Yau": 26516, + "Ġrever": 26517, + "ĠWilk": 26518, + "Ġdecimal": 26519, + "HCO": 26520, + "angered": 26521, + "Ġerythrocyte": 26522, + "ĉĉĠĠĠ": 26523, + "nuclear": 26524, + "Ġabnormality": 26525, + "Pres": 26526, + "Participants": 26527, + "ĠWagner": 26528, + "Ġfibrils": 26529, + "Ġfetus": 26530, + "ĠExpress": 26531, + "request": 26532, + "minimum": 26533, + "ĠBooks": 26534, + "hetamine": 26535, + "ushes": 26536, + "ĠBach": 26537, + "ĠDOS": 26538, + "lectric": 26539, + "ĠTween": 26540, + "ĠHughes": 26541, + "Ġmartens": 26542, + "Ġnematic": 26543, + "Ġexperimentation": 26544, + "ĠParker": 26545, + "Ġepisodic": 26546, + "Ġtelem": 26547, + "ADE": 26548, + "columns": 26549, + "Ġfundamentally": 26550, + "enet": 26551, + "ĠVl": 26552, + "earth": 26553, + "Ġquantile": 26554, + "ĠReplication": 26555, + "Ġcleared": 26556, + "Energy": 26557, + "Smith": 26558, + "Ġantidepressant": 26559, + "mx": 26560, + "pmod": 26561, + "amid": 26562, + "Ġserotype": 26563, + "Ġundergraduate": 26564, + "ĠArizona": 26565, + "Ġpushed": 26566, + "ulu": 26567, + "ĠNIC": 26568, + "Ġrheological": 26569, + "omegal": 26570, + "ĠQing": 26571, + "orch": 26572, + "irmed": 26573, + "ĠQuery": 26574, + "Ġsandwich": 26575, + "Ġclinician": 26576, + "ĠElliptic": 26577, + "ĠMeh": 26578, + "DEV": 26579, + "ĠDetermining": 26580, + "alcogen": 26581, + "bench": 26582, + "azep": 26583, + "ĠMississ": 26584, + "tizing": 26585, + "ĠRBC": 26586, + "Ġofficials": 26587, + "Tag": 26588, + "kT": 26589, + "luence": 26590, + "ĠRoom": 26591, + "Ġlectin": 26592, + "bara": 26593, + "kyl": 26594, + "OND": 26595, + "ĠDose": 26596, + "Ġprism": 26597, + "Ġreductive": 26598, + "ĠSpectroscopic": 26599, + "odied": 26600, + "colone": 26601, + "ĠCONFIG": 26602, + "Ġbrittle": 26603, + "inverse": 26604, + "ĠBuff": 26605, + "ytocin": 26606, + "Ġformations": 26607, + "ĠConventional": 26608, + "prev": 26609, + "Ġferrite": 26610, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 26611, + "Ġadopts": 26612, + "ĠMiocene": 26613, + "management": 26614, + "ĠCRF": 26615, + "ĠHelm": 26616, + "Ġdoubled": 26617, + "ĠEFFECT": 26618, + "Ġdance": 26619, + "structions": 26620, + "rait": 26621, + "ifers": 26622, + "ellip": 26623, + "utting": 26624, + "prof": 26625, + "ĠQin": 26626, + "Ġabsc": 26627, + "Ġexploits": 26628, + "Ġcyber": 26629, + "definition": 26630, + "ĠCoronary": 26631, + "Ġdeterg": 26632, + "ĠPerception": 26633, + "ĠCurves": 26634, + "Ġnematodes": 26635, + "Ġlistening": 26636, + "Ġcatalase": 26637, + "Coll": 26638, + "ré": 26639, + "islative": 26640, + "Ġarriving": 26641, + "Ġviolating": 26642, + "д": 26643, + "hetics": 26644, + "ĠJar": 26645, + "concept": 26646, + "Ġbrush": 26647, + "immunity": 26648, + "Ġfingerprint": 26649, + "resid": 26650, + "Ġelevations": 26651, + "ockets": 26652, + "Ġcatechol": 26653, + "иÑ": 26654, + "Ġprecipitates": 26655, + "Ġsoccer": 26656, + "insulin": 26657, + "Ġpursue": 26658, + "ĠICA": 26659, + "ĠPolice": 26660, + "ĠMurphy": 26661, + "Task": 26662, + "ĠCoc": 26663, + "ĠHabit": 26664, + "ĠKP": 26665, + "Ġfloral": 26666, + "Ġhun": 26667, + "Ġhydrogenation": 26668, + "Ġspong": 26669, + "Ġchimeric": 26670, + "ĠKoch": 26671, + "gon": 26672, + "ĠSchur": 26673, + "ĠGreater": 26674, + "RX": 26675, + "Ġcing": 26676, + "ĠWaltham": 26677, + "angling": 26678, + "Ġcounties": 26679, + "Ġlamina": 26680, + "Ġcouncil": 26681, + "sort": 26682, + "ĠBarc": 26683, + "ĠDow": 26684, + "ĠZeng": 26685, + "Ġdevised": 26686, + "uitable": 26687, + "Ġmethylene": 26688, + "Ġsuperiority": 26689, + "Ġepidermis": 26690, + "Ġprag": 26691, + "ĠPED": 26692, + "threatening": 26693, + "ishi": 26694, + "Ġepsilon": 26695, + "address": 26696, + "ENTAL": 26697, + "ĠBle": 26698, + "ĠAntonio": 26699, + "oother": 26700, + "ĠAgar": 26701, + "Ġneighborhoods": 26702, + "Ġshortened": 26703, + "STATE": 26704, + "ĠSerial": 26705, + "MAR": 26706, + "OU": 26707, + "Ġencapsulation": 26708, + "ĠConsortium": 26709, + "Dr": 26710, + "profile": 26711, + "Ġemitter": 26712, + "Ġnecrotic": 26713, + "ĠAutonomous": 26714, + "ĠPhosphorylation": 26715, + "minim": 26716, + "anthin": 26717, + "ĠSph": 26718, + "ĠGur": 26719, + "dihydroxy": 26720, + "distributed": 26721, + "ĠRPMI": 26722, + "stones": 26723, + "Ġhyperfine": 26724, + "Ġislet": 26725, + "ĠSlo": 26726, + "pletely": 26727, + "Ġinactivated": 26728, + "ĠAgriculture": 26729, + "Ġtremend": 26730, + "Ġeveryone": 26731, + "omponent": 26732, + "ZnO": 26733, + "MPI": 26734, + "ĠDiamond": 26735, + "Ġ⣨": 26736, + "Cost": 26737, + "Ġdisabilities": 26738, + "inver": 26739, + "ĠCensus": 26740, + "echo": 26741, + "Ġvegetative": 26742, + "Ġwillingness": 26743, + "Ġrecap": 26744, + "ĠConstraint": 26745, + "ĠPatrick": 26746, + "Ġovert": 26747, + "Ġmoieties": 26748, + "orax": 26749, + "ippi": 26750, + "Direct": 26751, + "Ġcaries": 26752, + "Ġlocalities": 26753, + "lattices": 26754, + "ĠExploration": 26755, + "ĠAW": 26756, + "Ġlocking": 26757, + "Ġcoincident": 26758, + "Ġmultimedia": 26759, + "Ġtemporarily": 26760, + "ĠCaus": 26761, + "encia": 26762, + "Ġweathering": 26763, + "ĠHelicobacter": 26764, + "ĠThings": 26765, + "hips": 26766, + "moving": 26767, + "Ġsigmoid": 26768, + "isin": 26769, + "ĠBec": 26770, + "Ġmicrograms": 26771, + "bounds": 26772, + "ĠColumn": 26773, + "Ġcommuting": 26774, + "ĠJen": 26775, + "Ġhourly": 26776, + "MSC": 26777, + "Ġattendance": 26778, + "ĠâIJ£": 26779, + "ĠEO": 26780, + "prog": 26781, + "Ġrapamycin": 26782, + "ĠPredictors": 26783, + "ĠRetrieved": 26784, + "Ġsubspecies": 26785, + "Ġderives": 26786, + "ĠĤ": 26787, + "ĠGenerating": 26788, + "anners": 26789, + "Ġvolat": 26790, + "Ġvisiting": 26791, + "ĠCalculations": 26792, + "ña": 26793, + "Ġdesert": 26794, + "Ġexpectancy": 26795, + "BMCs": 26796, + "ĠExplo": 26797, + "Ġtravelling": 26798, + "icum": 26799, + "Ġsubdivision": 26800, + "Ġcrosslinking": 26801, + "benzoth": 26802, + "ĠTon": 26803, + "REN": 26804, + "Ġleth": 26805, + "rabbit": 26806, + "ĠAbove": 26807, + "ulted": 26808, + "Ġconstric": 26809, + "Jones": 26810, + "zhou": 26811, + "vern": 26812, + "ĠLady": 26813, + "ĠBuffer": 26814, + "ĠControlling": 26815, + "Ġmultiscale": 26816, + "nikov": 26817, + "acycl": 26818, + "Ġprosthesis": 26819, + "Af": 26820, + "ĠCorps": 26821, + "structed": 26822, + "Grid": 26823, + "inning": 26824, + "olding": 26825, + "Ġthiol": 26826, + "ikov": 26827, + "âĢ¢âĢ¢âĢ¢": 26828, + "Ġgovernments": 26829, + "rapping": 26830, + "Ġthrombocyt": 26831, + "Leg": 26832, + "RY": 26833, + "ĠIceland": 26834, + "ocycle": 26835, + "ĠMemorial": 26836, + "got": 26837, + "Ġidem": 26838, + "ĠBuild": 26839, + "olipoprotein": 26840, + "DV": 26841, + "Ġphthal": 26842, + "richment": 26843, + "ĠHaem": 26844, + "Ġanswering": 26845, + "ĠIJ": 26846, + "Ġtransgene": 26847, + "Ġrenamed": 26848, + "ĠImageJ": 26849, + "Ġcassette": 26850, + "Ġcoalescence": 26851, + "Ġcompaction": 26852, + "Ġwildlife": 26853, + "Ġwins": 26854, + "Ġsupernovae": 26855, + "enteric": 26856, + "isphere": 26857, + "Ġtracker": 26858, + "Ġevidences": 26859, + "Ġcomorbidity": 26860, + "ĠRules": 26861, + "phasing": 26862, + "ĠLangevin": 26863, + "ĠFit": 26864, + "Ġpsychiat": 26865, + "Ġbreakthrough": 26866, + "Ġcholinergic": 26867, + "ĠMetall": 26868, + "breeding": 26869, + "itinib": 26870, + "Ġsolo": 26871, + "abling": 26872, + "elief": 26873, + "oscill": 26874, + "rev": 26875, + "arya": 26876, + "Ġgoodness": 26877, + "ĠPBE": 26878, + "Ġawards": 26879, + "Ġcrani": 26880, + "Ġphotograp": 26881, + "arents": 26882, + "Ġfixes": 26883, + "rÃŃ": 26884, + "assuming": 26885, + "Ġcongruent": 26886, + "ĠMother": 26887, + "ĠNap": 26888, + "ĠProc": 26889, + "Ġcategorization": 26890, + "inch": 26891, + "ĠHorm": 26892, + "ĠInterventions": 26893, + "Ġnonequilibrium": 26894, + "Ġencrypted": 26895, + "primary": 26896, + "iens": 26897, + "lac": 26898, + "rams": 26899, + "Ġboards": 26900, + "ĠHell": 26901, + "charged": 26902, + "Ġperioperative": 26903, + "emp": 26904, + "ĠInvolvement": 26905, + "Russ": 26906, + "univers": 26907, + "ĠDJ": 26908, + "Ġdisagreement": 26909, + "Ġpert": 26910, + "Ġstroma": 26911, + "Ġcalcite": 26912, + "Ġrotary": 26913, + "Ġmethyltransferase": 26914, + "Ġancestry": 26915, + "ĠWitten": 26916, + "CRC": 26917, + "uretic": 26918, + "ophyta": 26919, + "provided": 26920, + "Ġcorrespondingly": 26921, + "bigcap": 26922, + "ĠAgilent": 26923, + "ë": 26924, + "rooms": 26925, + "Ġdisent": 26926, + "Ġdilutions": 26927, + "ĠMyel": 26928, + "Ġquasar": 26929, + "Ġtilted": 26930, + "Ġinternalization": 26931, + "ĠPrivate": 26932, + "ĠFriedman": 26933, + "Ġseventh": 26934, + "ĠClosed": 26935, + "CTC": 26936, + "gren": 26937, + "ĠColombia": 26938, + "odel": 26939, + "Ġpolitics": 26940, + "ĠMSSM": 26941, + "Ġmate": 26942, + "Ġcommod": 26943, + "ĠRus": 26944, + "Ġanesthetized": 26945, + "together": 26946, + "ĠBCS": 26947, + "ewski": 26948, + "romagnet": 26949, + "ĠCun": 26950, + "Ġcurative": 26951, + "Ġimputation": 26952, + "Ġcarbide": 26953, + "DFT": 26954, + "nsic": 26955, + "bee": 26956, + "Ġsplen": 26957, + "ĠMaryland": 26958, + "Ġoligonucleotide": 26959, + "ĠVeget": 26960, + "buffered": 26961, + "National": 26962, + "letic": 26963, + "ĠSyl": 26964, + "Ġseab": 26965, + "ardial": 26966, + "Ġportray": 26967, + "Ġaberrations": 26968, + "Ġstorms": 26969, + "ĠShan": 26970, + "ĠGenBank": 26971, + "issa": 26972, + "Ġcet": 26973, + "Ġbench": 26974, + "ĠRecommendations": 26975, + "Ġtriples": 26976, + "Ġïĥ¥": 26977, + "ĠNeuros": 26978, + "Ġdiscom": 26979, + "season": 26980, + "ĠExec": 26981, + "changing": 26982, + "Ġarrives": 26983, + "Hash": 26984, + "mRNA": 26985, + "Ġfric": 26986, + "asa": 26987, + "obia": 26988, + "Ġpostsynaptic": 26989, + "optimizer": 26990, + "ĠClouds": 26991, + "Ġhypersensitivity": 26992, + "vacc": 26993, + "ĠSig": 26994, + "philic": 26995, + "Ġgrounded": 26996, + "ĠWan": 26997, + "ĠCalabi": 26998, + "ĠMachines": 26999, + "Ġaxisymmetric": 27000, + "ĠSteve": 27001, + "Ġpulled": 27002, + "ĠExcel": 27003, + "Ġdiamonds": 27004, + "KR": 27005, + "West": 27006, + "ĠDest": 27007, + "Ġannular": 27008, + "Ġarchive": 27009, + "Ġparenchyma": 27010, + "ĠEH": 27011, + "ópez": 27012, + "Ġunpublished": 27013, + "Ġsoutheastern": 27014, + "Ġnests": 27015, + "dimensions": 27016, + "latitude": 27017, + "Orig": 27018, + "eced": 27019, + "ĠDraw": 27020, + "redshift": 27021, + "Ġamyl": 27022, + "omyelitis": 27023, + "Why": 27024, + "caro": 27025, + "iq": 27026, + "assess": 27027, + "ĠContin": 27028, + "Ġchirality": 27029, + "matical": 27030, + "Ġchaperone": 27031, + "Ġendometriosis": 27032, + "relu": 27033, + "Ġconverged": 27034, + "broad": 27035, + "ĠIterative": 27036, + "Ġvasculature": 27037, + "fund": 27038, + "ĠFly": 27039, + "Ġantigenic": 27040, + "Ġmeningitis": 27041, + "Ġentails": 27042, + "horn": 27043, + "Ġlocomotor": 27044, + "izard": 27045, + "Ġuneven": 27046, + "parity": 27047, + "packet": 27048, + "tubulin": 27049, + "Ġsewage": 27050, + "Ġdecentralized": 27051, + "Ġgrafted": 27052, + "Ġsep": 27053, + "ĠExtensive": 27054, + "Ġspline": 27055, + "quer": 27056, + "archit": 27057, + "Ġprimate": 27058, + "Ġïģ±": 27059, + "pyrimidin": 27060, + "ĠSAP": 27061, + "Ġunderlie": 27062, + "Ġanalyzes": 27063, + "ĠCCA": 27064, + "recogn": 27065, + "IPT": 27066, + "Different": 27067, + "ĠTEST": 27068, + "Ġunfavorable": 27069, + "edic": 27070, + "ĠAbnormal": 27071, + "pyrimidine": 27072, + "urine": 27073, + "embedded": 27074, + "varies": 27075, + "otropin": 27076, + "Ġsemen": 27077, + "Ġtransmittance": 27078, + "Ġabras": 27079, + "Ġó¸Ģł": 27080, + "Ġtriglyceride": 27081, + "bundle": 27082, + "ĠYb": 27083, + "ĠCarr": 27084, + "Ġnaming": 27085, + "Weight": 27086, + "Ġcondensates": 27087, + "Ġnos": 27088, + "amard": 27089, + "vertices": 27090, + "ELS": 27091, + "idone": 27092, + "Ġcontest": 27093, + "Ġheading": 27094, + "ĠGalerkin": 27095, + "GV": 27096, + "ĠGli": 27097, + "Ġfermented": 27098, + "Ġbilingual": 27099, + "Ġticks": 27100, + "Ġkary": 27101, + "ragal": 27102, + "ĠAber": 27103, + "ĠYouTube": 27104, + "UCTURE": 27105, + "branch": 27106, + "ر": 27107, + "ĠFH": 27108, + "onoi": 27109, + "imotor": 27110, + "Ġverifying": 27111, + "ĠConceptual": 27112, + "ĠDeterminants": 27113, + "urm": 27114, + "uronic": 27115, + "ĠKau": 27116, + "ĠConformal": 27117, + "Ġdropping": 27118, + "ĠFlows": 27119, + "gluon": 27120, + "again": 27121, + "ĠMRSA": 27122, + "warf": 27123, + "Ġemphasizes": 27124, + "Entry": 27125, + "ĠASP": 27126, + "resol": 27127, + "ventricular": 27128, + "ĠâĨĶ": 27129, + "Ġoverexpressing": 27130, + "omegalovirus": 27131, + "inoc": 27132, + "SCO": 27133, + "ĠPARP": 27134, + "ĠSchul": 27135, + "ĠCamb": 27136, + "ĠPod": 27137, + "ĠPun": 27138, + "ĠCompetition": 27139, + "ĠGATA": 27140, + "Ġmoon": 27141, + "Ġputs": 27142, + "angiogenic": 27143, + "ĠRepublican": 27144, + "ĠUbiqu": 27145, + "eys": 27146, + "ĠGong": 27147, + "arger": 27148, + "ĠIntermediate": 27149, + "Ġinterpolated": 27150, + "Ġenlargement": 27151, + "Ġinstruct": 27152, + "Ġrc": 27153, + "dioxo": 27154, + "eye": 27155, + "ĠCarls": 27156, + "ĠMeasured": 27157, + "ircles": 27158, + "ĠRaf": 27159, + "Ġarb": 27160, + "examples": 27161, + "Mi": 27162, + "ĠStern": 27163, + "ĠFK": 27164, + "Ġmillisecond": 27165, + "ĠIRF": 27166, + "ĠEpithelial": 27167, + "edicine": 27168, + "eles": 27169, + "sig": 27170, + "âĪĢ": 27171, + "ĠWiener": 27172, + "bauer": 27173, + "ouses": 27174, + "Ġcoloured": 27175, + "ĠIncrease": 27176, + "Ġtriglycerides": 27177, + "Ġaegypti": 27178, + "ĠNumerous": 27179, + "Ġretardation": 27180, + "Ġintercellular": 27181, + "ĠKlebsiella": 27182, + "ĠDra": 27183, + "ĠDIC": 27184, + "ĠThreshold": 27185, + "rainment": 27186, + "Ġreproducing": 27187, + "Ġulcers": 27188, + "Ġarousal": 27189, + "ĠHills": 27190, + "Ġcalves": 27191, + "ĠReservoir": 27192, + "ĠRadar": 27193, + "Ġpsychosis": 27194, + "ĠFORM": 27195, + "duration": 27196, + "ĠAcademic": 27197, + "catal": 27198, + "olla": 27199, + "olol": 27200, + "ĠCron": 27201, + "iko": 27202, + "Ġextremes": 27203, + "ĠTrypan": 27204, + "Ġbip": 27205, + "Ġalginate": 27206, + "ĠHoch": 27207, + "ĠBennett": 27208, + "ĠHippocamp": 27209, + "ĠGeological": 27210, + "Nevertheless": 27211, + "ĠHes": 27212, + "ĠAdding": 27213, + "Ġexternally": 27214, + "Ġslag": 27215, + "Ġteach": 27216, + "ĠStanley": 27217, + "controller": 27218, + "ĠUnits": 27219, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 27220, + "Ġaerodynamic": 27221, + "ovalent": 27222, + "cube": 27223, + "ÅŁ": 27224, + "require": 27225, + "romolecules": 27226, + "irteen": 27227, + "Ġclauses": 27228, + "Ġdefeat": 27229, + "policy": 27230, + "Ġfaithful": 27231, + "Ġpq": 27232, + "ĠTanaka": 27233, + "ĠEver": 27234, + "Ġunpredict": 27235, + "auty": 27236, + "ĠGALAX": 27237, + "Ġtide": 27238, + "ĠFiltering": 27239, + "Ġeuthan": 27240, + "merce": 27241, + "DEX": 27242, + "Ġnesting": 27243, + "DN": 27244, + "IRT": 27245, + "ĠThr": 27246, + "tissue": 27247, + "Ġpalae": 27248, + "Ï©": 27249, + "Ġdilated": 27250, + "Ġpinning": 27251, + "Rb": 27252, + "ĠSap": 27253, + "ragonal": 27254, + "ĠSPR": 27255, + "ĠDial": 27256, + "Ġacupuncture": 27257, + "diameter": 27258, + "ĠPCB": 27259, + "Parameters": 27260, + "ĠProfiles": 27261, + "transfected": 27262, + "liter": 27263, + "ĠRights": 27264, + "Ġcontributor": 27265, + "ĠCorrel": 27266, + "Ġregressions": 27267, + "Ġsegmental": 27268, + "Shape": 27269, + "IAN": 27270, + "ecom": 27271, + "comings": 27272, + "Ġhemorrhagic": 27273, + "opos": 27274, + "Ġrefraction": 27275, + "PFC": 27276, + "proj": 27277, + "ovo": 27278, + "ĠDerived": 27279, + "Ġundirected": 27280, + "Ġlos": 27281, + "Ġengaging": 27282, + "cans": 27283, + "Ġdestructive": 27284, + "Pop": 27285, + "Ġmakers": 27286, + "ĠWor": 27287, + "ĠAreas": 27288, + "vasion": 27289, + "Ġparaformaldehyde": 27290, + "abinoid": 27291, + "cpy": 27292, + "proxim": 27293, + "Ġenamel": 27294, + "Ġpaediatric": 27295, + "ĠChildhood": 27296, + "Ġpectin": 27297, + "ofilm": 27298, + "Ġcarboxylic": 27299, + "Ġausten": 27300, + "Ġunequal": 27301, + "ĠCountry": 27302, + "Ġiterated": 27303, + "Ġflanking": 27304, + "Ġtraction": 27305, + "anson": 27306, + "iscus": 27307, + "ĠDavies": 27308, + "raham": 27309, + "terozoic": 27310, + "ĠBrass": 27311, + "Oc": 27312, + "Ġunification": 27313, + "meter": 27314, + "ĠNeon": 27315, + "building": 27316, + "icting": 27317, + "Ġjustification": 27318, + "Prior": 27319, + "Ġfirms": 27320, + "Ġeducated": 27321, + "Ġintersecting": 27322, + "Ġboosting": 27323, + "Pass": 27324, + "member": 27325, + "contains": 27326, + "rano": 27327, + "relax": 27328, + "ĠCollaborative": 27329, + "Ġpx": 27330, + "Ġseeding": 27331, + "cripts": 27332, + "inez": 27333, + "omeres": 27334, + "Ġsiblings": 27335, + "anging": 27336, + "fert": 27337, + "Ġrecovering": 27338, + "pure": 27339, + "Ġsd": 27340, + "ĠVul": 27341, + "pedance": 27342, + "Ġfighting": 27343, + "Super": 27344, + "ĠIto": 27345, + "Ġperimeter": 27346, + "ĠInhibitors": 27347, + "electrode": 27348, + "enabled": 27349, + "fb": 27350, + "ĠPCs": 27351, + "Ġnausea": 27352, + "ĠConversion": 27353, + "Ġsla": 27354, + "Ġinvertebrates": 27355, + "ĠBrian": 27356, + "Ġcontiguous": 27357, + "ĠACKNOWLEDGM": 27358, + "urface": 27359, + "Ġcoars": 27360, + "ĠLeh": 27361, + "ĠCompression": 27362, + "cycles": 27363, + "Ġsinh": 27364, + "ĠOccup": 27365, + "strength": 27366, + "Ġconstr": 27367, + "Ġpesticide": 27368, + "Ġbisp": 27369, + "ĠTn": 27370, + "Ġparentheses": 27371, + "degrad": 27372, + "Ġhyperglycemia": 27373, + "PW": 27374, + "kj": 27375, + "ecological": 27376, + "Ġthy": 27377, + "Ġeleg": 27378, + "ĠSynaptic": 27379, + "scaled": 27380, + "tity": 27381, + "Ġequity": 27382, + "Ġblockchain": 27383, + "ĠLithium": 27384, + "Ġspark": 27385, + "Ġentitled": 27386, + "Ġconventions": 27387, + "Argument": 27388, + "Ġretail": 27389, + "Ġneoplastic": 27390, + "Ġdamped": 27391, + "ĠSurveillance": 27392, + "ĠAnna": 27393, + "Ġspacetimes": 27394, + "inges": 27395, + "ahashi": 27396, + "ĠInfections": 27397, + "Ġneglecting": 27398, + "Ġevaporated": 27399, + "vastatin": 27400, + "Ġgh": 27401, + "ĠNLP": 27402, + "Ġphones": 27403, + "Ġlifted": 27404, + "Ġdivisible": 27405, + "Ġdurability": 27406, + "osited": 27407, + "Ġexcitability": 27408, + "Ġbuoyancy": 27409, + "Ġuncontrolled": 27410, + "bran": 27411, + "ĠPhe": 27412, + "Ġimmunocomp": 27413, + "Ġeventual": 27414, + "Ġclassroom": 27415, + "Ġmicrographs": 27416, + "Ġrecharge": 27417, + "ettes": 27418, + "ĠDiver": 27419, + "ĠDall": 27420, + "Ġmetac": 27421, + "Ġneuroendocrine": 27422, + "topology": 27423, + "ĠHawking": 27424, + "omson": 27425, + "ĠHarry": 27426, + "mouth": 27427, + "Ġdeciding": 27428, + "Ġuncovered": 27429, + "Ġgolden": 27430, + "ĠCastle": 27431, + "Ġfiducial": 27432, + "Aware": 27433, + "ĠGan": 27434, + "erahertz": 27435, + "ĠSaturn": 27436, + "LN": 27437, + "Unit": 27438, + "ĥĹ": 27439, + "Ġbinder": 27440, + "INFO": 27441, + "ĠTemper": 27442, + "ipel": 27443, + "Ġnumerator": 27444, + "Ġwebsites": 27445, + "Ġthreatened": 27446, + "Ġremnants": 27447, + "ĠFinnish": 27448, + "hof": 27449, + "media": 27450, + "concentration": 27451, + "ĠReed": 27452, + "ĠLeishmania": 27453, + "Ġmultifunctional": 27454, + "racy": 27455, + "Ġdistribute": 27456, + "ĠDecay": 27457, + "Ġgrinding": 27458, + "Loss": 27459, + "MPL": 27460, + "ĠLakes": 27461, + "ĠQR": 27462, + "ĠStructured": 27463, + "ĠMalaria": 27464, + "Ġflavonoid": 27465, + "Ġtowns": 27466, + "opia": 27467, + "ĠVec": 27468, + "othy": 27469, + "Ġsingles": 27470, + "Ġpenetrate": 27471, + "ĠPig": 27472, + "ieved": 27473, + "Ġderivations": 27474, + "Ġdiscomfort": 27475, + "afenib": 27476, + "ĠLegendre": 27477, + "ĠPax": 27478, + "ĠMX": 27479, + "ĠExtrem": 27480, + "ĠForeign": 27481, + "ĠCourse": 27482, + "ĠHit": 27483, + "vage": 27484, + "Ġclique": 27485, + "Ġcompensatory": 27486, + "User": 27487, + "Ġdraws": 27488, + "ĠProtective": 27489, + "Ġallocate": 27490, + "ĠPant": 27491, + "Ġdash": 27492, + "Ġparal": 27493, + "ĠCirculating": 27494, + "ĠHistone": 27495, + "ĠÅ«": 27496, + "Ġprojec": 27497, + "ĠAAA": 27498, + "ĠPMS": 27499, + "glacial": 27500, + "ĠMeeting": 27501, + "ĠAntibiotic": 27502, + "ategorical": 27503, + "Ġattenuate": 27504, + "Power": 27505, + "owicz": 27506, + "ĠDefault": 27507, + "Ġmarsh": 27508, + "plasm": 27509, + "ĠPathology": 27510, + "ĠEf": 27511, + "Lys": 27512, + "flies": 27513, + "Ġinterviewed": 27514, + "ĠQA": 27515, + "Ġimpuls": 27516, + "Ġpapillary": 27517, + "dR": 27518, + "uh": 27519, + "ĠJing": 27520, + "Ġrescaled": 27521, + "efficiency": 27522, + "Ġef": 27523, + "ĠEisen": 27524, + "Ġattacked": 27525, + "Ġopto": 27526, + "Ġspeculated": 27527, + "haz": 27528, + "Ġideally": 27529, + "ymenoptera": 27530, + "Ġlr": 27531, + "ĠIz": 27532, + "resource": 27533, + "ĠFacility": 27534, + "ĠAcquisition": 27535, + "Ġpostural": 27536, + "autiful": 27537, + "Ġgingival": 27538, + "Ġpertaining": 27539, + "ĠExtra": 27540, + "ĠProgramme": 27541, + "hesus": 27542, + "fermion": 27543, + "Ġsteadily": 27544, + "Ġterminus": 27545, + "Parser": 27546, + "ĠInclusion": 27547, + "ĠWuhan": 27548, + "Ġrepetitions": 27549, + "done": 27550, + "ĠCep": 27551, + "Ġunstructured": 27552, + "ĠCollectively": 27553, + "Ġsettling": 27554, + "Ġjaw": 27555, + "ĠUni": 27556, + "Ġrestoring": 27557, + "urtles": 27558, + "Full": 27559, + "Ġdynamo": 27560, + "IGO": 27561, + "ĠBAT": 27562, + "ová": 27563, + "venues": 27564, + "ĠPerhaps": 27565, + "sensing": 27566, + "ĠIschem": 27567, + "odemographic": 27568, + "Ss": 27569, + "ĠLund": 27570, + "Ġelite": 27571, + "protocol": 27572, + "ĠChristopher": 27573, + "basic": 27574, + "Ġpuber": 27575, + "Ġmagnetism": 27576, + "vars": 27577, + "inducing": 27578, + "Ġdated": 27579, + "Ġenemy": 27580, + "ĠStop": 27581, + "social": 27582, + "ĠdÏĦ": 27583, + "ĠBun": 27584, + "Small": 27585, + "purpose": 27586, + "Ġhunting": 27587, + "CPU": 27588, + "ĠJunior": 27589, + "REL": 27590, + "Ġcontractile": 27591, + "Ġsilicone": 27592, + "adrenergic": 27593, + "bz": 27594, + "Ġfus": 27595, + "ifted": 27596, + "sep": 27597, + "âĪĴâĪŀ": 27598, + "Ġdrum": 27599, + "----------": 27600, + "ĠTregs": 27601, + "itarian": 27602, + "century": 27603, + "âĬ¥": 27604, + "Numer": 27605, + "ĠBenz": 27606, + "Ġcommunicating": 27607, + "Ġpaternal": 27608, + "ĠFGFR": 27609, + "ĠâĤ¬": 27610, + "Ġdeviate": 27611, + "fre": 27612, + "Ġmolten": 27613, + "Ġstandardization": 27614, + "Ġfunctionalities": 27615, + "ĠPaulo": 27616, + "Ġbucket": 27617, + "ĠConcentrations": 27618, + "ĠKum": 27619, + "Ġmimicking": 27620, + "Drop": 27621, + "zoa": 27622, + "ĠNuclei": 27623, + "brack": 27624, + "ecolor": 27625, + "Ġcarn": 27626, + "Ġveterinary": 27627, + "Ġchemotherapeutic": 27628, + "Ġferment": 27629, + "lasting": 27630, + "ĠRogers": 27631, + "ieri": 27632, + "Ġconverters": 27633, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 27634, + "ĠRepair": 27635, + "Europe": 27636, + "TIME": 27637, + "Ġties": 27638, + "ĠPIN": 27639, + "Ġtribut": 27640, + "Ġhomogenization": 27641, + "excitation": 27642, + "atization": 27643, + "ĠRash": 27644, + "Ġprecession": 27645, + "ás": 27646, + "Ġspiking": 27647, + "ĠGrassmann": 27648, + "minister": 27649, + "Ġfactorial": 27650, + "ĠDeut": 27651, + "sampled": 27652, + "Ġeukaryotes": 27653, + "overlapping": 27654, + "agglut": 27655, + "Ġprescribing": 27656, + "Ġcro": 27657, + "omechanical": 27658, + "iza": 27659, + "ĠManufact": 27660, + "native": 27661, + "ursive": 27662, + "ĠIssues": 27663, + "Ġstreptomycin": 27664, + "endi": 27665, + "ĠSpr": 27666, + "ceq": 27667, + "arginine": 27668, + "ixon": 27669, + "ĠFoundations": 27670, + "Single": 27671, + "Ġoxal": 27672, + "Ġhydrate": 27673, + "Iterator": 27674, + "kii": 27675, + "aminated": 27676, + "Ġsprings": 27677, + "oln": 27678, + "ĠSetup": 27679, + "Ġripening": 27680, + "Ġtheoretic": 27681, + "Ġcfg": 27682, + "μL": 27683, + "Gordon": 27684, + "SK": 27685, + "Ġnations": 27686, + "Query": 27687, + "Ùħ": 27688, + "Ġfores": 27689, + "requencies": 27690, + "ĠPharmaceutical": 27691, + "ĠAllocation": 27692, + "otypical": 27693, + "ĠPilot": 27694, + "thora": 27695, + "ĠVand": 27696, + "Ġsyringe": 27697, + "ĠRAP": 27698, + "rometric": 27699, + "Ġïģ´": 27700, + "Ġcitations": 27701, + "would": 27702, + "Ġnortheastern": 27703, + "comparison": 27704, + "locus": 27705, + "ethe": 27706, + "ĠKB": 27707, + "Ġhomologs": 27708, + "Ġencephalitis": 27709, + "Ġzig": 27710, + "Ġincentive": 27711, + "Ġconfidential": 27712, + "Ġvestibular": 27713, + "ĠOTUs": 27714, + "Ġsynovial": 27715, + "ĠRelativity": 27716, + "Ġsubdivided": 27717, + "chez": 27718, + "Ġlikewise": 27719, + "ĠPDMS": 27720, + "ĠÅł": 27721, + "Ġsocieties": 27722, + "ocyanate": 27723, + "gia": 27724, + "Ġlocalize": 27725, + "Ġlactation": 27726, + "Ġnodule": 27727, + "ĠCOR": 27728, + "Ġharboring": 27729, + "ĠEQU": 27730, + "harvest": 27731, + "Ġbandgap": 27732, + "rk": 27733, + "Ġresistor": 27734, + "Ġye": 27735, + "ĠAsymmetric": 27736, + "Ġpropagators": 27737, + "Ġdiagnosing": 27738, + "ĠAffairs": 27739, + "Ġejecta": 27740, + "Ġisomer": 27741, + "Ġix": 27742, + "Ġfoliation": 27743, + "Ġcapacitors": 27744, + "Ġcad": 27745, + "ĠNeutroph": 27746, + "pliance": 27747, + "Ġcompressible": 27748, + "ĠHunter": 27749, + "ĠMZ": 27750, + "ĠWeib": 27751, + "Ġnoncoding": 27752, + "Ġmountains": 27753, + "Ġadvertising": 27754, + "alez": 27755, + "bright": 27756, + "limsup": 27757, + "Ci": 27758, + "ĠNev": 27759, + "ĠStrains": 27760, + "ostomy": 27761, + "opal": 27762, + "Ġconcatenated": 27763, + "ĠPerf": 27764, + "CHO": 27765, + "Ġturtles": 27766, + "ĠFra": 27767, + "Ġallogeneic": 27768, + "Ġunsuccessful": 27769, + "YM": 27770, + "erver": 27771, + "Ġcuc": 27772, + "Ġfires": 27773, + "chart": 27774, + "Ġinterrupted": 27775, + "Ġdecides": 27776, + "Ġauction": 27777, + "ĠUntil": 27778, + "ĠATG": 27779, + "Ġdiam": 27780, + "magnitude": 27781, + "Ġdl": 27782, + "Vertex": 27783, + "mont": 27784, + "Ġfemtosecond": 27785, + "Params": 27786, + "Ġlysate": 27787, + "ishers": 27788, + "ĠPAT": 27789, + "ĠKev": 27790, + "ĠKnock": 27791, + "Ġgroove": 27792, + "Lu": 27793, + "ĠJohann": 27794, + "Ġreplica": 27795, + "ĠMATERIALS": 27796, + "Ġlots": 27797, + "Ġgenerically": 27798, + "ĠAltered": 27799, + "ĠIdentity": 27800, + "Ġunfolded": 27801, + "CES": 27802, + "ingular": 27803, + "ĠFraction": 27804, + "ĠProliferation": 27805, + "ĠVienna": 27806, + "acia": 27807, + "pless": 27808, + "ĠSevent": 27809, + "Ġturbines": 27810, + "lysine": 27811, + "Ġperoxis": 27812, + "ARP": 27813, + "ĠEpis": 27814, + "ĠSYBR": 27815, + "Builder": 27816, + "Ġspherically": 27817, + "Ġdefend": 27818, + "Performance": 27819, + "Ġmortar": 27820, + "ĠConcepts": 27821, + "works": 27822, + "Ġreinforce": 27823, + "á¹": 27824, + "Ġcus": 27825, + "ĠCIF": 27826, + "ĠAgricultural": 27827, + "crystalline": 27828, + "rish": 27829, + "Ġreferenced": 27830, + "Ġactress": 27831, + "Ġboundedness": 27832, + "SiC": 27833, + "Ġâ": 27834, + "Ġjack": 27835, + "Ġterminate": 27836, + "ĠJA": 27837, + "ĠKrish": 27838, + "MMP": 27839, + "kx": 27840, + "ĠPSR": 27841, + "endl": 27842, + "WHO": 27843, + "ĠSão": 27844, + "ĠCultural": 27845, + "ĠEh": 27846, + "ulis": 27847, + "vik": 27848, + "prises": 27849, + "ixel": 27850, + "ĠMetrics": 27851, + "Ġdiscontinuities": 27852, + "ĠUne": 27853, + "SCR": 27854, + "Ġprojecting": 27855, + "ĠOriginal": 27856, + "ĠHumans": 27857, + "transcriptional": 27858, + "HK": 27859, + "ĠJain": 27860, + "atisfaction": 27861, + "mesenchymal": 27862, + "Ġpyramid": 27863, + "Ġascorbic": 27864, + "game": 27865, + "Ġnoun": 27866, + "otoxins": 27867, + "peptide": 27868, + "Ġglassy": 27869, + "Ġtalking": 27870, + "Dem": 27871, + "ĠSchro": 27872, + "ĠAssumptions": 27873, + "Ġðx": 27874, + "Ġaneurysms": 27875, + "MASS": 27876, + "ĠHou": 27877, + "exposure": 27878, + "ĠLLC": 27879, + "Ġnoises": 27880, + "CTG": 27881, + "ĠElementary": 27882, + "flip": 27883, + "Ġdysp": 27884, + "Ġmessenger": 27885, + "ĠImportant": 27886, + "Ġimposes": 27887, + "Ġorganelles": 27888, + "assertEqual": 27889, + "Ġjustif": 27890, + "ucine": 27891, + "Ġformic": 27892, + "ormalization": 27893, + "ĠRadial": 27894, + "ĠCurve": 27895, + "ĠCrohn": 27896, + "Ġbrowser": 27897, + "Ġeffusion": 27898, + "Ġhandles": 27899, + "varsigma": 27900, + "Ġspecialists": 27901, + "Ġpainful": 27902, + "Ġerythematosus": 27903, + "Ġfen": 27904, + "nitrophenyl": 27905, + "Ġlegacy": 27906, + "ĠQDs": 27907, + "rapper": 27908, + "Ġmonotherapy": 27909, + "ĠBelt": 27910, + "ZZ": 27911, + "Ġsintered": 27912, + "enedi": 27913, + "Hb": 27914, + "tv": 27915, + "ĠNas": 27916, + "ovis": 27917, + "Ġmucin": 27918, + "Ġaccelerates": 27919, + "Ġacquiring": 27920, + "luc": 27921, + "Ġdilaton": 27922, + "ĠPitts": 27923, + "Ġequivariant": 27924, + "ĠLyman": 27925, + "ĠYa": 27926, + "Ġprogressed": 27927, + "ĠAfterwards": 27928, + "ĠCHAR": 27929, + "Don": 27930, + "Ġhistologic": 27931, + "Ġcircuitry": 27932, + "pene": 27933, + "opres": 27934, + "ĠStefan": 27935, + "Ġsemiclassical": 27936, + "mund": 27937, + "ĠWaste": 27938, + "BQ": 27939, + "Ġadiponectin": 27940, + "Ġunseen": 27941, + "Ġbiomechanical": 27942, + "Ġhazardous": 27943, + "ructive": 27944, + "xyl": 27945, + "opf": 27946, + "Ġprion": 27947, + "ĠInfinite": 27948, + "Ġtracers": 27949, + "ĠHarrison": 27950, + "Ġfibrinogen": 27951, + "Ġhydrolys": 27952, + "Ġislets": 27953, + "Ġparallelism": 27954, + "Spect": 27955, + "Ġimperative": 27956, + "Ġcured": 27957, + "ĠDSB": 27958, + "idefinite": 27959, + "icker": 27960, + "Ġdivergences": 27961, + "ĠShapiro": 27962, + "abd": 27963, + "ĠLum": 27964, + "ĠVD": 27965, + "Ġfisheries": 27966, + "geon": 27967, + "copenia": 27968, + "ĠClay": 27969, + "Ġmaximized": 27970, + "ĠGrey": 27971, + "ĠBatch": 27972, + "Ġinfest": 27973, + "Ġample": 27974, + "Ġestate": 27975, + "ĠSupreme": 27976, + "AO": 27977, + "isia": 27978, + "ĠSmad": 27979, + "Carlo": 27980, + "ĠSubst": 27981, + "Ġmonoidal": 27982, + "Ġnumeric": 27983, + "Plot": 27984, + "Ġdystrophy": 27985, + "hypertensive": 27986, + "Ġstool": 27987, + "alsy": 27988, + "Ġcheese": 27989, + "nih": 27990, + "Ġbought": 27991, + "ĠSQ": 27992, + "Ġclues": 27993, + "Ġmeiotic": 27994, + "Ġgoats": 27995, + "ĠGTPase": 27996, + "Ġrescaling": 27997, + "NUM": 27998, + "icing": 27999, + "ĠÄĢ": 28000, + "Ġpretty": 28001, + "ligand": 28002, + "English": 28003, + "ĠIntelligent": 28004, + "Every": 28005, + "ĠPolitical": 28006, + "enton": 28007, + "Ġpassages": 28008, + "ĠRemarks": 28009, + "sb": 28010, + "Network": 28011, + "ĠLRR": 28012, + "Ġcurl": 28013, + "ursion": 28014, + "ĠAver": 28015, + "ĠGLP": 28016, + "heren": 28017, + "atan": 28018, + "ICENSE": 28019, + "Ġlatex": 28020, + "EMI": 28021, + "quasi": 28022, + "ĠOm": 28023, + "Ġreviewing": 28024, + "Background": 28025, + "Ġsom": 28026, + "Ġsnapshots": 28027, + "brow": 28028, + "who": 28029, + "ĠTail": 28030, + "ĠMSM": 28031, + "ĠGm": 28032, + "Ġphi": 28033, + "rency": 28034, + "separated": 28035, + "Ġgig": 28036, + "osides": 28037, + "Ġpean": 28038, + "Ġappealing": 28039, + "PU": 28040, + "nk": 28041, + "Ġquer": 28042, + "ĠCharg": 28043, + "ĠMolecules": 28044, + "localization": 28045, + "Idx": 28046, + "lap": 28047, + "ĠTax": 28048, + "ĠExponential": 28049, + "ĠInhibitor": 28050, + "ĠBiomedical": 28051, + "urethane": 28052, + "lerene": 28053, + "rogenesis": 28054, + "ĠLai": 28055, + "ĠAggregation": 28056, + "ĠCaCl": 28057, + "Ġsensible": 28058, + "Ġconjunc": 28059, + "paper": 28060, + "ĠCovid": 28061, + "ĠProcedures": 28062, + "Ġknew": 28063, + "Ġsetae": 28064, + "ĠAlle": 28065, + "ĠExcept": 28066, + "Ġpresynaptic": 28067, + "flower": 28068, + "Ġultrasonography": 28069, + "Ġentertain": 28070, + "iors": 28071, + "ĠEry": 28072, + "ĠInteger": 28073, + "Ġrepressor": 28074, + "Ġlaterally": 28075, + "Ġcomplemented": 28076, + "TAG": 28077, + "ĠAround": 28078, + "ĠLister": 28079, + "bitrary": 28080, + "backward": 28081, + "MeV": 28082, + "Ġwhisk": 28083, + "AMs": 28084, + "ĠBulk": 28085, + "Ġquiver": 28086, + "Ġdamaging": 28087, + "ĠQuantifying": 28088, + "Ġsuprem": 28089, + "tel": 28090, + "Ġtear": 28091, + "oters": 28092, + "vidin": 28093, + "Ġtubules": 28094, + "Ġipsilateral": 28095, + "isive": 28096, + "Ġsuitably": 28097, + "riel": 28098, + "Ġtuber": 28099, + "Ġfavors": 28100, + "Ġcentim": 28101, + "Ġtransversal": 28102, + "ĠCHO": 28103, + "Ġtrimester": 28104, + "CAC": 28105, + "cognitive": 28106, + "ĠUTC": 28107, + "pute": 28108, + "Ġmidline": 28109, + "amers": 28110, + "evaluation": 28111, + "Dav": 28112, + "Ġbags": 28113, + "timer": 28114, + "Ġshortcomings": 28115, + "ĠErd": 28116, + "Ġdiscriminator": 28117, + "Ant": 28118, + "sizes": 28119, + "Ġbist": 28120, + "ingual": 28121, + "ĠCategory": 28122, + "Ġpulsars": 28123, + "ĠSchwartz": 28124, + "ĠDrop": 28125, + "Sequence": 28126, + "Ġtann": 28127, + "ĠSymptoms": 28128, + "Dict": 28129, + "ĠBlu": 28130, + "Supplemental": 28131, + "Ġdisabled": 28132, + "ĠKoz": 28133, + "Ġinvoked": 28134, + "ĠCQ": 28135, + "ĠConnectivity": 28136, + "Ġtelescopes": 28137, + "oso": 28138, + "Ġphytochemical": 28139, + "Ġorthogonality": 28140, + "Ġinvisible": 28141, + "ĠSCF": 28142, + "ĠAvoid": 28143, + "ĠHus": 28144, + "micron": 28145, + "aternity": 28146, + "Project": 28147, + "Ġadvancing": 28148, + "ĠLorentzian": 28149, + "Sa": 28150, + "tÃŀ": 28151, + "ĠUP": 28152, + "Ġarts": 28153, + "Ġzer": 28154, + "asket": 28155, + "Ġappeal": 28156, + "nick": 28157, + "ĠCloning": 28158, + "Ġswap": 28159, + "Ġphospholipids": 28160, + "bg": 28161, + "othel": 28162, + "asco": 28163, + "Track": 28164, + "Ġsubmanifold": 28165, + "Offset": 28166, + "ĠBird": 28167, + "problems": 28168, + "DCs": 28169, + "Ġdow": 28170, + "Ġdeionized": 28171, + "Ġsubclass": 28172, + "Ġpublishing": 28173, + "ĠCarter": 28174, + "Ġsynergy": 28175, + "Ġweakened": 28176, + "ĠGlas": 28177, + "ĠPie": 28178, + "henko": 28179, + "Ġsetups": 28180, + "ĠBernstein": 28181, + "Ġÿ": 28182, + "ĠShu": 28183, + "ĠChanging": 28184, + "osov": 28185, + "ĠMeteor": 28186, + "inth": 28187, + "rah": 28188, + "paramet": 28189, + "rena": 28190, + "Ġnewborns": 28191, + "ische": 28192, + "rotating": 28193, + "Ġconfident": 28194, + "fac": 28195, + "ĠTerr": 28196, + "Ġlinewidth": 28197, + "ICP": 28198, + "thony": 28199, + "Ġlanes": 28200, + "Ġsmoother": 28201, + "mony": 28202, + "ĠCNNs": 28203, + "Port": 28204, + "Ġtransiently": 28205, + "Ġsurgeries": 28206, + "Ġsubmerged": 28207, + "Ġpuncture": 28208, + "Ġdichlor": 28209, + "Ġsystematics": 28210, + "Ġcontigs": 28211, + "Ġresiding": 28212, + "BW": 28213, + "EO": 28214, + "Gold": 28215, + "ionate": 28216, + "vocab": 28217, + "dW": 28218, + "STAR": 28219, + "ĠPLC": 28220, + "athi": 28221, + "ĠInfectious": 28222, + "Light": 28223, + "á»": 28224, + "ĠRal": 28225, + "Ġpropagates": 28226, + "ĠLikelihood": 28227, + "hill": 28228, + "curl": 28229, + "checkpoint": 28230, + "rax": 28231, + "Ġvancomycin": 28232, + "ĠUSD": 28233, + "opheles": 28234, + "Ġfiltr": 28235, + "Ġstoichiometry": 28236, + "âĶĢâĶĢ": 28237, + "ĠNad": 28238, + "accessible": 28239, + "Ġtoy": 28240, + "Ġnude": 28241, + "ĠSut": 28242, + "essential": 28243, + "ĠOL": 28244, + "Ġpertin": 28245, + "Ġrecur": 28246, + "Ġcapill": 28247, + "Ġcomputable": 28248, + "Ġsuction": 28249, + "Ġsoftening": 28250, + "ĠESI": 28251, + "Ġmonitors": 28252, + "Ġpyridine": 28253, + "ĠSensors": 28254, + "ĠCombinatorial": 28255, + "atta": 28256, + "ĠAMS": 28257, + "ĠDul": 28258, + "pleteness": 28259, + "Eth": 28260, + "Ġû": 28261, + "Ġexcised": 28262, + "ĠDiabetic": 28263, + "ĠIowa": 28264, + "Ġimmunostaining": 28265, + "Ġillnesses": 28266, + "Ġenumer": 28267, + "ĠIranian": 28268, + "Ġthumb": 28269, + "orphisms": 28270, + "Ġlegitimate": 28271, + "lg": 28272, + "ĠSVD": 28273, + "Ġdesk": 28274, + "Format": 28275, + "Bon": 28276, + "Ġgarden": 28277, + "Ġinterpersonal": 28278, + "Ġelbow": 28279, + "ĠDemonstr": 28280, + "Ġnonspecific": 28281, + "Ferm": 28282, + "ivalently": 28283, + "phthalene": 28284, + "ARGET": 28285, + "Valid": 28286, + "Ġsunlight": 28287, + "Ġrescued": 28288, + "DAR": 28289, + "ĠInvariant": 28290, + "Ġidle": 28291, + "Ġalkaloids": 28292, + "scales": 28293, + "ses": 28294, + "obicity": 28295, + "beat": 28296, + "Ġcentrifugal": 28297, + "analytical": 28298, + "pv": 28299, + "Ġtutorial": 28300, + "ĠNation": 28301, + "generator": 28302, + "Ġcollisional": 28303, + "ĠCME": 28304, + "Ġscrap": 28305, + "ĠQSO": 28306, + "Ġwax": 28307, + "ĠScenario": 28308, + "Ġminimizer": 28309, + "ĠMDPI": 28310, + "Ġprostaglandin": 28311, + "olites": 28312, + "ocysteine": 28313, + "Ġcompactification": 28314, + "Ġfrailty": 28315, + "opsin": 28316, + "Ġjunior": 28317, + "loud": 28318, + "Ġtitled": 28319, + "Ġeconomically": 28320, + "thiophene": 28321, + "ĠInvestigating": 28322, + "ĠEsp": 28323, + "Ġelusive": 28324, + "Ġmalware": 28325, + "ĠTHP": 28326, + "imidazole": 28327, + "Ġretains": 28328, + "ĠMIR": 28329, + "ffl": 28330, + "jac": 28331, + "ĠPART": 28332, + "ĠDCM": 28333, + "transport": 28334, + "MAPK": 28335, + "Problem": 28336, + "Su": 28337, + "Ġdelim": 28338, + "Ġpsychometric": 28339, + "vitably": 28340, + "Ġhypergeometric": 28341, + "Ġuterus": 28342, + "Ġanaesthesia": 28343, + "ĠAvenue": 28344, + "Ġmeanings": 28345, + "Ġrapidity": 28346, + "Ġdendrites": 28347, + "grain": 28348, + "ĠNile": 28349, + "Ġfacies": 28350, + "Ġpipelines": 28351, + "ĠCampylobacter": 28352, + "ĠMembers": 28353, + "benzoate": 28354, + "Request": 28355, + "Ġpk": 28356, + "Ġrefused": 28357, + "caus": 28358, + "ĠSay": 28359, + "lane": 28360, + "ĠPSO": 28361, + "Ġgathering": 28362, + "Ġrefriger": 28363, + "RCC": 28364, + "Ġfibronectin": 28365, + "help": 28366, + "ĠIntensity": 28367, + "CLC": 28368, + "Que": 28369, + "elly": 28370, + "Ġilluminated": 28371, + "Ġpedestrian": 28372, + "ĠMercury": 28373, + "Ġafforded": 28374, + "Ġpathophysiological": 28375, + "ĠNGS": 28376, + "assa": 28377, + "Ġendors": 28378, + "Ġsensation": 28379, + "Ġstreamflow": 28380, + "avin": 28381, + "ĠGABAergic": 28382, + "Ġretirement": 28383, + "Cells": 28384, + "oca": 28385, + "Ġoptimizations": 28386, + "Ġdigraph": 28387, + "ĠAutism": 28388, + "octurnal": 28389, + "oscience": 28390, + "ĠEllis": 28391, + "ĠAj": 28392, + "ĠWSN": 28393, + "Ġshooting": 28394, + "iper": 28395, + "îĦĥ": 28396, + "ĠWeather": 28397, + "Ġreceptive": 28398, + "Ġquartic": 28399, + "ocyclic": 28400, + "PATH": 28401, + "sizeof": 28402, + "Ġmelts": 28403, + "Ġdipoles": 28404, + "Ġbimodal": 28405, + "summary": 28406, + "Ġinsomnia": 28407, + "opyran": 28408, + "Ġwrapped": 28409, + "ĠJosé": 28410, + "AH": 28411, + "cia": 28412, + "Ġobeys": 28413, + "ĠKay": 28414, + "intervention": 28415, + "Ġrouter": 28416, + "ĠDrugs": 28417, + "owska": 28418, + "ĠArr": 28419, + "ĠCaptain": 28420, + "ĠTMS": 28421, + "adv": 28422, + "Ġboat": 28423, + "Ġtrusted": 28424, + "sever": 28425, + "illars": 28426, + "ĠMissouri": 28427, + "Ġequivalents": 28428, + "ĠHarvard": 28429, + "ĠClarke": 28430, + "resonant": 28431, + "rady": 28432, + "triggered": 28433, + "Ġcleft": 28434, + "Ġunic": 28435, + "Ġbrainstem": 28436, + "Ġthrombin": 28437, + "ĠFlight": 28438, + "Ġsectional": 28439, + "Ġconcatenation": 28440, + "Ġcantilever": 28441, + "eton": 28442, + "Ġdecode": 28443, + "ofacial": 28444, + "Action": 28445, + "ĠIllustration": 28446, + "vertical": 28447, + "chall": 28448, + "ĠRegistry": 28449, + "MAT": 28450, + "Ġconson": 28451, + "Ġneoadjuvant": 28452, + "ĠWistar": 28453, + "ĠImper": 28454, + "Ġaltitudes": 28455, + "Ġsubpopulation": 28456, + "ĠScene": 28457, + "tensorflow": 28458, + "slow": 28459, + "Ġhint": 28460, + "Ġbeamforming": 28461, + "ein": 28462, + "Ġimpregn": 28463, + "ĠRFID": 28464, + "ĠAnalyzing": 28465, + "ĠPent": 28466, + "ĠDNS": 28467, + "ĠGilbert": 28468, + "Ġcrater": 28469, + "Comparing": 28470, + "Ġbf": 28471, + "Ġflights": 28472, + "Ġmalnutrition": 28473, + "SMC": 28474, + "Ġerythrop": 28475, + "ĠTumors": 28476, + "Tx": 28477, + "Ġisospin": 28478, + "ĠKub": 28479, + "iking": 28480, + "Ġcorticosteroids": 28481, + "ursor": 28482, + "ĠBurg": 28483, + "inspired": 28484, + "ĠIgn": 28485, + "Ġmycel": 28486, + "prediction": 28487, + "methods": 28488, + "Copy": 28489, + "ĠRW": 28490, + "ĠKnight": 28491, + "Ġdemethyl": 28492, + "ìĦ": 28493, + "Ġcili": 28494, + "Ġbes": 28495, + "ĠEck": 28496, + "Ġdilatation": 28497, + "Ġanimation": 28498, + "abstract": 28499, + "Ġcircumvent": 28500, + "Ġinoculum": 28501, + "Seg": 28502, + "ĠCaps": 28503, + "erers": 28504, + "PLS": 28505, + "ĠPeer": 28506, + "Ġverifies": 28507, + "ategy": 28508, + "ogenetics": 28509, + "Ġoligonucleotides": 28510, + "ractical": 28511, + "Ġdiverges": 28512, + "ĠStanford": 28513, + "ĠAi": 28514, + "Ġweighing": 28515, + "Tg": 28516, + "reinfor": 28517, + "ĠAlam": 28518, + "quiry": 28519, + "ĠNob": 28520, + "Ġlinearization": 28521, + "ĠVenez": 28522, + "nexin": 28523, + "levels": 28524, + "Lip": 28525, + "ĠPatel": 28526, + "ĠMagnitude": 28527, + "etitive": 28528, + "ĠEagle": 28529, + "Ġsputum": 28530, + "ĠCOS": 28531, + "Ġincubator": 28532, + "Ul": 28533, + "ĠReceptors": 28534, + "ĠSchott": 28535, + "GCG": 28536, + "ĠZeiss": 28537, + "ĠEntanglement": 28538, + "ĠVaccine": 28539, + "orted": 28540, + "Ġnb": 28541, + "ĠSj": 28542, + "ĠMrs": 28543, + "Ġcalf": 28544, + "Ġintegrability": 28545, + "ĠPhoton": 28546, + "Ġgondii": 28547, + "ĠMIL": 28548, + "Ġaliph": 28549, + "ĠDip": 28550, + "falls": 28551, + "ctrl": 28552, + "ku": 28553, + "etent": 28554, + "plt": 28555, + "Ġpersisted": 28556, + "ĠManager": 28557, + "Ġprerequisite": 28558, + "filling": 28559, + "ĠMEA": 28560, + "Sym": 28561, + "ĠGrain": 28562, + "Ġductal": 28563, + "ĠTODO": 28564, + "Ġaffinities": 28565, + "Ġdegenerative": 28566, + "ĠFitz": 28567, + "ovar": 28568, + "ĠTriple": 28569, + "Ġdendrim": 28570, + "ĠFranklin": 28571, + "mag": 28572, + "otely": 28573, + "Ġstabilizes": 28574, + "Ġcash": 28575, + "ĠSquad": 28576, + "Ġchampion": 28577, + "PDB": 28578, + "Ġurg": 28579, + "Ġalcoholic": 28580, + "Ġtar": 28581, + "yled": 28582, + "Version": 28583, + "Ġsale": 28584, + "ĠMLP": 28585, + "outer": 28586, + "Ġsimplifying": 28587, + "ĠExtract": 28588, + "Param": 28589, + "ĠRestric": 28590, + "Ġtractable": 28591, + "ĠArchive": 28592, + "Response": 28593, + "ADDR": 28594, + "Ġcommutation": 28595, + "Rich": 28596, + "ĠAndrews": 28597, + "Ġosteoclast": 28598, + "romic": 28599, + "ĠShift": 28600, + "Ġaccelerometer": 28601, + "ĠSent": 28602, + "Ġchances": 28603, + "osting": 28604, + "Ġmethacrylate": 28605, + "Ġgluons": 28606, + "Ġôı½": 28607, + "Ġpolygons": 28608, + "ĠRCTs": 28609, + "Ġinfancy": 28610, + "Ġproceeded": 28611, + "ĠHorizontal": 28612, + "COR": 28613, + "Ġcaching": 28614, + "ĠNHS": 28615, + "phobic": 28616, + "ĠXMM": 28617, + "Ġmicrobiological": 28618, + "GMP": 28619, + "ÙĨ": 28620, + "ĠTSS": 28621, + "ĠSul": 28622, + "ĠFact": 28623, + "ĠWE": 28624, + "Ġcertainty": 28625, + "ensitivity": 28626, + "Ġdeconvolution": 28627, + "ĠGain": 28628, + "Ġblots": 28629, + "Ġseeks": 28630, + "Ġcosh": 28631, + "ennessee": 28632, + "Ġslave": 28633, + "ĠTran": 28634, + "Ġtranspose": 28635, + "reated": 28636, + "Ġshading": 28637, + "ĠBU": 28638, + "ĠOV": 28639, + "ĠLook": 28640, + "Ġcomprehensively": 28641, + "ĠFreder": 28642, + "Handler": 28643, + "fibr": 28644, + "Ġmissense": 28645, + "targets": 28646, + "promoting": 28647, + "ĠPep": 28648, + "varpi": 28649, + "ĠHarmonic": 28650, + "ĠAIS": 28651, + "Ġmonocyt": 28652, + "Ġthinning": 28653, + "Ġpheromone": 28654, + "Water": 28655, + "anase": 28656, + "ĠSang": 28657, + "Ġsubstructure": 28658, + "wp": 28659, + "ĠKansas": 28660, + "DEBUG": 28661, + "ĠProbe": 28662, + "Ġpatterned": 28663, + "clean": 28664, + "Ġbroiler": 28665, + "odextrin": 28666, + "aided": 28667, + "oprol": 28668, + "ublin": 28669, + "inum": 28670, + "Ġanatomic": 28671, + "Ġplating": 28672, + "arro": 28673, + "ucal": 28674, + "Ġspeedup": 28675, + "Ġhaemorrh": 28676, + "eptidase": 28677, + "Ġsagittal": 28678, + "Ġintim": 28679, + "ĠFISH": 28680, + "Ġscarc": 28681, + "ATCC": 28682, + "incor": 28683, + "Ġserological": 28684, + "ente": 28685, + "Ġshale": 28686, + "Ġoverfitting": 28687, + "ĠExcess": 28688, + "ĠALP": 28689, + "Pool": 28690, + "dry": 28691, + "yu": 28692, + "ĠPMMA": 28693, + "ĠHypoxia": 28694, + "nothing": 28695, + "chestra": 28696, + "coloneqq": 28697, + "Ġbibli": 28698, + "ĠEXPECT": 28699, + "BAL": 28700, + "ethan": 28701, + "ĠâĪĺ": 28702, + "Ġjourney": 28703, + "Ġbiocompatibility": 28704, + "PAN": 28705, + "Ġbon": 28706, + "ĠRoh": 28707, + "Ġpolarisation": 28708, + "Spin": 28709, + "idences": 28710, + "ĠBCR": 28711, + "ĠHIP": 28712, + "ĠThick": 28713, + "Ġrecognizes": 28714, + "Ġsar": 28715, + "Ġamend": 28716, + "questions": 28717, + "Ġcaregiver": 28718, + "ĠMarie": 28719, + "Ġmetalloproteinase": 28720, + "Ġaldehydes": 28721, + "Ġinterneurons": 28722, + "Ġtetrahedral": 28723, + "guez": 28724, + "Ġquasiparticle": 28725, + "Ġot": 28726, + "decreasing": 28727, + "stre": 28728, + "Ġphotoperiod": 28729, + "Ġprioriti": 28730, + "Ġapo": 28731, + "Ġimmunosuppression": 28732, + "ĠPierre": 28733, + "LPS": 28734, + "Ġclumps": 28735, + "ĠPlane": 28736, + "Ġturbidity": 28737, + "Ġpollutant": 28738, + "Ġbioch": 28739, + "ĠTRE": 28740, + "Ġdesigners": 28741, + "Ġrenders": 28742, + "Ġreplaces": 28743, + "ĠPLS": 28744, + "Ġhumoral": 28745, + "Bas": 28746, + "reira": 28747, + "ĠAedes": 28748, + "vitamin": 28749, + "curves": 28750, + "ociceptive": 28751, + "Ġindisp": 28752, + "Ġoxy": 28753, + "Ġedible": 28754, + "ĠMesenchymal": 28755, + "ĠDegree": 28756, + "ž": 28757, + "ĠOak": 28758, + "ĠBhatt": 28759, + "onso": 28760, + "ĠSBP": 28761, + "ĠAux": 28762, + "Ġmartingale": 28763, + "ĠMicrobiota": 28764, + "glow": 28765, + "Ġexud": 28766, + "apolis": 28767, + "Ġsomehow": 28768, + "Ġcentred": 28769, + "Channel": 28770, + "ĠNormalized": 28771, + "ilitation": 28772, + "Ġtranscriptase": 28773, + "Ġcryo": 28774, + "predicted": 28775, + "ĠDAG": 28776, + "Ġrf": 28777, + "endor": 28778, + "INTER": 28779, + "ĠMesh": 28780, + "ĠFundament": 28781, + "ycle": 28782, + "Ġprimitives": 28783, + "radiated": 28784, + "Ġrho": 28785, + "enesulf": 28786, + "ĠFSH": 28787, + "ĠEcos": 28788, + "localized": 28789, + "Ġenterprise": 28790, + "cephalus": 28791, + "Ġcarcass": 28792, + "AY": 28793, + "ecurity": 28794, + "ĠTMD": 28795, + "Ġlb": 28796, + "ĠAeros": 28797, + "ĠMER": 28798, + "Attr": 28799, + "ĠACL": 28800, + "ĠBarb": 28801, + "cout": 28802, + "Ġdeoxy": 28803, + "atios": 28804, + "Ġpersists": 28805, + "Ġviolent": 28806, + "Abelian": 28807, + "Ġellips": 28808, + "iong": 28809, + "Ġsuccessor": 28810, + "ĠGonzález": 28811, + "living": 28812, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 28813, + "imentin": 28814, + "Ġcapsules": 28815, + "VIS": 28816, + "ĠPOP": 28817, + "arithmic": 28818, + "OO": 28819, + "wl": 28820, + "inoic": 28821, + "ĠCenters": 28822, + "roblasts": 28823, + "those": 28824, + "ĠMJ": 28825, + "Ġfronts": 28826, + "Ġunint": 28827, + "Ġfacile": 28828, + "coherent": 28829, + "avour": 28830, + "ceptive": 28831, + "tah": 28832, + "Ġrelatedness": 28833, + "dE": 28834, + "ungen": 28835, + "#####": 28836, + "Ġamphi": 28837, + "ĠGuy": 28838, + "stars": 28839, + "ectom": 28840, + "Ġlaying": 28841, + "Ġspider": 28842, + "ACs": 28843, + "Ġseedling": 28844, + "Ġduplicated": 28845, + "iche": 28846, + "ĠMST": 28847, + "grass": 28848, + "Ġprophylactic": 28849, + "eks": 28850, + "Ġlaryngeal": 28851, + "ĠSper": 28852, + "ĠWals": 28853, + "Ġcholec": 28854, + "ĠPlanet": 28855, + "ĠHEPES": 28856, + "Ġdiploid": 28857, + "constraint": 28858, + "Pyx": 28859, + "ACh": 28860, + "ĠCui": 28861, + "ĠShared": 28862, + "ĠCand": 28863, + "ĠGö": 28864, + "Ġdetached": 28865, + "Ġpassengers": 28866, + "Ġaliphatic": 28867, + "Ġpour": 28868, + "Ġaccesses": 28869, + "ĠWald": 28870, + "Ġdecorated": 28871, + "Ġcarotenoids": 28872, + "uestions": 28873, + "ĠImpacts": 28874, + "SAT": 28875, + "aru": 28876, + "ĠPir": 28877, + "ĠConfiguration": 28878, + "ĠCongo": 28879, + "ĠLing": 28880, + "Ġdesic": 28881, + "Ġmacrom": 28882, + "Ġlacked": 28883, + "Ġencompasses": 28884, + "Ġpumped": 28885, + "ĠForty": 28886, + "rexate": 28887, + "ifferentiated": 28888, + "Ġnoble": 28889, + "Ġradion": 28890, + "Ġimmigrants": 28891, + "Ġbiodegradable": 28892, + "Ġmigrating": 28893, + "argv": 28894, + "COM": 28895, + "ĠObservational": 28896, + "Ġcannabis": 28897, + "yama": 28898, + "Ġconcentric": 28899, + "Conn": 28900, + "talion": 28901, + "Ġresponders": 28902, + "utenant": 28903, + "ĠTrim": 28904, + "Ġcontributors": 28905, + "Ġcontracted": 28906, + "ĠXenopus": 28907, + "Ġloud": 28908, + "ĠEnhancing": 28909, + "Ġinfarct": 28910, + "Ġok": 28911, + "Ġasks": 28912, + "relin": 28913, + "Ġillustrative": 28914, + "vdash": 28915, + "dg": 28916, + "Ġfoc": 28917, + "Ġlivers": 28918, + "ĠOtt": 28919, + "ĠTSP": 28920, + "logger": 28921, + "depending": 28922, + "Ġdisproportion": 28923, + "Ġintric": 28924, + "Ġimmunized": 28925, + "varez": 28926, + "Ġsalic": 28927, + "ĠInstitutes": 28928, + "KEY": 28929, + "Ġendoscopy": 28930, + "erk": 28931, + "eliness": 28932, + "ĠSag": 28933, + "athyroid": 28934, + "Ġacidity": 28935, + "arov": 28936, + "ĠVoronoi": 28937, + "Experimental": 28938, + "Ġgently": 28939, + "Measure": 28940, + "ïĺº": 28941, + "Ġwonder": 28942, + "ĠPancreatic": 28943, + "ĠHispanic": 28944, + "ĠEug": 28945, + "reducing": 28946, + "tainment": 28947, + "Ġsurprise": 28948, + "Ġæ": 28949, + "criter": 28950, + "ĠHypertension": 28951, + "tique": 28952, + "ĠCris": 28953, + "compatible": 28954, + "enson": 28955, + "Ġdistributional": 28956, + "ĠNAT": 28957, + "widths": 28958, + "Ġisotherms": 28959, + "ĠPrad": 28960, + "Ġbiodies": 28961, + "Ġorbifold": 28962, + "ĠEOS": 28963, + "Ġatax": 28964, + "ĠBod": 28965, + "ĠNMD": 28966, + "Ġmonoxide": 28967, + "ĠUkraine": 28968, + "foli": 28969, + "ĠDro": 28970, + "Ġunavailable": 28971, + "Ġbrighter": 28972, + "âĬĹ": 28973, + "omethane": 28974, + "Ġdream": 28975, + "Ġspo": 28976, + "ĠMaur": 28977, + "Ġoccasional": 28978, + "Ġinconsistency": 28979, + "ĠTac": 28980, + "opts": 28981, + "ĠGAB": 28982, + "ĠTao": 28983, + "ĠMatthew": 28984, + "ý": 28985, + "Ġpiano": 28986, + "ĠRCC": 28987, + "ĠOK": 28988, + "ĠKul": 28989, + "methan": 28990, + "ĠPROC": 28991, + "Ġconversations": 28992, + "ĠCSI": 28993, + "angent": 28994, + "ĠXue": 28995, + "Ġgraphic": 28996, + "dening": 28997, + "healthy": 28998, + "Ġfp": 28999, + "azone": 29000, + "Ġdiscipline": 29001, + "Ġprogresses": 29002, + "Ġbamboo": 29003, + "Ġcharm": 29004, + "ĠActivated": 29005, + "ĠSharp": 29006, + "ynes": 29007, + "Ġtoolbox": 29008, + "Ġheterostructures": 29009, + "piperazin": 29010, + "Ġarose": 29011, + "ĠInterval": 29012, + "Ġstripe": 29013, + "ĠChak": 29014, + "Ġcuff": 29015, + "RESS": 29016, + "Ġnonuniform": 29017, + "Ġbeetle": 29018, + "Prec": 29019, + "zc": 29020, + "Thread": 29021, + "bet": 29022, + "Ġee": 29023, + "ĠOptional": 29024, + "Ġtroph": 29025, + "ĠPuer": 29026, + "ĠFron": 29027, + "Ġmultiplet": 29028, + "Ġcalorimetry": 29029, + "Ġmonocytogenes": 29030, + "ĠHimal": 29031, + "Ġdrill": 29032, + "AGA": 29033, + "Ġferritin": 29034, + "Ġdpi": 29035, + "ĠCarm": 29036, + "Ġgone": 29037, + "Ġunidirectional": 29038, + "Ġreminis": 29039, + "Ġadjustable": 29040, + "ĠAustin": 29041, + "SARS": 29042, + "dal": 29043, + "Ġcef": 29044, + "equivariant": 29045, + "baseline": 29046, + "Ġspinors": 29047, + "ĠPrint": 29048, + "Ġmile": 29049, + "ĠLinc": 29050, + "mutation": 29051, + "Ġmucus": 29052, + "ĠHSC": 29053, + "Ġthermod": 29054, + "Ġpaint": 29055, + "Ġdistinctly": 29056, + "athy": 29057, + "Ġpharmacy": 29058, + "ĠBulg": 29059, + "ĠGang": 29060, + "hicle": 29061, + "ogan": 29062, + "ĠJian": 29063, + "ĠIndiana": 29064, + "Ġinstanton": 29065, + "Ġpalladium": 29066, + "fiber": 29067, + "npy": 29068, + "ĠUA": 29069, + "ĠQT": 29070, + "ceptible": 29071, + "etine": 29072, + "ĠHoles": 29073, + "Ġdependences": 29074, + "Ġthresholding": 29075, + "ĠMaintenance": 29076, + "Ġparticipates": 29077, + "ĠGenomes": 29078, + "factorial": 29079, + "ĠLiber": 29080, + "ĠThermodynamic": 29081, + "Ġelective": 29082, + "ucher": 29083, + "Ġhyperther": 29084, + "Ġstomatal": 29085, + "ĠBirth": 29086, + "cholesterol": 29087, + "Ġnotch": 29088, + "Ġsymbiotic": 29089, + "Ġbusinesses": 29090, + "Ġappreciable": 29091, + "Ġspecialization": 29092, + "ár": 29093, + "actyl": 29094, + "ĠGraphPad": 29095, + "osper": 29096, + "Ġorchestr": 29097, + "Ġdihydro": 29098, + "Ġconcluding": 29099, + "CLK": 29100, + "Ġeqs": 29101, + "ĠProgression": 29102, + "Ġclubs": 29103, + "aku": 29104, + "events": 29105, + "Ġsplenic": 29106, + "Ġbunch": 29107, + "ĠTm": 29108, + "ĠMobility": 29109, + "Ġtwofold": 29110, + "Ġradially": 29111, + "LSTM": 29112, + "MH": 29113, + "ĠCoal": 29114, + "Ġfrontier": 29115, + "Jan": 29116, + "Jun": 29117, + "ĠSimpson": 29118, + "Ġabstracts": 29119, + "Pal": 29120, + "Ġunim": 29121, + "Ġrobo": 29122, + "ĠIIB": 29123, + "depleted": 29124, + "Ġmorphologically": 29125, + "Ġenforcement": 29126, + "Ġdwell": 29127, + "Ġstagn": 29128, + "Ġlimestone": 29129, + "Ġmicrov": 29130, + "Ġïĥ¸": 29131, + "Luc": 29132, + "pacs": 29133, + "cyano": 29134, + "Ġintraocular": 29135, + "ĠCalculate": 29136, + "Support": 29137, + "SYS": 29138, + "ĠVS": 29139, + "CMs": 29140, + "Constant": 29141, + "ĠDj": 29142, + "Ġunbalanced": 29143, + "Ġrepeatability": 29144, + "gins": 29145, + "irect": 29146, + "ĠMOR": 29147, + "ĠBailey": 29148, + "Ġadvancement": 29149, + "Ġpursuit": 29150, + "Ġarom": 29151, + "proced": 29152, + "ĠInitiative": 29153, + "Ġincentives": 29154, + "Ġsurpass": 29155, + "genes": 29156, + "ĠIND": 29157, + "LH": 29158, + "Ġsuicidal": 29159, + "Ġbiodiesel": 29160, + "xz": 29161, + "ÙĬ": 29162, + "lea": 29163, + "ĠAnthony": 29164, + "Learning": 29165, + "Ġundo": 29166, + "Ġïĥº": 29167, + "ĠCommunities": 29168, + "hua": 29169, + "itime": 29170, + "ĠDean": 29171, + "Ġplasmin": 29172, + "ÃŃnez": 29173, + "ohydrate": 29174, + "Ġneurodevelop": 29175, + "Ġstoichiometric": 29176, + "ĠOncology": 29177, + "Ġshower": 29178, + "ĠDMS": 29179, + "WOR": 29180, + "ĠPIP": 29181, + "Ġsteric": 29182, + "mittees": 29183, + "istol": 29184, + "oxins": 29185, + "noon": 29186, + "FFT": 29187, + "Ġá»": 29188, + "opoiesis": 29189, + "Ġresembling": 29190, + "ĠBord": 29191, + "Ġprobiotics": 29192, + "ocysts": 29193, + "grey": 29194, + "ĠCatalog": 29195, + "IZATION": 29196, + "illes": 29197, + "ĠAlan": 29198, + "ĠÅ·": 29199, + "ĠLeib": 29200, + "ĠReasoning": 29201, + "biological": 29202, + "uterine": 29203, + "vacizumab": 29204, + "lecommun": 29205, + "ĠWarm": 29206, + "epage": 29207, + "variants": 29208, + "BSA": 29209, + "Ġïĥ¶": 29210, + "Ġhepatocyte": 29211, + "ketch": 29212, + "Ġstripping": 29213, + "ĠAdverse": 29214, + "ĠFeas": 29215, + "Ġïĥ¯": 29216, + "Pac": 29217, + "Ġindentation": 29218, + "Ġsecular": 29219, + "Ġidentifiable": 29220, + "running": 29221, + "Ġrd": 29222, + "Ġzyg": 29223, + "ĠDictionary": 29224, + "Ġresveratrol": 29225, + "inesterase": 29226, + "Ġtetracycline": 29227, + "ubles": 29228, + "Ġthroat": 29229, + "ĠLamb": 29230, + "aryon": 29231, + "ĠSQL": 29232, + "ĠÃľ": 29233, + "Ġglycemic": 29234, + "Ġcompetent": 29235, + "ĠAgreement": 29236, + "oiced": 29237, + "Ġconstitutively": 29238, + "Ġelectrocardi": 29239, + "oplasma": 29240, + "ĠîĦĥ": 29241, + "anide": 29242, + "Ġreorganization": 29243, + "Ġuninfected": 29244, + "UTE": 29245, + "Ġroyal": 29246, + "ĠSit": 29247, + "Ġmarital": 29248, + "ĠKobayashi": 29249, + "Barr": 29250, + "ĠTennessee": 29251, + "ĠChromat": 29252, + "ĠDerm": 29253, + "projection": 29254, + "ĠJob": 29255, + "Ġâīł": 29256, + "ĠTrip": 29257, + "Ġisop": 29258, + "Ġprojector": 29259, + "Ġatmospheres": 29260, + "Ġperforation": 29261, + "storage": 29262, + "iths": 29263, + "Ġmonomeric": 29264, + "ĠUSB": 29265, + "ĠEve": 29266, + "Ġspore": 29267, + "ĠmT": 29268, + "oxazole": 29269, + "ĠDeformation": 29270, + "Ġtextual": 29271, + "Ġwarf": 29272, + "Ġneuropathic": 29273, + "prepared": 29274, + "Ġblended": 29275, + "ĠHouston": 29276, + "************************************************************************": 29277, + "esters": 29278, + "Equals": 29279, + "Ġallergen": 29280, + "Ġpertinent": 29281, + "facts": 29282, + "uctions": 29283, + "Ġclocks": 29284, + "ĠVia": 29285, + "ĠCDF": 29286, + "Ġestuary": 29287, + "Ġphenomenology": 29288, + "arus": 29289, + "APH": 29290, + "Ġargues": 29291, + "Ġinserts": 29292, + "gow": 29293, + "hart": 29294, + "Ġchemotaxis": 29295, + "Ġpv": 29296, + "Ġrein": 29297, + "ĠGrim": 29298, + "ĠVF": 29299, + "Ġeffic": 29300, + "ĠProfiling": 29301, + "Ġanodic": 29302, + "ĠDENV": 29303, + "ĠWit": 29304, + "ĠSYSTEM": 29305, + "ĠCayley": 29306, + "Eng": 29307, + "ĠAQP": 29308, + "interactions": 29309, + "iliarity": 29310, + "ĠPromotes": 29311, + "Ġdams": 29312, + "ington": 29313, + "ffff": 29314, + "Ġintran": 29315, + "ĠTurbulence": 29316, + "ĠBianchi": 29317, + "CRE": 29318, + "ĠNOD": 29319, + "apine": 29320, + "ĠKane": 29321, + "ĠPDGF": 29322, + "ĠAxis": 29323, + "ĠCausal": 29324, + "ĠPoor": 29325, + "ĠWords": 29326, + "ĠHRV": 29327, + "Ġcyanobacteria": 29328, + "Ġreminiscent": 29329, + "ĠRemarkably": 29330, + "heet": 29331, + "@@": 29332, + "bil": 29333, + "Ġdiscriminating": 29334, + "ĠBaltic": 29335, + "ĠQuebec": 29336, + "Ġdefensive": 29337, + "âĪ©": 29338, + "kr": 29339, + "ĠRPE": 29340, + "seeking": 29341, + "ĠMovie": 29342, + "Ġinnovations": 29343, + "lept": 29344, + "Ġkw": 29345, + "Ġtibia": 29346, + "Ġneat": 29347, + "ytest": 29348, + "Ġthinner": 29349, + "Ġosteoblasts": 29350, + "ĠNorthwest": 29351, + "MOS": 29352, + "ĠPQ": 29353, + "Ġspi": 29354, + "Ġresponds": 29355, + "Ġhistorically": 29356, + "ĠPackage": 29357, + "ĠCoastal": 29358, + "ĠMississippi": 29359, + "ĠPVA": 29360, + "pering": 29361, + "indole": 29362, + "Ġprospectively": 29363, + "ĠHemisphere": 29364, + "Ġbarely": 29365, + "ánchez": 29366, + "aggered": 29367, + "yptian": 29368, + "ĠGest": 29369, + "yline": 29370, + "Ġphotochemical": 29371, + "oscalar": 29372, + "porated": 29373, + "Ġmetabolomics": 29374, + "Ġosteoblast": 29375, + "EGFP": 29376, + "eriatric": 29377, + "DW": 29378, + "quest": 29379, + "ĠHave": 29380, + "Ġspondyl": 29381, + "ĠPrimer": 29382, + "Ġsinks": 29383, + "Ġgaussian": 29384, + "ĠKhal": 29385, + "Enc": 29386, + "ĠAnopheles": 29387, + "Thanks": 29388, + "Ġconstrued": 29389, + "ĠUSS": 29390, + "ĠZeeman": 29391, + "Ġexported": 29392, + "ĠLevi": 29393, + "Ġcommander": 29394, + "connect": 29395, + "Ġnomenclature": 29396, + "therefore": 29397, + "ulata": 29398, + "Ġentrepreneur": 29399, + "Ġneuroscience": 29400, + "zan": 29401, + "Ġextant": 29402, + "ATIVE": 29403, + "opez": 29404, + "Ġenforced": 29405, + "ĠInnovation": 29406, + "earance": 29407, + "Ġimpressive": 29408, + "ĠPlac": 29409, + "ĠMoz": 29410, + "ĠStark": 29411, + "Ġrival": 29412, + "ĠCapital": 29413, + "Ġgranularity": 29414, + "Ġdiaphragm": 29415, + "utaneous": 29416, + "inds": 29417, + "Ġphotograph": 29418, + "Ġrectangles": 29419, + "TGF": 29420, + "Ġseaf": 29421, + "Ġmaze": 29422, + "ĠHW": 29423, + "Ġcorrelators": 29424, + "Ġdistinguishable": 29425, + "Ġconfounders": 29426, + "Ġlandslide": 29427, + "Ġtoll": 29428, + "Ġwastes": 29429, + "ĠWF": 29430, + "Ġendoc": 29431, + "Ġcapsid": 29432, + "ecund": 29433, + "ĠRBD": 29434, + "psin": 29435, + "Ġobstetric": 29436, + "Ġnanosheets": 29437, + "ocols": 29438, + "rens": 29439, + "ĠSubstituting": 29440, + "Ġcustomized": 29441, + "Ġresuscitation": 29442, + "Ġtubulin": 29443, + "ophyte": 29444, + "~~~~~~~~": 29445, + "plants": 29446, + "hicillin": 29447, + "halo": 29448, + "ruitment": 29449, + "ĠConcrete": 29450, + "Ġnanorods": 29451, + "ĠForms": 29452, + "Ġdying": 29453, + "discharge": 29454, + "Ġwellbeing": 29455, + "Ġwarmer": 29456, + "ĠSSD": 29457, + "ĠAUT": 29458, + "ĠConjug": 29459, + "Ġjuveniles": 29460, + "Ġinevitably": 29461, + "ĠMCS": 29462, + "approach": 29463, + "ĠMason": 29464, + "ĠGust": 29465, + "ĠThermodynamics": 29466, + "Ġpeel": 29467, + "ĠTranscriptome": 29468, + "Ġindispensable": 29469, + "urgery": 29470, + "posity": 29471, + "Ġpolarizations": 29472, + "ĠOthers": 29473, + "Ġsandy": 29474, + "Ġgliomas": 29475, + "Ġpursued": 29476, + "VEL": 29477, + "Ġrst": 29478, + "posium": 29479, + "nearest": 29480, + "Ġdisseminated": 29481, + "ĠMYC": 29482, + "Ġaldehyde": 29483, + "ĠDiagnostics": 29484, + "mans": 29485, + "Ġasphal": 29486, + "ĠSelect": 29487, + "ĠRecon": 29488, + "andro": 29489, + "DIM": 29490, + "Ġfeces": 29491, + "illon": 29492, + "ĠMALDI": 29493, + "nf": 29494, + "ĠElim": 29495, + "Ġhappy": 29496, + "ĠKarl": 29497, + "ĠInser": 29498, + "Ġinterrog": 29499, + "Intern": 29500, + "Ġtensorflow": 29501, + "Ġhaloes": 29502, + "Ġanticipate": 29503, + "ĠDPPH": 29504, + "rÃŃguez": 29505, + "Her": 29506, + "anate": 29507, + "Ġdressing": 29508, + "ĠHoly": 29509, + "Ġnewer": 29510, + "rides": 29511, + "placed": 29512, + "inetobacter": 29513, + "ĠOccurrence": 29514, + "edema": 29515, + "ĠIk": 29516, + "abad": 29517, + "ĠTransitions": 29518, + "Ġoutlines": 29519, + "Ġcochlear": 29520, + "Gy": 29521, + "success": 29522, + "ĠMEM": 29523, + "astype": 29524, + "Ġnormalizing": 29525, + "Ġterminates": 29526, + "Ġsuddenly": 29527, + "bbox": 29528, + "ĠPul": 29529, + "ĠPTP": 29530, + "aginal": 29531, + "Ġpretrained": 29532, + "Ġunreliable": 29533, + "ĠGraphical": 29534, + "ĠSeyfert": 29535, + "Ġcharacterizations": 29536, + "Ġtx": 29537, + "Ġbicarbonate": 29538, + "mathord": 29539, + "Ġheritability": 29540, + "stackexchange": 29541, + "iri": 29542, + "âĢĸ": 29543, + "ipit": 29544, + "attle": 29545, + "Ġarena": 29546, + "iba": 29547, + "ĠAX": 29548, + "ĠGPs": 29549, + "ophilia": 29550, + "SEL": 29551, + "osystem": 29552, + "ĠâĬ¢": 29553, + "ĠNucleus": 29554, + "redited": 29555, + "ACR": 29556, + "ĠAntenna": 29557, + "ĠCdc": 29558, + "orie": 29559, + "Ġequilibration": 29560, + "elong": 29561, + "stability": 29562, + "ĠSchist": 29563, + "Ġinjecting": 29564, + "hp": 29565, + "Ġvitamins": 29566, + "Poisson": 29567, + "ortal": 29568, + "ĠÃĬ": 29569, + "ĠÄı": 29570, + "Ill": 29571, + "Ġutils": 29572, + "ов": 29573, + "ĠGrom": 29574, + "::::": 29575, + "ĠGnRH": 29576, + "ĠSierra": 29577, + "Ġdrafted": 29578, + "Ġcapita": 29579, + "ships": 29580, + "Ġtimestamp": 29581, + "Ġsubstituents": 29582, + "ĠNotable": 29583, + "ĠPurpose": 29584, + "inol": 29585, + "Ġai": 29586, + "Ġfog": 29587, + "otone": 29588, + "ĠPlaces": 29589, + "byshev": 29590, + "tiology": 29591, + "ription": 29592, + "Ġyards": 29593, + "ĠXI": 29594, + "Ġtechnically": 29595, + "GAM": 29596, + "ĠABS": 29597, + "platform": 29598, + "ĠWO": 29599, + "PROC": 29600, + "Ġreconstit": 29601, + "ĠAnomalous": 29602, + "ĠBiol": 29603, + "Stage": 29604, + "ĠReviews": 29605, + "Ġrecalling": 29606, + "Ġillegal": 29607, + "lund": 29608, + "¬": 29609, + "uthenium": 29610, + "ĠPes": 29611, + "Ġovaries": 29612, + "solutions": 29613, + "massive": 29614, + "ĠRAW": 29615, + "Ġreconnection": 29616, + "ĠSusceptibility": 29617, + "Ġeconomical": 29618, + "cultured": 29619, + "ĠSham": 29620, + "sqcup": 29621, + "Ġpear": 29622, + "deposition": 29623, + "uchs": 29624, + "ĠSaw": 29625, + "Ġembolism": 29626, + "Bur": 29627, + "nar": 29628, + "oule": 29629, + "Ġtextile": 29630, + "seven": 29631, + "thio": 29632, + "Ġdenoising": 29633, + "CEP": 29634, + "Ġubiquitination": 29635, + "ĠCarlos": 29636, + "aP": 29637, + "Ġfolder": 29638, + "Ġhematological": 29639, + "iluminescence": 29640, + "ĠFuel": 29641, + "icion": 29642, + "aculture": 29643, + "ARB": 29644, + "ĠTravel": 29645, + "Func": 29646, + "acles": 29647, + "ĠInte": 29648, + "Ġvacua": 29649, + "Ġcocktail": 29650, + "ĠInsp": 29651, + "Ġcorporate": 29652, + "Ġdepicting": 29653, + "Ġsprint": 29654, + "ĠmTORC": 29655, + "Ġcimg": 29656, + "ocarbon": 29657, + "ĠDave": 29658, + "ĠGb": 29659, + "iji": 29660, + "targeting": 29661, + "Ġsequestration": 29662, + "Bri": 29663, + "IGF": 29664, + "Ġanalytics": 29665, + "ĠAcinetobacter": 29666, + "gets": 29667, + "MPS": 29668, + "ogluc": 29669, + "Cent": 29670, + "Ġverbs": 29671, + "Ġinductance": 29672, + "diagram": 29673, + "Ġrecalled": 29674, + "Ġcosme": 29675, + "Ġautomotive": 29676, + "ĠPDEs": 29677, + "ĠReid": 29678, + "Ġadapter": 29679, + "ĠOliver": 29680, + "Ġavalanche": 29681, + "Vir": 29682, + "ĠToxicity": 29683, + "ĠLeu": 29684, + "Conclusions": 29685, + "Ġtetragonal": 29686, + "ĠDMF": 29687, + "umannii": 29688, + "ĠRequirements": 29689, + "toc": 29690, + "ité": 29691, + "Ġcontinent": 29692, + "ĠHank": 29693, + "ĠDefinitions": 29694, + "GPU": 29695, + "origin": 29696, + "Ġdichro": 29697, + "Mus": 29698, + "Ġbival": 29699, + "Ġimpulsive": 29700, + "Ġassemble": 29701, + "Ġpipes": 29702, + "docs": 29703, + "Ġexchanger": 29704, + "Ġallograft": 29705, + "loyd": 29706, + "ĠÌĭ": 29707, + "Ġantenatal": 29708, + "Ġgrassland": 29709, + "Ġhystere": 29710, + "ĠAntigen": 29711, + "ĠGeneric": 29712, + "ĠTuring": 29713, + "ĠExcell": 29714, + "ĠHein": 29715, + "aja": 29716, + "uminum": 29717, + "citabine": 29718, + "facial": 29719, + "iteration": 29720, + "Ġslurry": 29721, + "AML": 29722, + "ergetic": 29723, + "ĠTHF": 29724, + "Ġkilometers": 29725, + "fg": 29726, + "educ": 29727, + "idian": 29728, + "Ġpredicates": 29729, + "Ġradios": 29730, + "ĠPeri": 29731, + "ĠShell": 29732, + "Ġarcsec": 29733, + "Ġstriatal": 29734, + "Ġceiling": 29735, + "olithic": 29736, + "Ġexhaustion": 29737, + "PUT": 29738, + "thers": 29739, + "ymp": 29740, + "ĠQian": 29741, + "ĠProgressive": 29742, + "Ġwel": 29743, + "ĠConvention": 29744, + "ĠCurie": 29745, + "ĠMans": 29746, + "ĠNova": 29747, + "ĠWells": 29748, + "dew": 29749, + "Standard": 29750, + "realistic": 29751, + "transpose": 29752, + "serial": 29753, + "ĠTx": 29754, + "ĠAMR": 29755, + "Ġindeterm": 29756, + "ĠLiouville": 29757, + "hookrightarrow": 29758, + "ARs": 29759, + "Ġbaseball": 29760, + "acious": 29761, + "agnetization": 29762, + "estimate": 29763, + "ĠPAS": 29764, + "Ġmeals": 29765, + "multiple": 29766, + "ĠBiomarkers": 29767, + "Wide": 29768, + "ĠTomography": 29769, + "////////////////////////////////": 29770, + "Ġresins": 29771, + "Ġanywhere": 29772, + "INC": 29773, + "ĠTeaching": 29774, + "ĠSamuel": 29775, + "Ġhallmark": 29776, + "ĠThyroid": 29777, + "othi": 29778, + "Ġconstraining": 29779, + "ĠBarrett": 29780, + "ĠErrors": 29781, + "Cole": 29782, + "sharing": 29783, + "HDL": 29784, + "Effect": 29785, + "ĠTolerance": 29786, + "Ġstressful": 29787, + "ĠBalance": 29788, + "ĠTech": 29789, + "Ġvalleys": 29790, + "setup": 29791, + "ĠRadical": 29792, + "ĠMacrophages": 29793, + "Ġinterrupt": 29794, + "Ġdiatom": 29795, + "colored": 29796, + "Ġpyrid": 29797, + "FDG": 29798, + "æ": 29799, + "Ġreared": 29800, + "ĠRating": 29801, + "Ġopaque": 29802, + "package": 29803, + "Ġnasopharyngeal": 29804, + "Ġpreconditioning": 29805, + "Diptera": 29806, + "ĠMing": 29807, + "ĠCaro": 29808, + "ĠImmunity": 29809, + "rifuge": 29810, + "ĠObjectives": 29811, + "ghan": 29812, + "uccin": 29813, + "ĠFors": 29814, + "ĠFITC": 29815, + "Ġseats": 29816, + "ĠImpaired": 29817, + "Ġreefs": 29818, + "emaker": 29819, + "Ġoffices": 29820, + "Ġaccepting": 29821, + "ĠTRAN": 29822, + "ĠTargets": 29823, + "Ġcorrelator": 29824, + "Ġsupercapac": 29825, + "inburgh": 29826, + "Ġcollider": 29827, + "Ġenteric": 29828, + "ĠSTRUCTURE": 29829, + "Ġminister": 29830, + "ĠArchae": 29831, + "Loop": 29832, + "ĠASA": 29833, + "Ġcontacted": 29834, + "Ġhistidine": 29835, + "folded": 29836, + "Search": 29837, + "Ġrespects": 29838, + "ĠATF": 29839, + "Ġtrouble": 29840, + "Ġprevailing": 29841, + "Cp": 29842, + "ĠTCM": 29843, + "ĠSpinal": 29844, + "Ġguides": 29845, + "evitable": 29846, + "Ġbrick": 29847, + "strings": 29848, + "ĠHungary": 29849, + "Ġeps": 29850, + "entricular": 29851, + "Specifically": 29852, + "ando": 29853, + "issues": 29854, + "osomiasis": 29855, + "kDa": 29856, + "Ġaside": 29857, + "Ġadenine": 29858, + "Ġmotivate": 29859, + "stratig": 29860, + "BLE": 29861, + "ĠDeposition": 29862, + "motor": 29863, + "ĠHers": 29864, + "Ġnebul": 29865, + "ĠBarrier": 29866, + "Unlike": 29867, + "Ġballistic": 29868, + "Ġsouthwestern": 29869, + "ĠMontreal": 29870, + "Scan": 29871, + "Ġmould": 29872, + "Ġinterrup": 29873, + "smallmatrix": 29874, + "Ġelaborated": 29875, + "ucks": 29876, + "APS": 29877, + "ĠConsumption": 29878, + "capacity": 29879, + "innitus": 29880, + "Ġgovernance": 29881, + "Ġpalsy": 29882, + "Ġsubmission": 29883, + "Ġtemple": 29884, + "ĠIIA": 29885, + "methionine": 29886, + "Ġkerat": 29887, + "Ġridges": 29888, + "Promega": 29889, + "cols": 29890, + "ISP": 29891, + "Ġapnea": 29892, + "ĠFlat": 29893, + "ĠEpigenetic": 29894, + "Ġparish": 29895, + "ĠParametric": 29896, + "dash": 29897, + "future": 29898, + "rise": 29899, + "Ġcontracting": 29900, + "algia": 29901, + "Ġgoto": 29902, + "stadt": 29903, + "Ġfabricate": 29904, + "Ġdimerization": 29905, + "dump": 29906, + "ĠLyn": 29907, + "Ġrecycled": 29908, + "posedness": 29909, + "ĠSensory": 29910, + "ïĿ": 29911, + "ĠWet": 29912, + "Ġdiethyl": 29913, + "Ġblades": 29914, + "Ġtimed": 29915, + "Ġkeyword": 29916, + "Ġpolytope": 29917, + "ĠGot": 29918, + "Ġapproximates": 29919, + "Without": 29920, + "ĠBere": 29921, + "ĠLp": 29922, + "oplasty": 29923, + "ĠFibr": 29924, + "modulated": 29925, + "ĠARM": 29926, + "Ġunderestimate": 29927, + "ĠCBS": 29928, + "ĠLectures": 29929, + "uncan": 29930, + "ĠSeismic": 29931, + "Soft": 29932, + "Ġzooplankton": 29933, + "Ġencephalopathy": 29934, + "ĠSSA": 29935, + "ĠCros": 29936, + "ĠHann": 29937, + "Ġshuffle": 29938, + "scription": 29939, + "ĠRevers": 29940, + "Studies": 29941, + "Ġsocially": 29942, + "Ġsubcl": 29943, + "ĠYong": 29944, + "ogh": 29945, + "Ġïģ³": 29946, + "UDY": 29947, + "ĠHaar": 29948, + "ĠDoctor": 29949, + "Ġintakes": 29950, + "Ġbarrel": 29951, + "ĠTRPV": 29952, + "ĠAggreg": 29953, + "nyi": 29954, + "tuned": 29955, + "acquired": 29956, + "Ġhook": 29957, + "FGF": 29958, + "«": 29959, + "ĠInjection": 29960, + "Ġgravel": 29961, + "Ġmicrog": 29962, + "Ġmenstrual": 29963, + "Feature": 29964, + "IRE": 29965, + "uu": 29966, + "ĠSrc": 29967, + "ĠStore": 29968, + "Ġinitiator": 29969, + "PSO": 29970, + "Ġepileptic": 29971, + "Ġcingulate": 29972, + "IJ": 29973, + "Row": 29974, + "Ġsinging": 29975, + "ĠMethan": 29976, + "ĠAldrich": 29977, + "Ġtremendous": 29978, + "amining": 29979, + "Ġtracts": 29980, + "Ġâİ£": 29981, + "klah": 29982, + "Div": 29983, + "indol": 29984, + "Ġindole": 29985, + "exper": 29986, + "Ġglycer": 29987, + "Ġbenzyl": 29988, + "Ġworsening": 29989, + "Ġunambiguous": 29990, + "uart": 29991, + "Ġparsim": 29992, + "ricks": 29993, + "Ġtrail": 29994, + "ĠBlanc": 29995, + "Ġaminotransferase": 29996, + "ĠDOC": 29997, + "Ġfumig": 29998, + "idic": 29999, + "ĠConsequences": 30000, + "Ġacidification": 30001, + "ĠCIFAR": 30002, + "ĠDatasets": 30003, + "ĠAMI": 30004, + "Ġexplants": 30005, + "ĠDiverse": 30006, + "Ġdephasing": 30007, + "Ġparliament": 30008, + "ipient": 30009, + "Ġhoneycomb": 30010, + "heavy": 30011, + "Ġwatermark": 30012, + "MED": 30013, + "datasets": 30014, + "waters": 30015, + "Provid": 30016, + "interpret": 30017, + "rovirus": 30018, + "Io": 30019, + "RAD": 30020, + "Ġlunar": 30021, + "Ġweaning": 30022, + "Ġsensorimotor": 30023, + "uca": 30024, + "Ġinfect": 30025, + "ĠUnique": 30026, + "GRP": 30027, + "QoL": 30028, + "ospec": 30029, + "Ġforwarding": 30030, + "Estim": 30031, + "ÅĦski": 30032, + "ĠMs": 30033, + "achn": 30034, + "Ġrota": 30035, + "Ġappointment": 30036, + "ĠMedal": 30037, + "Ġadenovirus": 30038, + "quinol": 30039, + "Ġdeuterium": 30040, + "tep": 30041, + "ĠStyle": 30042, + "Nd": 30043, + "ayama": 30044, + "ĠHamm": 30045, + "ĠSpecification": 30046, + "vability": 30047, + "tha": 30048, + "Ġjitter": 30049, + "Ġâݦ": 30050, + "aqu": 30051, + "wire": 30052, + "Ġclassically": 30053, + "Ġsuperpotential": 30054, + "ĠSpecim": 30055, + "ĠVariance": 30056, + "Ġalbums": 30057, + "ĠSenior": 30058, + "Ġneurotransmitter": 30059, + "ĠRecombinant": 30060, + "DCS": 30061, + "vl": 30062, + "Ġpf": 30063, + "Ġinevitable": 30064, + "ĠNick": 30065, + "Ġmanipulating": 30066, + "ituximab": 30067, + "ceiver": 30068, + "ĠBren": 30069, + "ĠRace": 30070, + "Ġretarded": 30071, + "modulin": 30072, + "Clinical": 30073, + "Ġneurologic": 30074, + "ĠRegiment": 30075, + "Ġzoom": 30076, + "ĠOrthogonal": 30077, + "ĠConcerning": 30078, + "ĠJurassic": 30079, + "ĠArtem": 30080, + "ĠMelbourne": 30081, + "bins": 30082, + "jl": 30083, + "Ġinhab": 30084, + "Ġsqrt": 30085, + "Ġsemisimple": 30086, + "astric": 30087, + "ĠProxim": 30088, + "ĠVariants": 30089, + "Ġaesthetic": 30090, + "Ġsummarised": 30091, + "ĠBecker": 30092, + "OCH": 30093, + "dale": 30094, + "Ġmounting": 30095, + "andering": 30096, + "Ġsoftmax": 30097, + "Ġneuroinflammation": 30098, + "Ġesophagus": 30099, + "operators": 30100, + "ĠADAM": 30101, + "Ġviolate": 30102, + "ĠPHY": 30103, + "ede": 30104, + "ĠCher": 30105, + "orsal": 30106, + "Ġmetamorphic": 30107, + "ĠICM": 30108, + "ĠAbcam": 30109, + "slot": 30110, + "serine": 30111, + "Ġduplicates": 30112, + "ĠMEMS": 30113, + "ĠAbl": 30114, + "ĠChel": 30115, + "ĠAuthority": 30116, + "Ġgeo": 30117, + "Ġhomeomorphism": 30118, + "Ġimmunomodulatory": 30119, + "ĠTU": 30120, + "ĠKT": 30121, + "aterally": 30122, + "oxides": 30123, + "tebral": 30124, + "Ġcataract": 30125, + "leaved": 30126, + "igu": 30127, + "ateur": 30128, + "ĠRé": 30129, + "Ġdiscoveries": 30130, + "boson": 30131, + "ocated": 30132, + "jpg": 30133, + "ĠSato": 30134, + "ĠPROP": 30135, + "ĠImplement": 30136, + "ELISA": 30137, + "iqueness": 30138, + "Ġsymbion": 30139, + "ĠFaraday": 30140, + "ĠPPARγ": 30141, + "witz": 30142, + "reward": 30143, + "ĠBush": 30144, + "stressed": 30145, + "ĠAbor": 30146, + "Ġairways": 30147, + "Ġinterferometry": 30148, + "Circ": 30149, + "Ġimmunoprecipitation": 30150, + "ĠApache": 30151, + "rophosph": 30152, + "ĠoC": 30153, + "Ġfrog": 30154, + "ĠGU": 30155, + "ffe": 30156, + "ĠStro": 30157, + "Ġdodecyl": 30158, + "dan": 30159, + "folds": 30160, + "ĠMust": 30161, + "Ġsurroundings": 30162, + "Ġcodons": 30163, + "onda": 30164, + "tb": 30165, + "odge": 30166, + "avas": 30167, + "ĠSeason": 30168, + "tude": 30169, + "ĠPlasticity": 30170, + "ĠHawaii": 30171, + "DEG": 30172, + "ĠCMD": 30173, + "Ġsingleton": 30174, + "keley": 30175, + "Ġalgebraically": 30176, + "Ġnanostructured": 30177, + "easible": 30178, + "Ġoverlooked": 30179, + "ĠPulse": 30180, + "romechanical": 30181, + "ĠElse": 30182, + "Ġexcitons": 30183, + "ĠConstrained": 30184, + "Ġcohesion": 30185, + "Ġrealizing": 30186, + "ĠRadiative": 30187, + "Ġtrypan": 30188, + "xs": 30189, + "ĠTas": 30190, + "Ġmainstream": 30191, + "Ġcompactly": 30192, + "growing": 30193, + "esc": 30194, + "ĠdN": 30195, + "ĠSignatures": 30196, + "ĠFundamentals": 30197, + "Ġexpose": 30198, + "ĠRang": 30199, + "Ġhanded": 30200, + "Ġfunctionalization": 30201, + "Ġpassiv": 30202, + "altern": 30203, + "agul": 30204, + "Ġschematically": 30205, + "OW": 30206, + "ĠÖ": 30207, + "ĠPOD": 30208, + "Ġhear": 30209, + "ymore": 30210, + "ĠPremier": 30211, + "South": 30212, + "Ä«": 30213, + "ĠOBS": 30214, + "ĠAlg": 30215, + "glia": 30216, + "ĠTransmembrane": 30217, + "Ġspheroids": 30218, + "ĠRHS": 30219, + "Ġinches": 30220, + "ĠKato": 30221, + "Ġie": 30222, + "ĠCommercial": 30223, + "Ġanalytes": 30224, + "Ġrisky": 30225, + "Ġpiston": 30226, + "ĠMarkovian": 30227, + "Ġdrama": 30228, + "Ġci": 30229, + "ĠHistological": 30230, + "Ġactuation": 30231, + "discrete": 30232, + "carbamoyl": 30233, + "SMA": 30234, + "Ġfeeds": 30235, + "Ġneoplasia": 30236, + "ĠController": 30237, + "been": 30238, + "glutamine": 30239, + "injected": 30240, + "Ġcrab": 30241, + "ĠCauses": 30242, + "ĠStory": 30243, + "Ġvanadium": 30244, + "ĠTitan": 30245, + "enix": 30246, + "assign": 30247, + "Ġimmunogenicity": 30248, + "ĠApparent": 30249, + "Ġenhancers": 30250, + "ĠSou": 30251, + "alloy": 30252, + "mathbin": 30253, + "Ġsedation": 30254, + "ĠWorkshop": 30255, + "gover": 30256, + "lst": 30257, + "Ġupwelling": 30258, + "mez": 30259, + "Ġpolypropylene": 30260, + "ĠColorectal": 30261, + "ĠRelaxation": 30262, + "Ġfragile": 30263, + "Äĥ": 30264, + "Ġsubgraphs": 30265, + "theoretical": 30266, + "Operator": 30267, + "lywood": 30268, + "awn": 30269, + "ĠPercentage": 30270, + "methylation": 30271, + "corrhizal": 30272, + "Grad": 30273, + "dens": 30274, + "ĠHα": 30275, + "Ġupcoming": 30276, + "Ġvirgin": 30277, + "Names": 30278, + "ĠRyd": 30279, + "Ġâݤ": 30280, + "phosphorylation": 30281, + "renewal": 30282, + "Year": 30283, + "Init": 30284, + "Ġselling": 30285, + "ĠMASS": 30286, + "rophin": 30287, + "ijn": 30288, + "Conversely": 30289, + "Ġuniversally": 30290, + "orhombic": 30291, + "Ġunpredictable": 30292, + "Fock": 30293, + "chair": 30294, + "ivas": 30295, + "networks": 30296, + "Ġterritories": 30297, + "thia": 30298, + "ĠAmplification": 30299, + "March": 30300, + "Ġflam": 30301, + "ĠChart": 30302, + "Ġshortage": 30303, + "AMET": 30304, + "Ġgrape": 30305, + "Ġvoltammetry": 30306, + "د": 30307, + "ĠSCH": 30308, + "Ġepithel": 30309, + "ĠChromosome": 30310, + "ĠXL": 30311, + "ĠPersistent": 30312, + "Ġtraveled": 30313, + "Ġmeridional": 30314, + "Ġfprintf": 30315, + "Ġgum": 30316, + "visory": 30317, + "Unfortunately": 30318, + "Ġanteced": 30319, + "Ġfrictional": 30320, + "DAT": 30321, + "acl": 30322, + "ĠPregnancy": 30323, + "ĠBZ": 30324, + "regulatory": 30325, + "stimulating": 30326, + "Japan": 30327, + "machine": 30328, + "uti": 30329, + "ĠLer": 30330, + "Ġnanoflu": 30331, + "prototype": 30332, + "identification": 30333, + "klahoma": 30334, + "ĠEmploy": 30335, + "Schwarz": 30336, + "Ġincorrectly": 30337, + "atto": 30338, + "rization": 30339, + "ismuth": 30340, + "Ġiris": 30341, + "imentary": 30342, + "Ġinflationary": 30343, + "Ġoutflows": 30344, + "ĠLic": 30345, + "oreductase": 30346, + "Ġproceeding": 30347, + "ĠTAC": 30348, + "ĠHTL": 30349, + "Ġresides": 30350, + "stral": 30351, + "ĠTransf": 30352, + "Ġdichotom": 30353, + "Filter": 30354, + "June": 30355, + "isure": 30356, + "ĠAde": 30357, + "Ġijk": 30358, + "ĠPhilos": 30359, + "Ġstayed": 30360, + "Ġtamoxifen": 30361, + "Ġasparagine": 30362, + "exception": 30363, + "Ġaccumulating": 30364, + "astro": 30365, + "Change": 30366, + "uzi": 30367, + "Ġlon": 30368, + "Instead": 30369, + "Ġcentrally": 30370, + "ĠDental": 30371, + "classified": 30372, + "ĠEgyptian": 30373, + "Address": 30374, + "ĠQuaternary": 30375, + "ĠUSP": 30376, + "coin": 30377, + "Ġembryogenesis": 30378, + "ï̍": 30379, + "Null": 30380, + "ĠMixing": 30381, + "intensive": 30382, + "Ġnormative": 30383, + "ĠLef": 30384, + "Ġrumen": 30385, + "ĠThai": 30386, + "Ġswallow": 30387, + "Component": 30388, + "Ġrobotics": 30389, + "ĠCad": 30390, + "ĠCIP": 30391, + "ĠAcids": 30392, + "ĠOffic": 30393, + "urer": 30394, + "ĠWick": 30395, + "Ġkink": 30396, + "ĠScha": 30397, + "ĠCharacteristic": 30398, + "families": 30399, + "ĠGCs": 30400, + "ĠOptimizing": 30401, + "Ġtimer": 30402, + "él": 30403, + "jin": 30404, + "reversal": 30405, + "Ġsandstone": 30406, + "HN": 30407, + "tk": 30408, + "Ġptr": 30409, + "Ġmonochromatic": 30410, + "Ġfeedforward": 30411, + "dington": 30412, + "Ġcriticism": 30413, + "Ġsig": 30414, + "Ġpace": 30415, + "ĠTK": 30416, + "ĠWas": 30417, + "Ġcertificate": 30418, + "Ġstuck": 30419, + "Ġcorrid": 30420, + "Ġlocalisation": 30421, + "Ġsilk": 30422, + "Ġdigest": 30423, + "ĠTemple": 30424, + "ĠPosterior": 30425, + "Ġcommutator": 30426, + "tsch": 30427, + "perme": 30428, + "ysed": 30429, + "Ġmenu": 30430, + "Ġmidw": 30431, + "ocatalytic": 30432, + "Ġppb": 30433, + "Types": 30434, + "arri": 30435, + "ĠLOD": 30436, + "Ġloan": 30437, + "secret": 30438, + "Ġcarbons": 30439, + "ĠHolog": 30440, + "olipids": 30441, + "Ġuplo": 30442, + "ĠDNase": 30443, + "Ġpuzzle": 30444, + "Ġstance": 30445, + "ĠManchester": 30446, + "ĠDetector": 30447, + "ims": 30448, + "ĠTerms": 30449, + "ĠPGC": 30450, + "Ġincidents": 30451, + "ieh": 30452, + "ĠIDs": 30453, + "ĠAhmad": 30454, + "Ġnights": 30455, + "Ġbiomo": 30456, + "ĠMethylation": 30457, + "uator": 30458, + "resize": 30459, + "ĠFinger": 30460, + "ĠWo": 30461, + "Ġposter": 30462, + "Ġsolidification": 30463, + "ĠValidity": 30464, + "ĠDendritic": 30465, + "Ġadherent": 30466, + "issions": 30467, + "inction": 30468, + "Ġantagonistic": 30469, + "ĠPreliminaries": 30470, + "Ġcoval": 30471, + "Ġmovies": 30472, + "Ġbudding": 30473, + "Kn": 30474, + "ĠGit": 30475, + "ĠThereafter": 30476, + "Ġcapacitive": 30477, + "Az": 30478, + "ĠTLS": 30479, + "Ġinitiates": 30480, + "ĠDMR": 30481, + "Ġâī«": 30482, + "ĠMyocardial": 30483, + "ĠRotation": 30484, + "CONFIG": 30485, + "Ġvowel": 30486, + "Ġolivine": 30487, + "Hamiltonian": 30488, + "Ġstalk": 30489, + "Neu": 30490, + "Rest": 30491, + "anical": 30492, + "Ġdst": 30493, + "Ġresh": 30494, + "Ġexpressive": 30495, + "Ġinfectivity": 30496, + "oku": 30497, + "CTL": 30498, + "Frequency": 30499, + "Ġpremise": 30500, + "Walk": 30501, + "ĠâĹ": 30502, + "Ġrelapsed": 30503, + "tured": 30504, + "ĠUML": 30505, + "ovan": 30506, + "ĠResearchers": 30507, + "Ġconveniently": 30508, + "usk": 30509, + "INIT": 30510, + "Eqs": 30511, + "Factory": 30512, + "Ġunsteady": 30513, + "ĠAnsw": 30514, + "Ala": 30515, + "nitine": 30516, + "qp": 30517, + "ulous": 30518, + "research": 30519, + "ĠBrom": 30520, + "ĠDemoc": 30521, + "configuration": 30522, + "ulosic": 30523, + "Ġfra": 30524, + "Ġgift": 30525, + "Third": 30526, + "Claim": 30527, + "ÄŁ": 30528, + "odiazep": 30529, + "Ġprox": 30530, + "ocystis": 30531, + "ĠRPA": 30532, + "ĠLikert": 30533, + "RMS": 30534, + "tech": 30535, + "Ġacous": 30536, + "TLR": 30537, + "buck": 30538, + "ĠTherap": 30539, + "ussions": 30540, + "helor": 30541, + "ĠEmotion": 30542, + "bird": 30543, + "Ġthio": 30544, + "Ġquantitation": 30545, + "bracket": 30546, + "Ġpercept": 30547, + "Ġsubcategory": 30548, + "Ġlightning": 30549, + "Ġhernia": 30550, + "Ġneurotrophic": 30551, + "SDS": 30552, + "ĠAnders": 30553, + "Ġslowing": 30554, + "strongly": 30555, + "ĠCounting": 30556, + "ĠIncluding": 30557, + "ductions": 30558, + "ubated": 30559, + "ĠStorm": 30560, + "correlated": 30561, + "Ġautoantibodies": 30562, + "ĠMerg": 30563, + "ocer": 30564, + "micutes": 30565, + "Ġnonlinearities": 30566, + "ĠCentury": 30567, + "ĠLandscape": 30568, + "ĠDerivatives": 30569, + "ĠContrary": 30570, + "Ġcompile": 30571, + "ĠHepatic": 30572, + "Ġponds": 30573, + "Ġorganize": 30574, + "DMSO": 30575, + "Position": 30576, + "Ġbrach": 30577, + "Ġinflat": 30578, + "ospace": 30579, + "Ġskewness": 30580, + "Ġagitation": 30581, + "ĠHOMO": 30582, + "EU": 30583, + "Ġcommented": 30584, + "Ġcorpora": 30585, + "Ġmalt": 30586, + "Hermitian": 30587, + "iday": 30588, + "ĠHelmholtz": 30589, + "roblast": 30590, + "ĠCTR": 30591, + "unching": 30592, + "ĠMond": 30593, + "ĠComment": 30594, + "Ġosteosarcoma": 30595, + "posterior": 30596, + "Ġthymus": 30597, + "Ġcigarettes": 30598, + "NW": 30599, + "olem": 30600, + "ĠHox": 30601, + "ĠNFL": 30602, + "ĠAvailable": 30603, + "ĠSiber": 30604, + "ĠFeld": 30605, + "Ġborderline": 30606, + "Ġbeats": 30607, + "Ġorganised": 30608, + "Ġdistinguishes": 30609, + "Ġdialog": 30610, + "ĠBerger": 30611, + "oleic": 30612, + "Ġnumbered": 30613, + "Ġreachable": 30614, + "ĠRobertson": 30615, + "ĠChamber": 30616, + "ndarray": 30617, + "Ġcytoskeletal": 30618, + "Ġblending": 30619, + "blood": 30620, + "Import": 30621, + "Ġoverwhelming": 30622, + "Ġio": 30623, + "Ġoutage": 30624, + "ĠScholar": 30625, + "placing": 30626, + "ĠPolyp": 30627, + "Decl": 30628, + "ĠMEDLINE": 30629, + "ĠKM": 30630, + "ĠDAP": 30631, + "errors": 30632, + "ĠSHR": 30633, + "ĠDex": 30634, + "ĠGAS": 30635, + "ĠGian": 30636, + "Ġclinicopathological": 30637, + "Ġïģ·": 30638, + "ĠPredictions": 30639, + "ĠQuadratic": 30640, + "Ġarrhythmias": 30641, + "arid": 30642, + "Ġclothing": 30643, + "ĠFracture": 30644, + "ĉĠĠĠĠĠ": 30645, + "addy": 30646, + "ĠAlberta": 30647, + "ĠWed": 30648, + "phire": 30649, + "ĠEncryp": 30650, + "ĠLAB": 30651, + "ĠFano": 30652, + "CTT": 30653, + "Ġoryz": 30654, + "iliac": 30655, + "ĠLiao": 30656, + "versus": 30657, + "Ġmeso": 30658, + "Ġmidpoint": 30659, + "Ġstator": 30660, + "ĠJenn": 30661, + "ovsky": 30662, + "Ġuncover": 30663, + "erenn": 30664, + "ĠMcM": 30665, + "âīĪ": 30666, + "ĠCircuits": 30667, + "Ġfetuses": 30668, + "Ġagglomer": 30669, + "Ġfb": 30670, + "Ġyy": 30671, + "atech": 30672, + "ARG": 30673, + "Ġbaumannii": 30674, + "Ġellipsoid": 30675, + "Ġloses": 30676, + "Ġunve": 30677, + "Ġbutt": 30678, + "Ġmulticentre": 30679, + "iline": 30680, + "Ġresort": 30681, + "Ġcerebrovascular": 30682, + "ĠDecreased": 30683, + "jud": 30684, + "sus": 30685, + "amol": 30686, + "constraints": 30687, + "Ġteen": 30688, + "ĠPassive": 30689, + "ĠCaucasian": 30690, + "Ġcran": 30691, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 30692, + "ün": 30693, + "ĠDNMT": 30694, + "Ġterror": 30695, + "adrenal": 30696, + "Ġangiogenic": 30697, + "ĠInhibitory": 30698, + "prag": 30699, + "Ġcob": 30700, + "elsh": 30701, + "Ġenhancements": 30702, + "ĠShaw": 30703, + "ĠTakahashi": 30704, + "Ġsulphur": 30705, + "Ġgravitation": 30706, + "ĠPVDF": 30707, + "must": 30708, + "¢": 30709, + "asymptotic": 30710, + "elman": 30711, + "ĠPros": 30712, + "ĠMAD": 30713, + "ĠLen": 30714, + "therapy": 30715, + "efully": 30716, + "sulfur": 30717, + "ĠTCA": 30718, + "additive": 30719, + "talk": 30720, + "Ġpiglets": 30721, + "Ġprospect": 30722, + "ecundity": 30723, + "ĠXiang": 30724, + "handler": 30725, + "Ġclath": 30726, + "Ġmillimeter": 30727, + "jar": 30728, + "Ġbiophysical": 30729, + "Ġcomplexities": 30730, + "ĠHerb": 30731, + "Ġrecovers": 30732, + "ĠVincent": 30733, + "ĠPuerto": 30734, + "Earth": 30735, + "RAM": 30736, + "Ġcables": 30737, + "designed": 30738, + "ĠOscillation": 30739, + "Ġmeiosis": 30740, + "Ġfleet": 30741, + "ĠHuntington": 30742, + "ĠBeg": 30743, + "ĠECs": 30744, + "ĠAntic": 30745, + "Ġpractitioner": 30746, + "cultural": 30747, + "kat": 30748, + "Ġrecoil": 30749, + "ĠImplicit": 30750, + "Ġsummaries": 30751, + "Ġdiscontinued": 30752, + "Ġencompassing": 30753, + "ĠAltogether": 30754, + "ĠDIST": 30755, + "Ġconstellation": 30756, + "ĠExisting": 30757, + "Ġconductors": 30758, + "oplasm": 30759, + "ĠCosmology": 30760, + "Zero": 30761, + "ĠInform": 30762, + "Ġendangered": 30763, + "Ġweapons": 30764, + "atype": 30765, + "ĠAsc": 30766, + "Ġfluence": 30767, + "Ġferric": 30768, + "ĠLaurent": 30769, + "Early": 30770, + "Ġsgn": 30771, + "ĠHadamard": 30772, + "Ġastron": 30773, + "Cys": 30774, + "ĠThm": 30775, + "Ġdece": 30776, + "erencing": 30777, + "ĠMeans": 30778, + "Ġhydrated": 30779, + "ÙĪ": 30780, + "Ġrigorously": 30781, + "Ġambulatory": 30782, + "ĠDOI": 30783, + "Handle": 30784, + "ĠEnterobacteriaceae": 30785, + "ĠRQ": 30786, + "ĠGFR": 30787, + "prote": 30788, + "Ġmigrated": 30789, + "thening": 30790, + "ĠHopkins": 30791, + "ĠPsychology": 30792, + "igl": 30793, + "ĠEDS": 30794, + "Ġâζ": 30795, + "Ġremotely": 30796, + "ĠÂ¥": 30797, + "Ġinspiration": 30798, + "ĠâĮ¬": 30799, + "olian": 30800, + "Ġsaliency": 30801, + "ĠDog": 30802, + "ĠRosa": 30803, + "oya": 30804, + "Ġoccupies": 30805, + "camera": 30806, + "Ġdecompression": 30807, + "Ġscatt": 30808, + "Ġinvestigator": 30809, + "Ġcounterex": 30810, + "ĠIFNγ": 30811, + "ĠPittsburgh": 30812, + "Ġadminister": 30813, + "negl": 30814, + "ussis": 30815, + "MPC": 30816, + "ĠSwitching": 30817, + "Ġcooler": 30818, + "Ġbronchi": 30819, + "Ġparalle": 30820, + "Ġspeckle": 30821, + "Ġphysiologic": 30822, + "INVAL": 30823, + "Ġheterologous": 30824, + "|||": 30825, + "orghum": 30826, + "GAL": 30827, + "Ġmalformations": 30828, + "Ġweakening": 30829, + "Ġpsycho": 30830, + "ĠIH": 30831, + "Ġcontradictory": 30832, + "Ġphonological": 30833, + "ĠPerturbation": 30834, + "bB": 30835, + "ĠNos": 30836, + "TRUE": 30837, + "folding": 30838, + "phenol": 30839, + "ĠLSM": 30840, + "ĠâĪĹ": 30841, + "ĠAngle": 30842, + "Ġprovincial": 30843, + "FeO": 30844, + "ÅĽ": 30845, + "ĠIber": 30846, + "ressors": 30847, + "Ġproliferating": 30848, + "zers": 30849, + "organism": 30850, + "âĨĵ": 30851, + "ZO": 30852, + "cimg": 30853, + "Ġunperturbed": 30854, + "Ġjj": 30855, + "Ġelectrodynamics": 30856, + "ĠEpit": 30857, + "NTs": 30858, + "ĠBloom": 30859, + "Ġlanth": 30860, + "aminant": 30861, + "ĠSwift": 30862, + "European": 30863, + "Ġafferent": 30864, + "Reduce": 30865, + "published": 30866, + "ĠFitting": 30867, + "ĠFungal": 30868, + "Ġtribe": 30869, + "recting": 30870, + "Ġconjugacy": 30871, + "imeters": 30872, + "ĠCec": 30873, + "ĠKH": 30874, + "castle": 30875, + "Ġseptal": 30876, + "releasing": 30877, + "Ġoss": 30878, + "Ġ¦": 30879, + "ĠMissing": 30880, + "ĠFatigue": 30881, + "ĠBaseball": 30882, + "Ġimmunoblotting": 30883, + "Ġoh": 30884, + "orations": 30885, + "Ġvine": 30886, + "azy": 30887, + "serum": 30888, + "Ġlookup": 30889, + "Ġneovascular": 30890, + "iah": 30891, + "soil": 30892, + "Ġairflow": 30893, + "ĠSloan": 30894, + "him": 30895, + "çļ": 30896, + "located": 30897, + "zantine": 30898, + "ĠSuccessful": 30899, + "eminal": 30900, + "ĠDimensional": 30901, + "ĠNSA": 30902, + "ĠLogistic": 30903, + "emetery": 30904, + "Ġbrak": 30905, + "antal": 30906, + "south": 30907, + "Ġprototypes": 30908, + "Ġadvised": 30909, + "Ġidealized": 30910, + "ophytic": 30911, + "nbsp": 30912, + "Binary": 30913, + "Hyp": 30914, + "Joh": 30915, + "polation": 30916, + "Ġpolyvinyl": 30917, + "estimated": 30918, + "Ġoxytocin": 30919, + "ĠLetter": 30920, + "ĠImpair": 30921, + "Ġenvelopes": 30922, + "mainly": 30923, + "Ġmys": 30924, + "Ġintras": 30925, + "Ġbiogenic": 30926, + "cysteine": 30927, + "Ġuric": 30928, + "ĠCyan": 30929, + "ryption": 30930, + "Ġphotoreceptor": 30931, + "ĠToxic": 30932, + "ĠGamm": 30933, + "Ġcontainment": 30934, + "IgG": 30935, + "Squ": 30936, + "Ġperfused": 30937, + "Ġbiosensors": 30938, + "Ġmagmatic": 30939, + "Rate": 30940, + "ĠTf": 30941, + "Ġsecrete": 30942, + "Ġcriticality": 30943, + "Ġcompositionally": 30944, + "ĠBruce": 30945, + "SZ": 30946, + "ĠSport": 30947, + "ĠEI": 30948, + "Ġdiseased": 30949, + "Ġpreschool": 30950, + "ĠHarvey": 30951, + "ĠPTH": 30952, + "Ġbilayers": 30953, + "ĠOscillations": 30954, + "ĠHonor": 30955, + "ĠCCN": 30956, + "ĠMOT": 30957, + "ĠLloyd": 30958, + "Ġtrapez": 30959, + "Ġbuds": 30960, + "OFFSET": 30961, + "Ġmacromolecules": 30962, + "Ġbilirubin": 30963, + "olly": 30964, + "Ġutilities": 30965, + "ministered": 30966, + "Ġglobe": 30967, + "OLOGY": 30968, + "ropods": 30969, + "ĠMDM": 30970, + "ĠPyObject": 30971, + "macroph": 30972, + "ĠPBMCs": 30973, + "ospheres": 30974, + "Ġcatastrophic": 30975, + "ĠNavigation": 30976, + "ĠLSD": 30977, + "Ġcream": 30978, + "Ġdereg": 30979, + "bonded": 30980, + "rents": 30981, + "Ġpotentiation": 30982, + "Ġstro": 30983, + "Ġsteeper": 30984, + "ulinum": 30985, + "Ġperiodontitis": 30986, + "arization": 30987, + "âĪª": 30988, + "amicin": 30989, + "Ġmagnetized": 30990, + "ĠNutritional": 30991, + "Ġaccord": 30992, + "gaard": 30993, + "FTIR": 30994, + "ramethyl": 30995, + "ĠGle": 30996, + "Mel": 30997, + "ĠCTL": 30998, + "Ġtranslating": 30999, + "Ġautoimmunity": 31000, + "olerant": 31001, + "triangleq": 31002, + "amo": 31003, + "Ġvel": 31004, + "ĠHCN": 31005, + "ĠHamming": 31006, + "ĠVenus": 31007, + "ĠGad": 31008, + "ĠOwing": 31009, + "Information": 31010, + "ĠSchemes": 31011, + "carotene": 31012, + "Its": 31013, + "anis": 31014, + "Ġreplay": 31015, + "Ġtouc": 31016, + "LECT": 31017, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 31018, + "Ġtabulated": 31019, + "ĠSchottky": 31020, + "Far": 31021, + "amation": 31022, + "ĠRies": 31023, + "Ġexpects": 31024, + "ĠInstability": 31025, + "Ġsons": 31026, + "Ġdeck": 31027, + "Ġïģ¥": 31028, + "ĠSignature": 31029, + "Ġlithosphere": 31030, + "WW": 31031, + "makers": 31032, + "ughters": 31033, + "Ġâİ¡": 31034, + "ardian": 31035, + "à¦": 31036, + "Ġaccepts": 31037, + "ĠOSA": 31038, + "Ġγδ": 31039, + "nonumber": 31040, + "Select": 31041, + "lite": 31042, + "ĠAqueous": 31043, + "agawa": 31044, + "ĠEdinburgh": 31045, + "ĠMembranes": 31046, + "ĠSIG": 31047, + "akia": 31048, + "Ġtestes": 31049, + "Ġheli": 31050, + "++++": 31051, + "Ġultrafast": 31052, + "Ġmaneuver": 31053, + "ĠDate": 31054, + "phin": 31055, + "ĠKad": 31056, + "Ġtransferase": 31057, + "Pers": 31058, + "Ġtones": 31059, + "ĠSGD": 31060, + "anto": 31061, + "ĠOrange": 31062, + "ĠGeography": 31063, + "ĠAccumulation": 31064, + "aty": 31065, + "Ġbeating": 31066, + "Ġoverlying": 31067, + "ĠNDVI": 31068, + "ĠTownship": 31069, + "jing": 31070, + "ĠNOS": 31071, + "player": 31072, + "ĠMDD": 31073, + "ĠHungarian": 31074, + "Ġdw": 31075, + "ĠHin": 31076, + "Ġvalidating": 31077, + "Ġcolorimetric": 31078, + "ĠSupersymmetric": 31079, + "FUNC": 31080, + "gically": 31081, + "ofuran": 31082, + "-------": 31083, + "Ġimping": 31084, + "similarity": 31085, + "ĠDOX": 31086, + "ĠGlo": 31087, + "ivirus": 31088, + "listed": 31089, + "Ġbusy": 31090, + "iprofloxacin": 31091, + "Ġanxi": 31092, + "Ġblunt": 31093, + "Ġprocedural": 31094, + "Ġunknowns": 31095, + "AdS": 31096, + "thickness": 31097, + "follows": 31098, + "closing": 31099, + "environmental": 31100, + "ĠFeeding": 31101, + "unami": 31102, + "ende": 31103, + "ipine": 31104, + "Ġimpacting": 31105, + "Ġpenetrating": 31106, + "ambia": 31107, + "ĠWavelet": 31108, + "Ġfilamentous": 31109, + "Ġleng": 31110, + "ĠSCA": 31111, + "ĠEther": 31112, + "metall": 31113, + "Ġfringe": 31114, + "ĠAdjust": 31115, + "usz": 31116, + "ĠRey": 31117, + "ĠBoyd": 31118, + "Ġburnout": 31119, + "Ġcook": 31120, + "Ġnowadays": 31121, + "ĠDispersion": 31122, + "ĠRodriguez": 31123, + "Factor": 31124, + "ĠOklahoma": 31125, + "Ġunital": 31126, + "Ġpredictability": 31127, + "Ġlithography": 31128, + "ès": 31129, + "Willi": 31130, + "unal": 31131, + "asting": 31132, + "correction": 31133, + "ĠDed": 31134, + "ĠSocio": 31135, + "ĠChapman": 31136, + "ĠEco": 31137, + "Ġoncogene": 31138, + "ĠDrive": 31139, + "Ġfunnel": 31140, + "uis": 31141, + "ĠGENER": 31142, + "ĠACR": 31143, + "Ġworkloads": 31144, + "Ġoctahedral": 31145, + "vich": 31146, + "enburg": 31147, + "Ġimproper": 31148, + "decoded": 31149, + "Ġimmunosorbent": 31150, + "Ġinhomogeneity": 31151, + "RK": 31152, + "onically": 31153, + "Ġglycoproteins": 31154, + "onics": 31155, + "ĠFok": 31156, + "ĠBras": 31157, + "ĠCalculus": 31158, + "ĠMoss": 31159, + "ĠRK": 31160, + "Ġviolet": 31161, + "Ġlymphomas": 31162, + "enspace": 31163, + "ĠPalae": 31164, + "Ġrenin": 31165, + "phant": 31166, + "ĠRED": 31167, + "Ġfaulty": 31168, + "Riemann": 31169, + "Ãī": 31170, + "ĠElli": 31171, + "Bol": 31172, + "Tn": 31173, + "Yang": 31174, + "gender": 31175, + "Ġdetuning": 31176, + "Ġoperon": 31177, + "Ġinsecticide": 31178, + "esi": 31179, + "amon": 31180, + "ĠSCD": 31181, + "ĠBath": 31182, + "ĠâĢĸ": 31183, + "ĠGeographic": 31184, + "Ġcyclohex": 31185, + "ĠConfidence": 31186, + "Ġcomet": 31187, + "Ġfolate": 31188, + "observer": 31189, + "Ġvisitors": 31190, + "extra": 31191, + "ateness": 31192, + "ĠSPT": 31193, + "arcane": 31194, + "Ġholistic": 31195, + "semi": 31196, + "ĠMild": 31197, + "Ġsmear": 31198, + "Ġcyclase": 31199, + "Ġanymore": 31200, + "Ġseagrass": 31201, + "Ġconsortium": 31202, + "Ġfinishes": 31203, + "cyan": 31204, + "ductance": 31205, + "frost": 31206, + "hereafter": 31207, + "Ġprescriptions": 31208, + "Ġcmd": 31209, + "ĠPerceived": 31210, + "coordinates": 31211, + "Ġstyl": 31212, + "ĠBard": 31213, + "ĠHoll": 31214, + "ĠsiRNAs": 31215, + "sugg": 31216, + "Ġthr": 31217, + "Ġmainland": 31218, + "SCH": 31219, + "Ġassertions": 31220, + "Ġbabies": 31221, + "Ġrecapit": 31222, + "Tok": 31223, + "Ġresected": 31224, + "construct": 31225, + "Ber": 31226, + "Ġcholine": 31227, + "Ġunitarity": 31228, + "Ġcatalyzes": 31229, + "detector": 31230, + "ĠSMB": 31231, + "tery": 31232, + "cluded": 31233, + "ĠAbbreviations": 31234, + "ĠOliveira": 31235, + "LOC": 31236, + "zin": 31237, + "ĠLorenz": 31238, + "Kernel": 31239, + "lyn": 31240, + "ĠLEP": 31241, + "soni": 31242, + "Ġseptum": 31243, + "TMS": 31244, + "Ġunmodified": 31245, + "borough": 31246, + "ĠAudio": 31247, + "Ġdollars": 31248, + "CMD": 31249, + "Ġnorthwestern": 31250, + "Ġpalmit": 31251, + "ragalactic": 31252, + "ĠMiz": 31253, + "FH": 31254, + "confidence": 31255, + "NEXT": 31256, + "ĠAGE": 31257, + "ĠEqn": 31258, + "ĠClasses": 31259, + "Ġmisleading": 31260, + "ĠPKA": 31261, + "Ġanchored": 31262, + "ĠRip": 31263, + "phag": 31264, + "Ġintubation": 31265, + "ĠAngular": 31266, + "ĠBEC": 31267, + "Thr": 31268, + "Ġorganisations": 31269, + "Ġcomfortable": 31270, + "Ġcommissioned": 31271, + "poll": 31272, + "ydia": 31273, + "instead": 31274, + "Ġpassword": 31275, + "Ġcompliant": 31276, + "ĠPrecipitation": 31277, + "ophosphamide": 31278, + "usters": 31279, + "Ġpneumococcal": 31280, + "Ġtomographic": 31281, + "tidae": 31282, + "ĠFirmicutes": 31283, + "bw": 31284, + "ĠPDB": 31285, + "ĠGPUs": 31286, + "ĠPlanar": 31287, + "Ġverbose": 31288, + "Summary": 31289, + "lance": 31290, + "ĠEGFP": 31291, + "ongru": 31292, + "Complex": 31293, + "ĠWheat": 31294, + "uche": 31295, + "ĠMCA": 31296, + "ĠProjection": 31297, + "Ġstats": 31298, + "Ġsummand": 31299, + "dimethoxyphenyl": 31300, + "ĠABSTRACT": 31301, + "Ġcarotenoid": 31302, + "Ġbroke": 31303, + "ĠDesigning": 31304, + "ĠHetero": 31305, + "ĠCarlsbad": 31306, + "Cov": 31307, + "ineral": 31308, + "Ġanalyte": 31309, + "ĠColeman": 31310, + "Ġeigenstate": 31311, + "ĠHolland": 31312, + "ERSION": 31313, + "ĠDak": 31314, + "ellers": 31315, + "ĠÃĺ": 31316, + "missing": 31317, + "deposited": 31318, + "ĠLincoln": 31319, + "anion": 31320, + "ĠSPEC": 31321, + "Ġfertilizer": 31322, + "ĠCPS": 31323, + "Ġcofactor": 31324, + "Ġtren": 31325, + "Ġcalendar": 31326, + "Ġyoungest": 31327, + "STATUS": 31328, + "ĠEXPERIMENTAL": 31329, + "Ġsr": 31330, + "Ġnl": 31331, + "ĠMES": 31332, + "Study": 31333, + "padding": 31334, + "Ġatopic": 31335, + "ĠOG": 31336, + "Ġentrainment": 31337, + "AFM": 31338, + "ĠCou": 31339, + "Web": 31340, + "ĠMicroscopic": 31341, + "Ġunambiguously": 31342, + "Day": 31343, + "yotrophic": 31344, + "reous": 31345, + "Ġsarcom": 31346, + "ĠVAL": 31347, + "Ġhindered": 31348, + "ĠREM": 31349, + "otrexate": 31350, + "ocarcin": 31351, + "ĠAlk": 31352, + "Ġbrevity": 31353, + "factual": 31354, + "Cer": 31355, + "diox": 31356, + "ophical": 31357, + "Ġlytic": 31358, + "Take": 31359, + "Ġintend": 31360, + "ĠCla": 31361, + "Ġasteroid": 31362, + "ĠSEP": 31363, + "apenem": 31364, + "universal": 31365, + "Ġoceans": 31366, + "Ġmonoid": 31367, + "Ġseparator": 31368, + "ĠPorous": 31369, + "Ġpostoperatively": 31370, + "Ġsemin": 31371, + "ĠDisplay": 31372, + "Ġhydrolase": 31373, + "transferases": 31374, + "Ġthrombus": 31375, + "ĠOv": 31376, + "ĠDielectric": 31377, + "Ġcompelling": 31378, + "assing": 31379, + "ĠMAS": 31380, + "ullary": 31381, + "ĠMori": 31382, + "ĠPathogenesis": 31383, + "ĠBreaking": 31384, + "ĠPLGA": 31385, + "cooling": 31386, + "§": 31387, + "Ġfee": 31388, + "Ġreducible": 31389, + "Ġdiverge": 31390, + "Ġqueues": 31391, + "Ġmushroom": 31392, + "Ġdeacetylase": 31393, + "YFP": 31394, + "Ġdisreg": 31395, + "ĠArrays": 31396, + "processes": 31397, + "ĠTransportation": 31398, + "Ġundetectable": 31399, + "bursts": 31400, + "Ġphospholipase": 31401, + "Option": 31402, + "asin": 31403, + "Ġnocturnal": 31404, + "tez": 31405, + "ĠDisruption": 31406, + "oserine": 31407, + "behavior": 31408, + "ĠTony": 31409, + "ĠKot": 31410, + "ieval": 31411, + "Ġmyofib": 31412, + "Ġhalogen": 31413, + "ĠCPR": 31414, + "ployed": 31415, + "ĠPolymers": 31416, + "Ġadenoma": 31417, + "Ġquartile": 31418, + "Ġquaternary": 31419, + "ĠIraq": 31420, + "Ġsieve": 31421, + "Ġintractable": 31422, + "Ġfabrics": 31423, + "continuum": 31424, + "ĠEmergence": 31425, + "Pot": 31426, + "itism": 31427, + "veness": 31428, + "hoe": 31429, + "Ġredes": 31430, + "ĠHRP": 31431, + "ploidy": 31432, + "picuous": 31433, + "ogo": 31434, + "ĠGag": 31435, + "Ġnominated": 31436, + "occupied": 31437, + "Ġquench": 31438, + "ropolis": 31439, + "nucleotide": 31440, + "ĠEventually": 31441, + "Ñı": 31442, + "ĠClock": 31443, + "ĠSteady": 31444, + "opolymers": 31445, + "ĠARE": 31446, + "irnov": 31447, + "helf": 31448, + "blob": 31449, + "download": 31450, + "PLL": 31451, + "UNT": 31452, + "predictions": 31453, + "Ġoccipital": 31454, + "toxic": 31455, + "ĠVice": 31456, + "Ġangio": 31457, + "CuO": 31458, + "Ġresistances": 31459, + "fflffl": 31460, + "Distribution": 31461, + "Gre": 31462, + "onamide": 31463, + "ĠIOP": 31464, + "UNEL": 31465, + "Ġaids": 31466, + "ĠHUV": 31467, + "ECM": 31468, + "ĠPAD": 31469, + "ĠAgNPs": 31470, + "Print": 31471, + "Ġlamellar": 31472, + "ĠUltrason": 31473, + "severe": 31474, + "ĠAnnotation": 31475, + "NIR": 31476, + "sgn": 31477, + "ĠOften": 31478, + "Ġiterate": 31479, + "Ġcarriage": 31480, + "spherical": 31481, + "ĠFrid": 31482, + "Ġdiffract": 31483, + "ĠBasal": 31484, + "Ġunsatisf": 31485, + "ĠDysfunction": 31486, + "arboxylic": 31487, + "ĠCollective": 31488, + "Ġdegrading": 31489, + "Ġadiposity": 31490, + "Ġfifty": 31491, + "Ġpars": 31492, + "ĠOptimized": 31493, + "ocaine": 31494, + "Ġbb": 31495, + "ĠShip": 31496, + "ĠLW": 31497, + "Ġtremor": 31498, + "Ġã": 31499, + "Ġnucleons": 31500, + "Ġscientist": 31501, + "ĠMish": 31502, + "gression": 31503, + "ĠMerc": 31504, + "ĠFlem": 31505, + "Ġcorals": 31506, + "Incre": 31507, + "ĠDSP": 31508, + "Ġdefenses": 31509, + "dimer": 31510, + "atherine": 31511, + "otubes": 31512, + "stride": 31513, + "ĠAlterations": 31514, + "Ġoest": 31515, + "ĠBIC": 31516, + "Ġradiated": 31517, + "Ġketamine": 31518, + "Ġdissimilarity": 31519, + "ĠAncient": 31520, + "ĠHed": 31521, + "Ġattr": 31522, + "ĠIsa": 31523, + "Ġionospheric": 31524, + "Ġgovernor": 31525, + "ĠEstimated": 31526, + "Ġultrathin": 31527, + "Update": 31528, + "Ġimmunoassay": 31529, + "Ġconjectured": 31530, + "ĠREF": 31531, + "ĠSiegel": 31532, + "Adv": 31533, + "Mem": 31534, + "Ġpups": 31535, + "ĠAPPL": 31536, + "ecomposable": 31537, + "journal": 31538, + "ĠRol": 31539, + "ĠLob": 31540, + "rington": 31541, + "Ġnonsingular": 31542, + "Ġcitric": 31543, + "iones": 31544, + "ositis": 31545, + "ALY": 31546, + "Ġmentions": 31547, + "ĠMarkers": 31548, + "algebraic": 31549, + "Ġflattened": 31550, + "Ġmail": 31551, + "ĠTGA": 31552, + "ĠPMA": 31553, + "ĠNaval": 31554, + "Ġfacilitation": 31555, + "Ġunidentified": 31556, + "Ġempathy": 31557, + "jectories": 31558, + "logits": 31559, + "Ġpermanently": 31560, + "Ġbottles": 31561, + "ĠBengal": 31562, + "Ġpeanut": 31563, + "Ġcapillaries": 31564, + "erents": 31565, + "ĠLooking": 31566, + "changes": 31567, + "ĠMagell": 31568, + "ĠCMC": 31569, + "ĠVerm": 31570, + "Ġsubscales": 31571, + "demand": 31572, + "orexia": 31573, + "Ġachievements": 31574, + "ĠRobustness": 31575, + "ĠWallace": 31576, + "ĠDTT": 31577, + "ogels": 31578, + "ocker": 31579, + "ĠSpike": 31580, + "Ġpainter": 31581, + "Ġbuses": 31582, + "Ġpolluted": 31583, + "Ġtort": 31584, + "ĠPPP": 31585, + "nex": 31586, + "extended": 31587, + "ucalypt": 31588, + "Ġprostatic": 31589, + "ĠFCC": 31590, + "Ġkick": 31591, + "oyal": 31592, + "epochs": 31593, + "hss": 31594, + "yon": 31595, + "Ġdans": 31596, + "ĠAw": 31597, + "Ġadversely": 31598, + "Ġaltogether": 31599, + "Ġophthalm": 31600, + "Ġcpu": 31601, + "ĠFRET": 31602, + "Ġforensic": 31603, + "Ġhotspots": 31604, + "Ġpaintings": 31605, + "Ġomn": 31606, + "ĠpS": 31607, + "oglu": 31608, + "ofol": 31609, + "FTs": 31610, + "Ġdermat": 31611, + "pragma": 31612, + "Ġbump": 31613, + "ĠCir": 31614, + "aS": 31615, + "Ġnaked": 31616, + "ĠNLS": 31617, + "ĠSpitzer": 31618, + "Ġsalvage": 31619, + "Ġintuitively": 31620, + "Ġcasual": 31621, + "Ġfired": 31622, + "verages": 31623, + "ĠBurden": 31624, + "Wang": 31625, + "ylem": 31626, + "Ġradiographs": 31627, + "ĠSchiff": 31628, + "OLUTION": 31629, + "Cross": 31630, + "Ġhints": 31631, + "owing": 31632, + "ĠStreng": 31633, + "ĠANY": 31634, + "Ġworry": 31635, + "ĠRoger": 31636, + "Ġtrabecular": 31637, + "Band": 31638, + "ĠNec": 31639, + "ipes": 31640, + "tool": 31641, + "ĠILC": 31642, + "iÄĩ": 31643, + "ocean": 31644, + "ĠAri": 31645, + "AMA": 31646, + "ĠVertex": 31647, + "activate": 31648, + "Location": 31649, + "onts": 31650, + "Ġhs": 31651, + "Ġslender": 31652, + "refring": 31653, + "ĠEndogenous": 31654, + "adiabatic": 31655, + "Ġcryptic": 31656, + "Ġeradication": 31657, + "ĠKevin": 31658, + "Ġmc": 31659, + "Ġcardio": 31660, + "Ġphosphoryl": 31661, + "Witten": 31662, + "Ġscl": 31663, + "ĠIw": 31664, + "ĠMade": 31665, + "Ġfounding": 31666, + "oflag": 31667, + "aline": 31668, + "horizontal": 31669, + "ĠGeneralization": 31670, + "psychiatric": 31671, + "ĠDuncan": 31672, + "ĠSnO": 31673, + "ĠAar": 31674, + "Ġgg": 31675, + "Ġpremi": 31676, + "ĠStrom": 31677, + "ĠExplan": 31678, + "Ġlethality": 31679, + "ÏĤ": 31680, + "odo": 31681, + "Ġsubscrib": 31682, + "ĠSTUDY": 31683, + "Ġoutperformed": 31684, + "Ġcovalently": 31685, + "MHC": 31686, + "fail": 31687, + "ĠKac": 31688, + "EGR": 31689, + "ĠTRI": 31690, + "robot": 31691, + "ĠCandidate": 31692, + "ĠTNBC": 31693, + "Ġarchaeological": 31694, + "Eukary": 31695, + "Ġlava": 31696, + "dipole": 31697, + "Ġuncons": 31698, + "Anti": 31699, + "Ġprednis": 31700, + "ĠRobin": 31701, + "Ġstratigraphic": 31702, + "Ġ¤": 31703, + "Ġfinance": 31704, + "ĠStudio": 31705, + "render": 31706, + "Ġrearing": 31707, + "Ġger": 31708, + "ĠOpt": 31709, + "ĠManifolds": 31710, + "Ġdestabil": 31711, + "Ġtelomerase": 31712, + "Ġpicking": 31713, + "Ġamplicon": 31714, + "Ġyearly": 31715, + "ĠNCC": 31716, + "inser": 31717, + "ĠEnrichment": 31718, + "ĠMicrostructure": 31719, + "ĠWarren": 31720, + "ophysics": 31721, + "Ġfifteen": 31722, + "Åij": 31723, + "Ġreviewer": 31724, + "Ġskilled": 31725, + "Ġmagnetoresistance": 31726, + "Ġreconfiguration": 31727, + "Ġpoet": 31728, + "Ġpredetermined": 31729, + "Ġcryopres": 31730, + "Ġattractors": 31731, + "Ġprojectile": 31732, + "ĠCrystals": 31733, + "ĠMCM": 31734, + "ĠXanth": 31735, + "Ġclockwise": 31736, + "regnant": 31737, + "Ġgated": 31738, + "ryza": 31739, + "ĠProsp": 31740, + "adin": 31741, + "Ġmolybdenum": 31742, + "ĠAlps": 31743, + "ĠBald": 31744, + "Ġhalluc": 31745, + "udo": 31746, + "Ġmont": 31747, + "ĠFlash": 31748, + "Ġpulling": 31749, + "ĠLQ": 31750, + "ĠWalsh": 31751, + "ĠThomson": 31752, + "meson": 31753, + "Ġintercal": 31754, + "Ġelapsed": 31755, + "FFFF": 31756, + "ĠForecasting": 31757, + "à¯": 31758, + "ĠLSP": 31759, + "endorf": 31760, + "Ġxml": 31761, + "substrate": 31762, + "Mu": 31763, + "during": 31764, + "oconstr": 31765, + "EMA": 31766, + "Ġïĥ«": 31767, + "ĠDFS": 31768, + "ĠVon": 31769, + "Ġfathers": 31770, + "Ġunco": 31771, + "ĠUnderg": 31772, + "Ġmultiplexing": 31773, + "atra": 31774, + "Ġcohesive": 31775, + "ĠUI": 31776, + "ĠPrev": 31777, + "çļĦ": 31778, + "cum": 31779, + "hf": 31780, + "ĠSCN": 31781, + "atalysis": 31782, + "ĠArsen": 31783, + "amping": 31784, + "ĠPlastic": 31785, + "ĠMadison": 31786, + "Ġsupremum": 31787, + "ĠCited": 31788, + "Ġaren": 31789, + "iski": 31790, + "inel": 31791, + "stro": 31792, + "Ġcorrupted": 31793, + "Ġglab": 31794, + "Ġcardiopulmonary": 31795, + "Ġpragmatic": 31796, + "CAG": 31797, + "Stack": 31798, + "thioxo": 31799, + "ĠReproductive": 31800, + "Ġsteatosis": 31801, + "Best": 31802, + "ĠBars": 31803, + "Ġracing": 31804, + "ĠUtah": 31805, + "equivalence": 31806, + "ĠFifty": 31807, + "ĠCytokine": 31808, + "Ġutilised": 31809, + "horizon": 31810, + "ouracil": 31811, + "iversary": 31812, + "emer": 31813, + "ĠQuestions": 31814, + "Ġlinkages": 31815, + "anchez": 31816, + "VV": 31817, + "Ġphotodet": 31818, + "kowski": 31819, + "REST": 31820, + "Ġhosting": 31821, + "Ġpushing": 31822, + "Ġneurotoxicity": 31823, + "SQ": 31824, + "rst": 31825, + "Ġhockey": 31826, + "Ġtrips": 31827, + "ĠIndoor": 31828, + "ematics": 31829, + "Ġtransect": 31830, + "ĠABI": 31831, + "agar": 31832, + "âĪļ": 31833, + "egenerate": 31834, + "ĠQP": 31835, + "MID": 31836, + "ĠAccept": 31837, + "ĠCyber": 31838, + "North": 31839, + "Ġdθ": 31840, + "alla": 31841, + "Ġbraid": 31842, + "finding": 31843, + "alin": 31844, + "ĠLST": 31845, + "ĠLax": 31846, + "udin": 31847, + "ĠiNOS": 31848, + "convert": 31849, + "ACA": 31850, + "ĠGuan": 31851, + "Ġlymphocytic": 31852, + "Ġsyllable": 31853, + "ĠTOR": 31854, + "ĠSCR": 31855, + "ĠAJ": 31856, + "Ġoutburst": 31857, + "bladder": 31858, + "OTA": 31859, + "audio": 31860, + "chromen": 31861, + "ÑģÑĤ": 31862, + "Ġgratefully": 31863, + "Ġtiling": 31864, + "Ġquit": 31865, + "shan": 31866, + "ĠAccretion": 31867, + "Ġnarrowing": 31868, + "ĠInduces": 31869, + "Mic": 31870, + "Ġfuc": 31871, + "Ġthalamus": 31872, + "ANES": 31873, + "Ġquaternion": 31874, + "ĠListeria": 31875, + "duality": 31876, + "hend": 31877, + "ande": 31878, + "Ġparo": 31879, + "Ġinspected": 31880, + "question": 31881, + "ĠHoney": 31882, + "Ġchunks": 31883, + "Ġforearm": 31884, + "radients": 31885, + "ificantly": 31886, + "obank": 31887, + "Ġsomewhere": 31888, + "Ġmonetary": 31889, + "ĠLouisiana": 31890, + "Ġemulsions": 31891, + "Ġprogrammable": 31892, + "Ġmanifests": 31893, + "ĠMartinez": 31894, + "Ġted": 31895, + "emen": 31896, + "anni": 31897, + "Ġoverlaid": 31898, + "Ġvirulent": 31899, + "Mask": 31900, + "ĠUtility": 31901, + "Ġwk": 31902, + "osexual": 31903, + "ĠEarl": 31904, + "dar": 31905, + "hdr": 31906, + "ractors": 31907, + "Ġconstructor": 31908, + "Ġnascent": 31909, + "inzburg": 31910, + "ĠCraig": 31911, + "Ġplexus": 31912, + "reverse": 31913, + "ograv": 31914, + "tags": 31915, + "Ġcalibrate": 31916, + "à®": 31917, + "Ġhide": 31918, + "ĠFol": 31919, + "Ġinteracted": 31920, + "Ġconfron": 31921, + "market": 31922, + "Ġsociodemographic": 31923, + "ĠLucas": 31924, + "ĠMCT": 31925, + "ĠRSS": 31926, + "Ġmicroplate": 31927, + "underst": 31928, + "Ital": 31929, + "ĠCMR": 31930, + "recy": 31931, + "ĠPCOS": 31932, + "Ġdetoxification": 31933, + "Ġsubtree": 31934, + "Ġsubsections": 31935, + "Ġpropositions": 31936, + "Acknowledgements": 31937, + "reinforced": 31938, + "lis": 31939, + "ĠCIR": 31940, + "Ġimprinted": 31941, + "vium": 31942, + "afic": 31943, + "Ġchecklist": 31944, + "ĠRx": 31945, + "ĠEph": 31946, + "Ġsolder": 31947, + "transformation": 31948, + "ĠStrait": 31949, + "azar": 31950, + "Ġhandler": 31951, + "kelet": 31952, + "BCL": 31953, + "Math": 31954, + "Ġwishes": 31955, + "uminescent": 31956, + "ĠPEC": 31957, + "irt": 31958, + "ylidene": 31959, + "Ġloosely": 31960, + "naissance": 31961, + "ILs": 31962, + "foil": 31963, + "ĠGNU": 31964, + "ĠKet": 31965, + "vix": 31966, + "ĠPlain": 31967, + "ĠRES": 31968, + "Ġparenting": 31969, + "ĠConnection": 31970, + "Ġrhizosphere": 31971, + "oprevalence": 31972, + "iatic": 31973, + "ĠpA": 31974, + "ĠVil": 31975, + "setting": 31976, + "ĠReLU": 31977, + "ĠBOOST": 31978, + "Ġappreciate": 31979, + "bx": 31980, + "orest": 31981, + "ologie": 31982, + "Ġpalp": 31983, + "foo": 31984, + "usual": 31985, + "Ġquestioned": 31986, + "Ġtrigon": 31987, + "ĠGFAP": 31988, + "ĠKyoto": 31989, + "dise": 31990, + "antile": 31991, + "ück": 31992, + "ĠQuantization": 31993, + "Ġscler": 31994, + "Ġbehalf": 31995, + "ĠDuality": 31996, + "Ġmagnetically": 31997, + "Ġelegant": 31998, + "UA": 31999, + "epis": 32000, + "Ġsubclinical": 32001, + "ontrol": 32002, + "ĠChemicals": 32003, + "Utils": 32004, + "Ġlowers": 32005, + "extraction": 32006, + "Ġamplifiers": 32007, + "ĠEntry": 32008, + "ĠWORK": 32009, + "Ġthrombocytopenia": 32010, + "Mil": 32011, + "idus": 32012, + "embry": 32013, + "manager": 32014, + "ĠCoordination": 32015, + "ĠPhenotypic": 32016, + "chunk": 32017, + "Ġhypotension": 32018, + "Ġcryogenic": 32019, + "Ġreactants": 32020, + "ĠMMSE": 32021, + "Ġcentros": 32022, + "ĠButler": 32023, + "Ġcavitation": 32024, + "ĠLessons": 32025, + "estion": 32026, + "ĠMIS": 32027, + "associ": 32028, + "APE": 32029, + "ĠEulerian": 32030, + "Ġrecreational": 32031, + "ĠNeo": 32032, + "ĠCDM": 32033, + "repeat": 32034, + "details": 32035, + "Bal": 32036, + "STA": 32037, + "Ġâīº": 32038, + "ĠCamero": 32039, + "ĠTelevision": 32040, + "Ġworkforce": 32041, + "Ġcomputerized": 32042, + "Ġextraordinary": 32043, + "Ġribonucle": 32044, + "Ġhydrophobicity": 32045, + "ĠFeasibility": 32046, + "Ol": 32047, + "Tw": 32048, + "ĠMam": 32049, + "ĠFAC": 32050, + "profit": 32051, + "negligible": 32052, + "ĠFruit": 32053, + "Ġears": 32054, + "Ġshearing": 32055, + "ĠCorresponding": 32056, + "fun": 32057, + "ieck": 32058, + "mos": 32059, + "ĠEMI": 32060, + "ĠSometimes": 32061, + "Ġfluorine": 32062, + "Ġdetergent": 32063, + "Ġalg": 32064, + "races": 32065, + "ivable": 32066, + "COMM": 32067, + "ĠSwitch": 32068, + "Ġstrained": 32069, + "virtual": 32070, + "Temperature": 32071, + "Ġcredible": 32072, + "ĠGPCR": 32073, + "ĠDebye": 32074, + "ĠLit": 32075, + "Ġhemic": 32076, + "Ġtransducers": 32077, + "metast": 32078, + "adiene": 32079, + "Ġoryzae": 32080, + "tn": 32081, + "Ġafternoon": 32082, + "ĠArabian": 32083, + "ĠChromatin": 32084, + "Ġxenografts": 32085, + "Ġcryptographic": 32086, + "Ġaxillary": 32087, + "Ġvolunteer": 32088, + "ĠNevada": 32089, + "Ġpions": 32090, + "unknown": 32091, + "ĠFU": 32092, + "venously": 32093, + "radio": 32094, + "ĠLabour": 32095, + "ĠVillage": 32096, + "Ric": 32097, + "Ġmetat": 32098, + "Ġserotypes": 32099, + "regression": 32100, + "saturation": 32101, + "rera": 32102, + "Ġfarther": 32103, + "Ġrounding": 32104, + "Ġlibitum": 32105, + "Ġshuff": 32106, + "ĠOw": 32107, + "Ġlocalised": 32108, + "ĠALG": 32109, + "Ġhypertrophic": 32110, + "ppm": 32111, + "imine": 32112, + "ĠAthe": 32113, + "Ġanhydro": 32114, + "Ġsupramolecular": 32115, + "Ġmacros": 32116, + "aceted": 32117, + "ĠOliv": 32118, + "Ġmotivational": 32119, + "ĠCave": 32120, + "enzie": 32121, + "Ġaffiliated": 32122, + "Fermi": 32123, + "Ġequalities": 32124, + "ĠMilan": 32125, + "Ġdressed": 32126, + "Ġanger": 32127, + "ados": 32128, + "Ġavg": 32129, + "ĠPhon": 32130, + "Ġradioactivity": 32131, + "ĠEch": 32132, + "Ġorganoids": 32133, + "Ġïģ§": 32134, + "ĠAnthrop": 32135, + "lateral": 32136, + "Ġalpine": 32137, + "Ġaudit": 32138, + "WER": 32139, + "ĠCSC": 32140, + "Ġrankings": 32141, + "ĠERR": 32142, + "GLER": 32143, + "Obviously": 32144, + "ĠMadrid": 32145, + "obenzene": 32146, + "othermia": 32147, + "Ġresponsibilities": 32148, + "omestic": 32149, + "ĠInflation": 32150, + "Ġepidemics": 32151, + "Ġtaut": 32152, + "phos": 32153, + "ĠUnless": 32154, + "Ġgeomagnetic": 32155, + "ĠCFTR": 32156, + "veld": 32157, + "arietal": 32158, + "Ġendotoxin": 32159, + "ADP": 32160, + "Ġsuppressive": 32161, + "randial": 32162, + "Ġïĥ©": 32163, + "excited": 32164, + "ĠInnate": 32165, + "ĠLópez": 32166, + "omycetes": 32167, + "Ġbeautiful": 32168, + "irk": 32169, + "ĠHwang": 32170, + "ĠUSE": 32171, + "ÏĢi": 32172, + "Record": 32173, + "Attribute": 32174, + "Ġreacts": 32175, + "ĠBund": 32176, + "Ġcowork": 32177, + "Ġconfluence": 32178, + "ĠRegardless": 32179, + "Ġmetagenomic": 32180, + "MAL": 32181, + "Ġaided": 32182, + "anga": 32183, + "Ġamn": 32184, + "ĠICI": 32185, + "ĠPML": 32186, + "Ġdelivers": 32187, + "Ġkeyp": 32188, + "Ġbeetles": 32189, + "Ġoxidant": 32190, + "Immun": 32191, + "Ġrhythmic": 32192, + "female": 32193, + "JC": 32194, + "PAD": 32195, + "genitor": 32196, + "AMS": 32197, + "catalytic": 32198, + "ĠMom": 32199, + "ĠHert": 32200, + "adish": 32201, + "Ġcontention": 32202, + "Ġyolk": 32203, + "Ġdemyel": 32204, + "Ġsucc": 32205, + "Ġtravels": 32206, + "Ve": 32207, + "ĠFul": 32208, + "ĠRif": 32209, + "Ġintrons": 32210, + "encaps": 32211, + "colour": 32212, + "Ġhotel": 32213, + "Access": 32214, + "adoop": 32215, + "Ġcoalition": 32216, + "ĠMuh": 32217, + "ĠLTP": 32218, + "autom": 32219, + "ĠLak": 32220, + "Ġremedi": 32221, + "Ġtrailing": 32222, + "insulator": 32223, + "ĠRelig": 32224, + "ĠHudson": 32225, + "emics": 32226, + "OAc": 32227, + "ourt": 32228, + "Ġrelic": 32229, + "ĠMixture": 32230, + "Ġcalorimeter": 32231, + "ĠRDF": 32232, + "ĠHodgkin": 32233, + "Newtonian": 32234, + "ĠDelayed": 32235, + "ĠNortheast": 32236, + "hering": 32237, + "Ġhelices": 32238, + "Ġprincipally": 32239, + "Ġsuspicion": 32240, + "Ġextremities": 32241, + "Ġdeadline": 32242, + "ĠEnterococcus": 32243, + "mj": 32244, + "Ġhp": 32245, + "ĠNAS": 32246, + "ouss": 32247, + "Ġintramuscular": 32248, + "LIN": 32249, + "Ġchicks": 32250, + "Score": 32251, + "Ġfür": 32252, + "ĠRSA": 32253, + "Ġkr": 32254, + "Ġphotography": 32255, + "Ġclearing": 32256, + "holomorphic": 32257, + "them": 32258, + "Ġpom": 32259, + "ĠLis": 32260, + "Ġdiscard": 32261, + "Ġguan": 32262, + "cx": 32263, + "ubov": 32264, + "ĠConsistency": 32265, + "Ġplei": 32266, + "ĠUrinary": 32267, + "Ġbreadth": 32268, + "EI": 32269, + "mechan": 32270, + "Ġdq": 32271, + "ĠBlast": 32272, + "coeff": 32273, + "ILD": 32274, + "Ġunemployment": 32275, + "Arm": 32276, + "ĠCn": 32277, + "moderate": 32278, + "Ġaggress": 32279, + "Ġcircumf": 32280, + "los": 32281, + "Ġbaro": 32282, + "velope": 32283, + "Ġulcerative": 32284, + "Ġhelicase": 32285, + "HW": 32286, + "KG": 32287, + "rion": 32288, + "Ġgenotyped": 32289, + "Ġarid": 32290, + "ĠAndreas": 32291, + "Ġthereof": 32292, + "ĠOperating": 32293, + "ĠNEW": 32294, + "ĠAntibacterial": 32295, + "ĠDarwin": 32296, + "Ġreferee": 32297, + "Ġdome": 32298, + "agus": 32299, + "ĠDMD": 32300, + "ATOR": 32301, + "Currently": 32302, + "ĠInequalities": 32303, + "dN": 32304, + "olymer": 32305, + "empirical": 32306, + "ĠBraun": 32307, + "FIN": 32308, + "ĠOber": 32309, + "prone": 32310, + "Ġdiminish": 32311, + "ĠGraduate": 32312, + "ĠTSH": 32313, + "ĠHsu": 32314, + "oidosis": 32315, + "Ġepidural": 32316, + "Ġreinforcing": 32317, + "Ġtheatre": 32318, + "Ġvib": 32319, + "ĠHob": 32320, + "collection": 32321, + "MANGLER": 32322, + "ĠHecke": 32323, + "Ġtruck": 32324, + "Ġmotivates": 32325, + "ĠVOC": 32326, + "Ġunbound": 32327, + "ramid": 32328, + "iously": 32329, + "ĠFernández": 32330, + "ĠFacial": 32331, + "oxazol": 32332, + "Ġtreadm": 32333, + "ĠResid": 32334, + "Loader": 32335, + "ĠRunning": 32336, + "otinib": 32337, + "PAC": 32338, + "VII": 32339, + "iu": 32340, + "Ġcite": 32341, + "ĠHockey": 32342, + "ESC": 32343, + "rhoea": 32344, + "Ġmacaques": 32345, + "Ġmediast": 32346, + "atim": 32347, + "ĠTMP": 32348, + "ĠAGB": 32349, + "ĠRup": 32350, + "uga": 32351, + "Ġassurance": 32352, + "pay": 32353, + "energies": 32354, + "ĠKend": 32355, + "tillery": 32356, + "Ġanesthetic": 32357, + "Window": 32358, + "Ġbeverages": 32359, + "aguchi": 32360, + "ĠFLT": 32361, + "ĠBounded": 32362, + "ĠPolymerase": 32363, + "Sam": 32364, + "ĠOrbit": 32365, + "Ġseasonality": 32366, + "Ġtachycardia": 32367, + "esteem": 32368, + "ĠPerfect": 32369, + "SEC": 32370, + "later": 32371, + "tale": 32372, + "ĠFormally": 32373, + "LG": 32374, + "zyn": 32375, + "Ġmicroalgae": 32376, + "Ġindium": 32377, + "erennial": 32378, + "ĠIPT": 32379, + "Ġkj": 32380, + "ĠPDA": 32381, + "Ġassimil": 32382, + "wheel": 32383, + "ĠSOS": 32384, + "ĠPFC": 32385, + "Ġdecoded": 32386, + "ATS": 32387, + "Ġsocietal": 32388, + "Ġdiffeomorphisms": 32389, + "Ġtraverse": 32390, + "Ġcollateral": 32391, + "gives": 32392, + "ĠCEN": 32393, + "Ġrand": 32394, + "Ġherself": 32395, + "Ġpayments": 32396, + "Ġpsi": 32397, + "âIJ£": 32398, + "ĠGromov": 32399, + "Ġaccidental": 32400, + "ĠReality": 32401, + "Ġlogistics": 32402, + "Ġrobustly": 32403, + "ĠSarah": 32404, + "NU": 32405, + "dates": 32406, + "ĠCUR": 32407, + "ĠDream": 32408, + "Ġdegrades": 32409, + "ĠGEO": 32410, + "Ġbutterfly": 32411, + "Ġpendulum": 32412, + "qa": 32413, + "Ġaspartate": 32414, + "pseudo": 32415, + "Ġallosteric": 32416, + "derr": 32417, + "ĠQoL": 32418, + "Agilent": 32419, + "ĠHardware": 32420, + "ĠCumulative": 32421, + "Ġpn": 32422, + "quantitative": 32423, + "Ġappraisal": 32424, + "Ġpolyacrylamide": 32425, + "Ġmildly": 32426, + "Ġcontraceptive": 32427, + "ĠPublished": 32428, + "Ġuplift": 32429, + "beh": 32430, + "Ġadaptor": 32431, + "ĠEqual": 32432, + "thienyl": 32433, + "atched": 32434, + "Ġreply": 32435, + "Ġupwards": 32436, + "Ġautopsy": 32437, + "simulation": 32438, + "Ġgranite": 32439, + "Ġpelvis": 32440, + "Ġhatching": 32441, + "ĠSPS": 32442, + "ĠGEM": 32443, + "illiard": 32444, + "ĠRetrospective": 32445, + "ĠEarthqu": 32446, + "ĠInvestigations": 32447, + "ĠMerck": 32448, + "Ġcholangi": 32449, + "Ġinfiltrating": 32450, + "Ġoverestimated": 32451, + "focused": 32452, + "Amin": 32453, + "Ġpreeclampsia": 32454, + "ospatial": 32455, + "ĠTRAIL": 32456, + "Pair": 32457, + "Ġsubmarine": 32458, + "Ġproteolysis": 32459, + "Ġcomplements": 32460, + "ĠKirch": 32461, + "Ġcentrom": 32462, + "Ġnap": 32463, + "ĠWear": 32464, + "Ġpunishment": 32465, + "Ġautoregressive": 32466, + "Ġcomposer": 32467, + "ĠEngel": 32468, + "Ġanaemia": 32469, + "ĠKronecker": 32470, + "ĠDid": 32471, + "ĠCarp": 32472, + "peer": 32473, + "Ġbugs": 32474, + "ĠIslamic": 32475, + "ithromycin": 32476, + "Ġconsec": 32477, + "Ġfamiliarity": 32478, + "etaxel": 32479, + "Ġintensively": 32480, + "ĠUpt": 32481, + "Ġindica": 32482, + "ADA": 32483, + "ĠChebyshev": 32484, + "Ġhierarchies": 32485, + "Ġworthwhile": 32486, + "Ġburned": 32487, + "ĠHMGB": 32488, + "Ġpolygonal": 32489, + "brile": 32490, + "Ġzoon": 32491, + "warning": 32492, + "Eukaryota": 32493, + "dA": 32494, + "ĠRepeated": 32495, + "ĠCastro": 32496, + "Ġmetropolitan": 32497, + "ontinuous": 32498, + "ĠBarnes": 32499, + "ĠPostoperative": 32500, + "Ġcytology": 32501, + "Ġspotted": 32502, + "versity": 32503, + "affine": 32504, + "sorted": 32505, + "ĠProto": 32506, + "ĠDescriptive": 32507, + "Ġhitting": 32508, + "Ġanalogously": 32509, + "feedback": 32510, + "Ġspiritual": 32511, + "ĠLINE": 32512, + "ressin": 32513, + "ophthal": 32514, + "Ġpolyunsaturated": 32515, + "Ġpiper": 32516, + "observations": 32517, + "ĭ¤": 32518, + "irre": 32519, + "ĠWNT": 32520, + "Ġundifferentiated": 32521, + "erald": 32522, + "ĠCTC": 32523, + "Ġhomomorphisms": 32524, + "ĠNeonatal": 32525, + "Fin": 32526, + "rozen": 32527, + "ĠLux": 32528, + "Ġmodifier": 32529, + "ĠKA": 32530, + "osaur": 32531, + "Ġinterventional": 32532, + "ĠHapl": 32533, + "Ġluminance": 32534, + "Ġunfortunately": 32535, + "Ġsleeping": 32536, + "Ġcitrus": 32537, + "resonance": 32538, + "Ġmoss": 32539, + "ulay": 32540, + "ĠPenn": 32541, + "administration": 32542, + "ĠNGF": 32543, + "Ġsecured": 32544, + "ĠAEs": 32545, + "ĠPWM": 32546, + "occo": 32547, + "obuf": 32548, + "Ġphotocurrent": 32549, + "ĠScilabDouble": 32550, + "April": 32551, + "Ġforamin": 32552, + "Ġparalysis": 32553, + "ĠQuark": 32554, + "eqref": 32555, + "ĠBrooks": 32556, + "ĠCollision": 32557, + "War": 32558, + "Ġig": 32559, + "amylase": 32560, + "istered": 32561, + "Ġretraction": 32562, + "ĠMultiplex": 32563, + "ĠMao": 32564, + "Common": 32565, + "ĠEconomics": 32566, + "ĠCriterion": 32567, + "ĠCCC": 32568, + "ĠLei": 32569, + "Ġorthorhombic": 32570, + "Ġaliquots": 32571, + "Ġstric": 32572, + "ĠLenn": 32573, + "Ġdisclosure": 32574, + "ameth": 32575, + "Ġnormalisation": 32576, + "Ġphylogen": 32577, + "ĠQTLs": 32578, + "ĠVersus": 32579, + "ĠUtilization": 32580, + "yne": 32581, + "unted": 32582, + "ĠDuff": 32583, + "ĠGJ": 32584, + "Ġoptimised": 32585, + "iformis": 32586, + "ĠIncreases": 32587, + "ĠFDG": 32588, + "ĠBattery": 32589, + "Phe": 32590, + "ĠCCS": 32591, + "Ġchrys": 32592, + "ofen": 32593, + "Ġmulticomponent": 32594, + "discussed": 32595, + "bonding": 32596, + "oretically": 32597, + "ĠAlliance": 32598, + "Ġheadquarters": 32599, + "ĠGlasgow": 32600, + "Ġbout": 32601, + "Ġeighth": 32602, + "Ġincurred": 32603, + "ĠBarry": 32604, + "Ġquadric": 32605, + "Ġduties": 32606, + "Ġmindfulness": 32607, + "rastructural": 32608, + "Train": 32609, + "shitz": 32610, + "CDC": 32611, + "Ġdyslipidemia": 32612, + "Ġalleged": 32613, + "Ġbronze": 32614, + "Ġattainment": 32615, + "QD": 32616, + "rombin": 32617, + "Ġapolipoprotein": 32618, + "owned": 32619, + "Ġgeographically": 32620, + "working": 32621, + "ĠBlind": 32622, + "Ġdonation": 32623, + "ĠSerge": 32624, + "Ġspreads": 32625, + "ĠHeterogeneity": 32626, + "ĠFré": 32627, + "Ġdefer": 32628, + "Ġlifts": 32629, + "EGFR": 32630, + "ĠPortland": 32631, + "Ġbrothers": 32632, + "ĠTrypanosoma": 32633, + "inian": 32634, + "Ġpressed": 32635, + "Ġtransduced": 32636, + "Ġpolyn": 32637, + "Ġlisteners": 32638, + "boards": 32639, + "ĠSustainable": 32640, + "alan": 32641, + "ĠSullivan": 32642, + "Assumption": 32643, + "often": 32644, + "jp": 32645, + "orative": 32646, + "plers": 32647, + "Ġmodularity": 32648, + "ĠHermite": 32649, + "Ġhydroxyapatite": 32650, + "ĠHirsch": 32651, + "Determ": 32652, + "facing": 32653, + "irradiated": 32654, + "Ġharsh": 32655, + "Ġtolerate": 32656, + "ĠTrap": 32657, + "ĠAware": 32658, + "otax": 32659, + "ATING": 32660, + "Ġhistopathology": 32661, + "ĠIsraeli": 32662, + "clockwise": 32663, + "zig": 32664, + "ĠJC": 32665, + "ĠQuick": 32666, + "ĠSLAM": 32667, + "Ġfox": 32668, + "ĠRav": 32669, + "generating": 32670, + "Ġhematoxylin": 32671, + "yltransferase": 32672, + "Ġcorroborated": 32673, + "FDR": 32674, + "oard": 32675, + "Ġequid": 32676, + "Ġ»": 32677, + "Ġneuropsychological": 32678, + "Ġbreakup": 32679, + "Ġemphasizing": 32680, + "Ġemissivity": 32681, + "blocking": 32682, + "Ġparall": 32683, + "Ġtilting": 32684, + "Ġpeng": 32685, + "ĠScan": 32686, + "Ġionosphere": 32687, + "Ġmount": 32688, + "forest": 32689, + "Ġcallus": 32690, + "αβ": 32691, + "ĠChristmas": 32692, + "ĠMagazine": 32693, + "evaluate": 32694, + "ĠPag": 32695, + "ĠBeat": 32696, + "Ġaccumulates": 32697, + "Ġcrowding": 32698, + "unneling": 32699, + "ĠÑ": 32700, + "ĠACP": 32701, + "geometry": 32702, + "MPT": 32703, + "Ġpharmacists": 32704, + "Ġpullback": 32705, + "Ġductility": 32706, + "Supervised": 32707, + "Ġlymphoblastic": 32708, + "pea": 32709, + "typical": 32710, + "broken": 32711, + "Fc": 32712, + "Ġlining": 32713, + "ĠDum": 32714, + "Ġmultiples": 32715, + "ów": 32716, + "Ġmerits": 32717, + "Ġextinct": 32718, + "ĠNursing": 32719, + "ĠExploiting": 32720, + "ĠBhattach": 32721, + "July": 32722, + "tze": 32723, + "thromb": 32724, + "teenth": 32725, + "Ġtoxicities": 32726, + "Ġdenitrification": 32727, + "Ġexposition": 32728, + "Ġimperf": 32729, + "Ġsurname": 32730, + "pointer": 32731, + "ĠErn": 32732, + "ĠAbundance": 32733, + "ĠDunn": 32734, + "ophora": 32735, + "Ġtoolkit": 32736, + "Load": 32737, + "ĠDerivation": 32738, + "could": 32739, + "ĠCaspase": 32740, + "ĠSprague": 32741, + "ĠTrp": 32742, + "Ġbrightest": 32743, + "illard": 32744, + "Ġinterdisciplinary": 32745, + "Ġquarant": 32746, + "Ġhypersurfaces": 32747, + "eliac": 32748, + "ĠALMA": 32749, + "Ġacrylic": 32750, + "Ġgentle": 32751, + "Deep": 32752, + "ĠPandemic": 32753, + "Ġinfeasible": 32754, + "Ġradiol": 32755, + "ABP": 32756, + "Ġmesenteric": 32757, + "ylinder": 32758, + "packed": 32759, + "Ġsomatosensory": 32760, + "Ġpave": 32761, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 32762, + "Ġpharmacology": 32763, + "Ġtanh": 32764, + "ĠMtb": 32765, + "Ġchimpan": 32766, + "Ġautophagic": 32767, + "Ġwithdrawn": 32768, + "ĠMCC": 32769, + "ZF": 32770, + "ĠSpl": 32771, + "ĠLau": 32772, + "Ġbiologic": 32773, + "electrons": 32774, + "Ġunderestimation": 32775, + "Ġcharacterise": 32776, + "circular": 32777, + "ĠTHEORY": 32778, + "Brown": 32779, + "FBS": 32780, + "Jo": 32781, + "dG": 32782, + "mars": 32783, + "articular": 32784, + "ĠPren": 32785, + "ĠMSA": 32786, + "ĠItem": 32787, + "Ġsemidefinite": 32788, + "ĠGibson": 32789, + "Ġtourism": 32790, + "ĠKok": 32791, + "Ġexposing": 32792, + "Ġintravenously": 32793, + "driver": 32794, + "ĠFortunately": 32795, + "ĠSach": 32796, + "Ġcontaminant": 32797, + "Ġabrog": 32798, + "ĠEmotional": 32799, + "VALUE": 32800, + "dispersion": 32801, + "Jacobi": 32802, + "ĠImperial": 32803, + "Ion": 32804, + "Lin": 32805, + "fidelity": 32806, + "ĠBirds": 32807, + "ĠConcurrent": 32808, + "matism": 32809, + "coal": 32810, + "Ġtq": 32811, + "ĠMnO": 32812, + "Ġfossils": 32813, + "Ġtender": 32814, + "Ġrhesus": 32815, + "Ġbloom": 32816, + "abdominal": 32817, + "Ġscalp": 32818, + "Ġhomeostatic": 32819, + "ĠHunt": 32820, + "ĠPharmacokine": 32821, + "brown": 32822, + "ĠHYP": 32823, + "Ġdissociated": 32824, + "ĠSoccer": 32825, + "ĠInequality": 32826, + "maker": 32827, + "Ġshade": 32828, + "ĠZur": 32829, + "observation": 32830, + "altered": 32831, + "UU": 32832, + "Ġtheor": 32833, + "epit": 32834, + "Ġphylum": 32835, + "Ġvigorous": 32836, + "ĠACM": 32837, + "Ġmethotrexate": 32838, + "demographic": 32839, + "Ġsingly": 32840, + "ĠPhysiology": 32841, + "Ġremodelling": 32842, + "ĠKrist": 32843, + "ropies": 32844, + "flows": 32845, + "hardness": 32846, + "ighteen": 32847, + "breve": 32848, + "ĠRetinal": 32849, + "Ġscintill": 32850, + "Ġutterance": 32851, + "Ġmonolithic": 32852, + "ĠVlad": 32853, + "ĠLMC": 32854, + "ipt": 32855, + "arrows": 32856, + "ĠPublishing": 32857, + "ĠStreptomyces": 32858, + "fal": 32859, + "Ġtroposphere": 32860, + "Ben": 32861, + "candid": 32862, + "ĠSic": 32863, + "timore": 32864, + "Len": 32865, + "inen": 32866, + "ampered": 32867, + "ĠMonth": 32868, + "Ġopponent": 32869, + "August": 32870, + "Ġstaggered": 32871, + "centre": 32872, + "expect": 32873, + "Ġreddening": 32874, + "ĠTl": 32875, + "hibition": 32876, + "Ġmicroparticles": 32877, + "ĠIntrac": 32878, + "ĠInitialize": 32879, + "Ġdictated": 32880, + "Dig": 32881, + "äº": 32882, + "healing": 32883, + "ĠdV": 32884, + "Ġappetite": 32885, + "Ġunusually": 32886, + "ĠAstronomy": 32887, + "Ġware": 32888, + "Ġovercoming": 32889, + "Ġcolliders": 32890, + "ĠUSING": 32891, + "ocarditis": 32892, + "Pick": 32893, + "Ġdub": 32894, + "ĠJason": 32895, + "ĠEditor": 32896, + "ê³": 32897, + "Ġlags": 32898, + "Ġcls": 32899, + "Ġsurgically": 32900, + "ĠPVC": 32901, + "particularly": 32902, + "Ġredist": 32903, + "Ġlogics": 32904, + "skii": 32905, + "ĠDVD": 32906, + "Ġcomply": 32907, + "azi": 32908, + "ĠInteracts": 32909, + "boolean": 32910, + "ĠERP": 32911, + "ĠErr": 32912, + "otranspiration": 32913, + "ĠPérez": 32914, + "Asp": 32915, + "amiliar": 32916, + "ĠFetal": 32917, + "Ġdeclaration": 32918, + "kinson": 32919, + "tube": 32920, + "Ġphysiologically": 32921, + "cue": 32922, + "ĠEri": 32923, + "Ġenvision": 32924, + "external": 32925, + "intermediate": 32926, + "Ġshopping": 32927, + "ĠFras": 32928, + "ĠHaj": 32929, + "ĠAlger": 32930, + "Ġanthropometric": 32931, + "Ġcancelled": 32932, + "HPV": 32933, + "kers": 32934, + "afa": 32935, + "Ġvulnerabilities": 32936, + "electrolyte": 32937, + "ĠGonzalez": 32938, + "íķĺ": 32939, + "qv": 32940, + "Ġdeaf": 32941, + "Ġbutyrate": 32942, + "ĠCoefficient": 32943, + "Ġstarburst": 32944, + "Ġpolymorph": 32945, + "ĠERA": 32946, + "ĠMaximal": 32947, + "ĠMueller": 32948, + "Ġabsorbers": 32949, + "Ġarab": 32950, + "retions": 32951, + "Ġnebula": 32952, + "Ġmines": 32953, + "ен": 32954, + "%%%%%%%%%%%%%%%%": 32955, + "Ġbandpass": 32956, + "Ġpolyurethane": 32957, + "ReLU": 32958, + "ĠFerro": 32959, + "picillin": 32960, + "CAD": 32961, + "Ty": 32962, + "ĠPCD": 32963, + "ĠBAC": 32964, + "Ġplanktonic": 32965, + "Fer": 32966, + "Ġcricket": 32967, + "Ġmanure": 32968, + "ouns": 32969, + "âΧ": 32970, + "Ġtorques": 32971, + "mitian": 32972, + "Ġtion": 32973, + "ĠGarden": 32974, + "Ġfolk": 32975, + "Ġsuspicious": 32976, + "ÃĤ": 32977, + "odia": 32978, + "istencies": 32979, + "ãĢī": 32980, + "ĠInvitrogen": 32981, + "ĠSUN": 32982, + "ĠSuperior": 32983, + "Ġdiscontinuation": 32984, + "cock": 32985, + "knot": 32986, + "Ġextens": 32987, + "ĠWhitney": 32988, + "Ġharbour": 32989, + "PID": 32990, + "Ġpmol": 32991, + "olymph": 32992, + "Ġgard": 32993, + "ĠOvarian": 32994, + "Ġrepressed": 32995, + "ĠAlab": 32996, + "ĠÃĦ": 32997, + "ulex": 32998, + "ĠAustrian": 32999, + "Ġaflat": 33000, + "Ġparathyroid": 33001, + "Ġgroupoid": 33002, + "Ġdevast": 33003, + "ĠKv": 33004, + "Ġborrow": 33005, + "Ġunconventional": 33006, + "Ġborehole": 33007, + "ÑĮ": 33008, + "ĠDays": 33009, + "Ġlexic": 33010, + "Nor": 33011, + "ĠHerc": 33012, + "assays": 33013, + "Ġdrawings": 33014, + "defin": 33015, + "evoked": 33016, + "Ġȳ": 33017, + "ĠSunday": 33018, + "ĠChes": 33019, + "considered": 33020, + "opedic": 33021, + "larger": 33022, + "ominant": 33023, + "ĠBomb": 33024, + "Ġfiss": 33025, + "Ġhinge": 33026, + "ĠIonic": 33027, + "Ġdestro": 33028, + "Ġcomplementarity": 33029, + "Higgs": 33030, + "oria": 33031, + "ourcing": 33032, + "ĠXin": 33033, + "Ġworkspace": 33034, + "ĠLigand": 33035, + "Ġstruggle": 33036, + "ĠImmunohistochemical": 33037, + "Ġnick": 33038, + "ĠGuard": 33039, + "rigid": 33040, + "Ġaquaculture": 33041, + "Experiment": 33042, + "ËĪ": 33043, + "tir": 33044, + "ĠSMS": 33045, + "Ġbevacizumab": 33046, + "Ġmodulations": 33047, + "Ġgeophysical": 33048, + "Properties": 33049, + "Ġpainted": 33050, + "Ġsanc": 33051, + "Ġintimate": 33052, + "Ġnail": 33053, + "identity": 33054, + "Ġdatum": 33055, + "anthus": 33056, + "Ġdyadic": 33057, + "Ġconvincing": 33058, + "elem": 33059, + "Ġhiding": 33060, + "Ġrugby": 33061, + "ĠXe": 33062, + "ĠIssue": 33063, + "Ġvesicular": 33064, + "ĠKelvin": 33065, + "Ġdistancing": 33066, + "echnology": 33067, + "afers": 33068, + "ĠAuthentic": 33069, + "PubMed": 33070, + "Ġdeformity": 33071, + "ĠChaos": 33072, + "ĠShield": 33073, + "oxetine": 33074, + "ĠWorkers": 33075, + "ĠMOI": 33076, + "Ġdehydrated": 33077, + "ĠGastric": 33078, + "Ġmonomials": 33079, + "odox": 33080, + "ĠDublin": 33081, + "Ġleishman": 33082, + "Ġplanner": 33083, + "circle": 33084, + "Ġfractured": 33085, + "ĠLocally": 33086, + "ĠActions": 33087, + "Ġlichen": 33088, + "hannel": 33089, + "ĠTAG": 33090, + "Ġdecisive": 33091, + "ĠQM": 33092, + "Ġbiomaterials": 33093, + "ĠViruses": 33094, + "hydroxyphenyl": 33095, + "ĠIAA": 33096, + "ĠRU": 33097, + "violating": 33098, + "Ġpockets": 33099, + "chant": 33100, + "iberg": 33101, + "lectomy": 33102, + "olerae": 33103, + "Ġattracting": 33104, + "Ġketone": 33105, + "ĠCod": 33106, + "Ġmicroarrays": 33107, + "ĠMetals": 33108, + "benzoyl": 33109, + "Ġsemigroups": 33110, + "Ġreconstituted": 33111, + "sites": 33112, + "anabe": 33113, + "ĠComposites": 33114, + "Ġwildtype": 33115, + "Ġleukaemia": 33116, + "Ġmurder": 33117, + "Ġdentin": 33118, + "Hub": 33119, + "Orient": 33120, + "onn": 33121, + "synchron": 33122, + "Ġchronically": 33123, + "methyleneamino": 33124, + "Ġdopant": 33125, + "Ġfecundity": 33126, + "delete": 33127, + "remia": 33128, + "ĠNHL": 33129, + "itidis": 33130, + "Ġcopep": 33131, + "XI": 33132, + "Ġlocating": 33133, + "ĠZIKV": 33134, + "hexa": 33135, + "ĠFactorization": 33136, + "ynchus": 33137, + "Methyl": 33138, + "hagen": 33139, + "ĠPaw": 33140, + "neath": 33141, + "bsite": 33142, + "Ġtrache": 33143, + "Bre": 33144, + "uw": 33145, + "roit": 33146, + "Ġreacting": 33147, + "ĠBae": 33148, + "Ġquotients": 33149, + "Ġpins": 33150, + "ĠVARI": 33151, + "Ġequine": 33152, + "ĠRunge": 33153, + "Ġcolonial": 33154, + "measurement": 33155, + "ĠAbbott": 33156, + "Ġortho": 33157, + "Ġmetaphor": 33158, + "benzoic": 33159, + "ĠTransformers": 33160, + "Lower": 33161, + "ĠOVA": 33162, + "radial": 33163, + "Flag": 33164, + "authorbs": 33165, + "Ġtreadmill": 33166, + "Ġenterica": 33167, + "ĠJulia": 33168, + "Ġplumes": 33169, + "Ġinvoke": 33170, + "chloric": 33171, + "olino": 33172, + "Ġinterruption": 33173, + "subunit": 33174, + "ĠMDP": 33175, + "Ġmanipulator": 33176, + "ĠScales": 33177, + "ĠHTML": 33178, + "ĠFrederick": 33179, + "Garc": 33180, + "Ġbell": 33181, + "ĠRect": 33182, + "romised": 33183, + "Word": 33184, + "oples": 33185, + "operated": 33186, + "Ġcollects": 33187, + "ĠHorizon": 33188, + "Ġsafer": 33189, + "dup": 33190, + "ĠMills": 33191, + "ALP": 33192, + "Ġexopl": 33193, + "ATTR": 33194, + "wara": 33195, + "ĉĉĉĉĉĉĉ": 33196, + "Ġdebug": 33197, + "Descriptor": 33198, + "statistics": 33199, + "ĠCub": 33200, + "STER": 33201, + "ĠStabilization": 33202, + "ĠIRAS": 33203, + "Ġconformally": 33204, + "Adap": 33205, + "ÂŃ": 33206, + "ĠQS": 33207, + "Ġmicrostrip": 33208, + "Ġdelicate": 33209, + "Ġpublisher": 33210, + "Ġhos": 33211, + "ĠSv": 33212, + "ĠDesert": 33213, + "ĠGuer": 33214, + "ĠCapture": 33215, + "EBP": 33216, + "dust": 33217, + "å¤": 33218, + "ĠOls": 33219, + "Ġsuperscript": 33220, + "ĠFluctuations": 33221, + "illium": 33222, + "Ġcaption": 33223, + "Ġconcur": 33224, + "Ġquantifies": 33225, + "sterdam": 33226, + "Ġspiked": 33227, + "Nan": 33228, + "usin": 33229, + "ĠLAN": 33230, + "Ġobserves": 33231, + "ĠAla": 33232, + "ĠIntuitively": 33233, + "curr": 33234, + "Ġshrinking": 33235, + "Ġcompressibility": 33236, + "orporeal": 33237, + "Ġdebt": 33238, + "çĶ": 33239, + "ĠTil": 33240, + "ĠWAT": 33241, + "odyne": 33242, + "Ġgateway": 33243, + "Ġductile": 33244, + "ĠJesus": 33245, + "ositol": 33246, + "ĠMales": 33247, + "Ġsolvation": 33248, + "Ġdisagree": 33249, + "Ġorthologs": 33250, + "San": 33251, + "igo": 33252, + "Ġphages": 33253, + "Ġnegatives": 33254, + "Ġinterpre": 33255, + "AAA": 33256, + "Ġgratings": 33257, + "ĠMoll": 33258, + "ĠRivers": 33259, + "Ġcruzi": 33260, + "ĠGenerate": 33261, + "ĠBarbara": 33262, + "ĠHeritage": 33263, + "ĠFluorescent": 33264, + "ĠLaws": 33265, + "ArrayExpr": 33266, + "Ġmultipole": 33267, + "Ġsqueezing": 33268, + "SPSS": 33269, + "lf": 33270, + "nlm": 33271, + "Ġworn": 33272, + "ĠKuz": 33273, + "Ġgenesis": 33274, + "ĠEmperor": 33275, + "volatile": 33276, + "Ġsibling": 33277, + "ivir": 33278, + "oen": 33279, + "Ġprotost": 33280, + "Ġtransformers": 33281, + "ennium": 33282, + "Ġproposing": 33283, + "Ġbroadcasting": 33284, + "QM": 33285, + "ĠDependent": 33286, + "Ġdisable": 33287, + "ĠUAS": 33288, + "Ġwarnings": 33289, + "Ġarmed": 33290, + "Ġjournalist": 33291, + "Ġmonoclinic": 33292, + "olium": 33293, + "aping": 33294, + "toon": 33295, + "Ġorthodontic": 33296, + "ĠNormalization": 33297, + "Ġmandible": 33298, + "aban": 33299, + "ĠWak": 33300, + "extend": 33301, + "Multiple": 33302, + "investig": 33303, + "iscal": 33304, + "uttered": 33305, + "Ġburg": 33306, + "decode": 33307, + "empor": 33308, + "ĠDuration": 33309, + "anny": 33310, + "oprost": 33311, + "ĠRenormalization": 33312, + "ĠFUNCTION": 33313, + "ytorch": 33314, + "Ġsynapt": 33315, + "ĠFormat": 33316, + "ĠCRT": 33317, + "ĠJonathan": 33318, + "ĠOFF": 33319, + "orr": 33320, + "Ġresur": 33321, + "Ġcorruption": 33322, + "dwelling": 33323, + "Ġbackup": 33324, + "AGT": 33325, + "ĠSafe": 33326, + "dorfer": 33327, + "Ġataxia": 33328, + "Ġparv": 33329, + "reader": 33330, + "Ġsubtract": 33331, + "embolism": 33332, + "Ġtinnitus": 33333, + "Ġcytomegalovirus": 33334, + "Ġdeleting": 33335, + "Tex": 33336, + "ĠCSS": 33337, + "ardt": 33338, + "Ġoutgrowth": 33339, + "Ġmyocytes": 33340, + "digital": 33341, + "Ġsubscale": 33342, + "uspension": 33343, + "Ġhamster": 33344, + "Ġinflaton": 33345, + "hara": 33346, + "urches": 33347, + "ĠCLE": 33348, + "ĠYas": 33349, + "ĠEncoding": 33350, + "ĠAuger": 33351, + "Ġanastomosis": 33352, + "Agent": 33353, + "ĠSIL": 33354, + "ĠCCT": 33355, + "Ġbrine": 33356, + "Ġoligo": 33357, + "Ġfluoro": 33358, + "Ġgallery": 33359, + "ddots": 33360, + "Ġcilia": 33361, + "ĠPPV": 33362, + "ĠUTR": 33363, + "Ġintertidal": 33364, + "ocalized": 33365, + "Ġcrowds": 33366, + "odor": 33367, + "Ġcov": 33368, + "Ġnonetheless": 33369, + "Ġïģ¤": 33370, + "Ġboosted": 33371, + "ĠChakra": 33372, + "Hal": 33373, + "Pear": 33374, + "Ġimprec": 33375, + "ĠSupplement": 33376, + "goal": 33377, + "Ġôı¼ģ": 33378, + "Ġstall": 33379, + "Ġherd": 33380, + "smaller": 33381, + "Ġreconstructing": 33382, + "Ġartefacts": 33383, + "Ġteg": 33384, + "conventional": 33385, + "radical": 33386, + "Ġliteral": 33387, + "framework": 33388, + "iprocal": 33389, + "EEG": 33390, + "Ġgins": 33391, + "odermal": 33392, + "ĠAgu": 33393, + "ĠTwelve": 33394, + "Mul": 33395, + "ب": 33396, + "irl": 33397, + "ĠBelief": 33398, + "Ġincont": 33399, + "ICC": 33400, + "hexane": 33401, + "Ġejected": 33402, + "ĠPSC": 33403, + "ĠHPC": 33404, + "ĠVH": 33405, + "Ġequivalences": 33406, + "plotlib": 33407, + "enital": 33408, + "rians": 33409, + "prov": 33410, + "ĠVibr": 33411, + "Ġgrammatical": 33412, + "bachia": 33413, + "acceptable": 33414, + "odicity": 33415, + "abb": 33416, + "Ġherbs": 33417, + "Ġpredominance": 33418, + "ĠOrientation": 33419, + "Ġinvertebrate": 33420, + "Ġpelagic": 33421, + "country": 33422, + "ĠOrigins": 33423, + "ĠAdolescents": 33424, + "ĠTuning": 33425, + "rainian": 33426, + "ĠScar": 33427, + "Ġlightest": 33428, + "Ġemitters": 33429, + "ĠTsai": 33430, + "ritical": 33431, + "ĠExpert": 33432, + "authors": 33433, + "ECTION": 33434, + "ĠSeverity": 33435, + "Nam": 33436, + "publ": 33437, + "ĠAbe": 33438, + "Ġnanocrystalline": 33439, + "ĠNakamura": 33440, + "ĠPec": 33441, + "ĠBug": 33442, + "Ġsensed": 33443, + "ONS": 33444, + "ICs": 33445, + "Ġelectrochem": 33446, + "ĠROM": 33447, + "ĠRecruitment": 33448, + "Ġ⣩": 33449, + "Ġbiomolecules": 33450, + "ĠBrac": 33451, + "Ġtransposition": 33452, + "ĠWP": 33453, + "ĠOmega": 33454, + "Ġdiagon": 33455, + "platelet": 33456, + "JM": 33457, + "acre": 33458, + "ĠASR": 33459, + "ĠKath": 33460, + "Ġpriv": 33461, + "oplasts": 33462, + "Samples": 33463, + "dF": 33464, + "atti": 33465, + "ĠSanger": 33466, + "ipitated": 33467, + "Ġricher": 33468, + "ĠGRA": 33469, + "Ġplantar": 33470, + "Ġfoams": 33471, + "Ġmathematic": 33472, + "Ġstaphyl": 33473, + "ĠUptake": 33474, + "Ġcant": 33475, + "ĠSZ": 33476, + "Ġdismiss": 33477, + "Ġselections": 33478, + "plitz": 33479, + "Ġexemplified": 33480, + "Ġtorsional": 33481, + "Ev": 33482, + "Ġvoters": 33483, + "ĠNest": 33484, + "yscale": 33485, + "Ġspeci": 33486, + "Ġpolished": 33487, + "Ġlatencies": 33488, + "qing": 33489, + "Ġonwards": 33490, + "llvm": 33491, + "theorem": 33492, + "logging": 33493, + "ĠALK": 33494, + "ĠBaum": 33495, + "ĠGhosh": 33496, + "Ġchairman": 33497, + "paired": 33498, + "ĠPAP": 33499, + "notes": 33500, + "olesterolem": 33501, + "Ġestuarine": 33502, + "ĠTibetan": 33503, + "ĠVER": 33504, + "Ġchecker": 33505, + "FLAGS": 33506, + "rolimus": 33507, + "ĠMutant": 33508, + "Ġspraying": 33509, + "ĠChest": 33510, + "olinium": 33511, + "ĠTriassic": 33512, + "Ġlidar": 33513, + "Art": 33514, + "ĠMilk": 33515, + "Ġindecomposable": 33516, + "Ġrocket": 33517, + "ĠPartners": 33518, + "Ġsemantically": 33519, + "entinel": 33520, + "Large": 33521, + "Pen": 33522, + "ĠTru": 33523, + "Ġheritage": 33524, + "ĠMutual": 33525, + "ĠChemotherapy": 33526, + "Ġdoubles": 33527, + "ĠEmbedded": 33528, + "itual": 33529, + "ĠBPA": 33530, + "Ġcholerae": 33531, + "ĠInside": 33532, + "ĠKatz": 33533, + "convergence": 33534, + "Ġindividualized": 33535, + "kinje": 33536, + "Ġdiscovering": 33537, + "Ġintricate": 33538, + "Ġinland": 33539, + "RECT": 33540, + "ĠChick": 33541, + "ĠSUR": 33542, + "Ġyeasts": 33543, + "luminosity": 33544, + "Ġfain": 33545, + "ioni": 33546, + "ĠTig": 33547, + "ounder": 33548, + "Ġdeliber": 33549, + "ĠConservative": 33550, + "ĠDelhi": 33551, + "BER": 33552, + "ĠYB": 33553, + "oley": 33554, + "ĠBeau": 33555, + "TEXT": 33556, + "Ġsqueezed": 33557, + "Ġsocket": 33558, + "ĠpT": 33559, + "pyrazol": 33560, + "coefficients": 33561, + "Ġrecruiting": 33562, + "Ġducts": 33563, + "Ġfoster": 33564, + "omeration": 33565, + "ĠPSI": 33566, + "ĠDup": 33567, + "Ġks": 33568, + "ĠOptics": 33569, + "Ġliterary": 33570, + "ĠNiO": 33571, + "ĠVEGFR": 33572, + "Ġgraviton": 33573, + "Ġutterances": 33574, + "Ġbrady": 33575, + "Ġforty": 33576, + "ĠTransplantation": 33577, + "Ġagreements": 33578, + "Leftrightarrow": 33579, + "waves": 33580, + "Ġacidosis": 33581, + "Ġwooden": 33582, + "ĠCytoplasmic": 33583, + "safe": 33584, + "Ġjumping": 33585, + "ennial": 33586, + "Various": 33587, + "ĠEryth": 33588, + "ulins": 33589, + "unlock": 33590, + "methylated": 33591, + "asserstein": 33592, + "Ġheterozygosity": 33593, + "oxycycl": 33594, + "Ġcreativity": 33595, + "MPLE": 33596, + "inative": 33597, + "Ġconvolutions": 33598, + "Ġnouns": 33599, + "egan": 33600, + "ĠAbraham": 33601, + "Ġdenser": 33602, + "Che": 33603, + "lc": 33604, + "ĉĉĉĠ": 33605, + "Ġsemim": 33606, + "ĠOuter": 33607, + "Ġcand": 33608, + "odule": 33609, + "esthesia": 33610, + "ĠJoy": 33611, + "ĠProtocols": 33612, + "ĠCalculated": 33613, + "atop": 33614, + "ĠFALSE": 33615, + "Ġrefin": 33616, + "Ġmigrants": 33617, + "ĠïĤ´": 33618, + "ĠSpecificity": 33619, + "ĠFellowship": 33620, + "ĠPMT": 33621, + "Ġdisclose": 33622, + "unches": 33623, + "Ġdiatoms": 33624, + "corr": 33625, + "Ġskyrm": 33626, + "Ġrenewal": 33627, + "gcd": 33628, + "cereb": 33629, + "Ġupright": 33630, + "Ġmesoscopic": 33631, + "hydraz": 33632, + "BAS": 33633, + "FLO": 33634, + "HCC": 33635, + "Mouse": 33636, + "Ġposet": 33637, + "Ġproteinuria": 33638, + "Ġreapp": 33639, + "ĠNickel": 33640, + "Ġstripes": 33641, + "Ġripple": 33642, + "September": 33643, + "odomain": 33644, + "ĠPope": 33645, + "ĠNons": 33646, + "Ġtechnic": 33647, + "Ġneutrop": 33648, + "descriptor": 33649, + "Ġdissipated": 33650, + "Ġglaciers": 33651, + "ĠHIGH": 33652, + "ĠLav": 33653, + "retely": 33654, + "Ġbackwards": 33655, + "Ġcritics": 33656, + "ĠExtending": 33657, + "bic": 33658, + "ĠChao": 33659, + "ofibr": 33660, + "Ġcounters": 33661, + "Ġstreets": 33662, + "Ġprosthetic": 33663, + "Ġbiodegradation": 33664, + "complexity": 33665, + "ĠSPL": 33666, + "ĠCAC": 33667, + "Ġadducts": 33668, + "Ġmorphometric": 33669, + "ĠMatt": 33670, + "Ġinducer": 33671, + "Ġastrocyte": 33672, + "Ġtriplets": 33673, + "Ġpertussis": 33674, + "PES": 33675, + "idy": 33676, + "uncertain": 33677, + "Ġhyperparameter": 33678, + "ĠInfrastructure": 33679, + "ìĿĺ": 33680, + "ZW": 33681, + "Ġaddr": 33682, + "Ġdisrupts": 33683, + "Ġoverestimate": 33684, + "ĠDYNA": 33685, + "Ġvolatiles": 33686, + "emerg": 33687, + "issue": 33688, + "cpp": 33689, + "Äħ": 33690, + "ĠVIP": 33691, + "Ġuve": 33692, + "ĠCNV": 33693, + "ylethyl": 33694, + "onazole": 33695, + "ĠHiro": 33696, + "Ġcn": 33697, + "tik": 33698, + "ubted": 33699, + "ĠJacobs": 33700, + "Ġadvocated": 33701, + "ĠBifid": 33702, + "material": 33703, + "Ġstyrene": 33704, + "ĠKeller": 33705, + "rocytic": 33706, + "pinephrine": 33707, + "ĠWritten": 33708, + "ĠRecommendation": 33709, + "bled": 33710, + "ĠBootstrap": 33711, + "thirds": 33712, + "Ġcaptain": 33713, + "equals": 33714, + "SRC": 33715, + "ĠKentucky": 33716, + "Ġeosinophils": 33717, + "Average": 33718, + "Hi": 33719, + "Whe": 33720, + "ĠDAT": 33721, + "ĠUM": 33722, + "Ġtendencies": 33723, + "ĠPeterson": 33724, + "Ġoccult": 33725, + "Ġexhibition": 33726, + "ĠINS": 33727, + "Ġadipocyte": 33728, + "Just": 33729, + "hift": 33730, + "tensors": 33731, + "Ġciliary": 33732, + "ipation": 33733, + "Ġmotivations": 33734, + "Ġwitnessed": 33735, + "itches": 33736, + "ĠSoy": 33737, + "Ġgib": 33738, + "eptic": 33739, + "ĠKOH": 33740, + "Ġïģ¨": 33741, + "ĠTorres": 33742, + "ο": 33743, + "arpo": 33744, + "okinase": 33745, + "ĠBudd": 33746, + "ĠGMM": 33747, + "Ġunderpin": 33748, + "Ġoptimistic": 33749, + "ogeography": 33750, + "numerical": 33751, + "ogg": 33752, + "Ġdisequilibrium": 33753, + "Ġswab": 33754, + "EDS": 33755, + "ĠPDFs": 33756, + "ĠSupernova": 33757, + "phospho": 33758, + "Ġlysosomes": 33759, + "galactic": 33760, + "ĠPerme": 33761, + "Ġfishery": 33762, + "ĠBOLD": 33763, + "Ġunravel": 33764, + "ĠEncryption": 33765, + "JP": 33766, + "hur": 33767, + "Ġdiscount": 33768, + "ĠWatanabe": 33769, + "ĠRheumat": 33770, + "FITC": 33771, + "Ġterahertz": 33772, + "ĠFont": 33773, + "iances": 33774, + "ĠAdditive": 33775, + "ĠEither": 33776, + "metadata": 33777, + "amphetamine": 33778, + "ĠPalmer": 33779, + "Ġleveraging": 33780, + "John": 33781, + "OCT": 33782, + "infer": 33783, + "ĠMSD": 33784, + "ĠâĪĵ": 33785, + "ouver": 33786, + "ĠAndersen": 33787, + "Ġworlds": 33788, + "Ġtori": 33789, + "Ġïģ°": 33790, + "engineering": 33791, + "ĠSquadron": 33792, + "Aff": 33793, + "åı": 33794, + "oxel": 33795, + "yletic": 33796, + "ĠCharacterizing": 33797, + "VT": 33798, + "rational": 33799, + "eremia": 33800, + "Ġcomplexation": 33801, + "ĠERα": 33802, + "carboxylic": 33803, + "ïĤ·": 33804, + "Ġgalactose": 33805, + "ĠAurora": 33806, + "Ġplasminogen": 33807, + "uren": 33808, + "igne": 33809, + "Ġrepaired": 33810, + "Ġblockers": 33811, + "ĠMNIST": 33812, + "Ïħ": 33813, + "ĠAxi": 33814, + "Ġstadium": 33815, + "diethyl": 33816, + "âĢİ": 33817, + "Ġcyclotron": 33818, + "Ġlymphaden": 33819, + "Ġvin": 33820, + "ĠMayer": 33821, + "Ġendometrium": 33822, + "ĠSpherical": 33823, + "Ġpersu": 33824, + "Ġimmortal": 33825, + "benzenesulf": 33826, + "ĠÅľ": 33827, + "Ġbite": 33828, + "ugged": 33829, + "ĠDiffraction": 33830, + "GTG": 33831, + "iate": 33832, + "Ġtp": 33833, + "Ġaber": 33834, + "ĠRein": 33835, + "Program": 33836, + "Style": 33837, + "ĠRegularization": 33838, + "ĠLeukemia": 33839, + "Ġprokaryotic": 33840, + "ocomial": 33841, + "skb": 33842, + "Ġdeviates": 33843, + "Ġfuse": 33844, + "ĠNull": 33845, + "ĠïĥĹ": 33846, + "ĠOperational": 33847, + "Ġcompressor": 33848, + "ĠRydberg": 33849, + "Ġfought": 33850, + "Ġeco": 33851, + "ĠSSP": 33852, + "CDs": 33853, + "ĠMEK": 33854, + "ĠAnisotropic": 33855, + "ĠDirection": 33856, + "ĠSpectrometry": 33857, + "Ġgluten": 33858, + "ĠPowell": 33859, + "recognized": 33860, + "Ġpsychotic": 33861, + "Ġhinder": 33862, + "Ġaccommodation": 33863, + "ĠNorman": 33864, + "Qx": 33865, + "Ġperiv": 33866, + "ĠUnknown": 33867, + "Ġjoins": 33868, + "ĠMinimization": 33869, + "ĠSons": 33870, + "ĠCin": 33871, + "Ġunavoid": 33872, + "ĠPTX": 33873, + "Ġcada": 33874, + "ĠLuk": 33875, + "Ġruling": 33876, + "Ġbiphasic": 33877, + "ĠComplications": 33878, + "ĠDefects": 33879, + "Content": 33880, + "ĠGregory": 33881, + "ĠWerner": 33882, + "ĠWeibull": 33883, + "eldom": 33884, + "Ġactivators": 33885, + "GLAPI": 33886, + "mathring": 33887, + "Ġhens": 33888, + "NSC": 33889, + "however": 33890, + "ĠTME": 33891, + "mafrost": 33892, + "coefficient": 33893, + "ĠInsect": 33894, + "ĠROIs": 33895, + "ĠBorrel": 33896, + "ĠQiu": 33897, + "Ġinhaled": 33898, + "idate": 33899, + "Ġantihypertensive": 33900, + "Ġtreats": 33901, + "ĠNearly": 33902, + "succ": 33903, + "ĠOrbital": 33904, + "eradish": 33905, + "administered": 33906, + "ĠÏĤ": 33907, + "ĠColony": 33908, + "ĠâĮĬ": 33909, + "ĠIndonesian": 33910, + "ĠBauer": 33911, + "ĠKod": 33912, + "manned": 33913, + "Resistant": 33914, + "Ġdaughters": 33915, + "ĠPredicted": 33916, + "Ġvocab": 33917, + "Ġcontrasted": 33918, + "margin": 33919, + "ĠDirected": 33920, + "EDTA": 33921, + "Ġsynchrony": 33922, + "icki": 33923, + "ĠSalv": 33924, + "treat": 33925, + "incess": 33926, + "varnothing": 33927, + "Ġhexane": 33928, + "Empty": 33929, + "Ġgemcitabine": 33930, + "omib": 33931, + "orepinephrine": 33932, + "proc": 33933, + "ĠMetS": 33934, + "ĠDRAM": 33935, + "Ġanticoagulant": 33936, + "nom": 33937, + "amater": 33938, + "ĠLiDAR": 33939, + "Ġmobil": 33940, + "Ġameliorates": 33941, + "niz": 33942, + "Ġja": 33943, + "Ġemuls": 33944, + "ĠZa": 33945, + "Ġastronomical": 33946, + "ĠAlfred": 33947, + "Hilbert": 33948, + "ĠKF": 33949, + "CRT": 33950, + "quadratic": 33951, + "Ġdifferentials": 33952, + "robacterium": 33953, + "ĠHippocampal": 33954, + "pull": 33955, + "ÄĻ": 33956, + "Ġsad": 33957, + "allyl": 33958, + "Ġhotspot": 33959, + "ĠElectronics": 33960, + "Ġconstitution": 33961, + "itonin": 33962, + "اÙĦ": 33963, + "Pc": 33964, + "Ġrevascular": 33965, + "Ġusable": 33966, + "ĠScatter": 33967, + "Ġgraphically": 33968, + "liminf": 33969, + "Ġrestaurant": 33970, + "ucalyptus": 33971, + "ACG": 33972, + "Analy": 33973, + "ĠMillipore": 33974, + "Ġmunicipalities": 33975, + "ĠMacrophage": 33976, + "Ġmacromolecular": 33977, + "License": 33978, + "gc": 33979, + "Ġlavage": 33980, + "ĠAES": 33981, + "ĠFCS": 33982, + "peritone": 33983, + "Ġmeasles": 33984, + "TEX": 33985, + "ĠVirulence": 33986, + "Ġhematoma": 33987, + "ĠFres": 33988, + "ĠNutrient": 33989, + "apar": 33990, + "ĠSpot": 33991, + "coplasma": 33992, + "ĠExpect": 33993, + "Ġciprofloxacin": 33994, + "phylaxis": 33995, + "ĠAtlanta": 33996, + "routing": 33997, + "arate": 33998, + "ĠCis": 33999, + "ensure": 34000, + "carriers": 34001, + "ĠVariant": 34002, + "surgical": 34003, + "ĠEstimate": 34004, + "à¹": 34005, + "ĠLiqu": 34006, + "Ġamalg": 34007, + "Ġbla": 34008, + "Ġthematic": 34009, + "IRQ": 34010, + "ACTION": 34011, + "ĠChristi": 34012, + "æľ": 34013, + "Ġnpy": 34014, + "death": 34015, + "Ġhairpin": 34016, + "Ġmultiplicities": 34017, + "Gibco": 34018, + "heated": 34019, + "afety": 34020, + "mutable": 34021, + "quarks": 34022, + "Sun": 34023, + "ql": 34024, + "Ġproductions": 34025, + "Ġgeology": 34026, + "Ġtides": 34027, + "atrix": 34028, + "Ġadmixture": 34029, + "translated": 34030, + "ĠAbu": 34031, + "nucleus": 34032, + "Ġweaknesses": 34033, + "Ġflavors": 34034, + "ĠLuis": 34035, + "ĠPutative": 34036, + "sentence": 34037, + "ĠMast": 34038, + "ĠMPS": 34039, + "ĠESS": 34040, + "Ġcompose": 34041, + "Ġbirefring": 34042, + "ĠRamsey": 34043, + "ĠCLL": 34044, + "Ġlignocell": 34045, + "ĠLamin": 34046, + "ĠWelsh": 34047, + "von": 34048, + "Ġpests": 34049, + "Ġfiction": 34050, + "ĠHRT": 34051, + "Ġassure": 34052, + "CTs": 34053, + "ĠPAHs": 34054, + "Ġcryptography": 34055, + "enerated": 34056, + "Ġops": 34057, + "ĠSynerg": 34058, + "iginal": 34059, + "ĠCraw": 34060, + "Ġkne": 34061, + "Ġcurvatures": 34062, + "Ġlux": 34063, + "ĠKenn": 34064, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 34065, + "println": 34066, + "Ġvertebrae": 34067, + "Ġrutile": 34068, + "ĠAerosol": 34069, + "referred": 34070, + "lactamase": 34071, + "vehicle": 34072, + "adir": 34073, + "izards": 34074, + "Ġcallback": 34075, + "Cluster": 34076, + "Ġsilt": 34077, + "Ġresearched": 34078, + "ĠGenerator": 34079, + "ĠRestoration": 34080, + "ĠChin": 34081, + "ometrical": 34082, + "ĠCoefficients": 34083, + "rachid": 34084, + "Face": 34085, + "Men": 34086, + "counts": 34087, + "Ġpeg": 34088, + "Ġecl": 34089, + "Ġcomedy": 34090, + "ĠLn": 34091, + "obuty": 34092, + "ĠSharing": 34093, + "Ġadequacy": 34094, + "urtosis": 34095, + "ĠPicard": 34096, + "Ġfestival": 34097, + "Ġdisposition": 34098, + "ĠComplement": 34099, + "ĠExclusion": 34100, + "Ġdextran": 34101, + "mons": 34102, + "ĠInterpolation": 34103, + "ĠSteven": 34104, + "Ġcelebrated": 34105, + "ĠhPa": 34106, + "ofrequency": 34107, + "Ġexceptionally": 34108, + "Ġenergetically": 34109, + "psychotic": 34110, + "Landau": 34111, + "Tuple": 34112, + "distributions": 34113, + "ĠRichards": 34114, + "Ġpolyps": 34115, + "ĠAbsence": 34116, + "Ġceleb": 34117, + "XG": 34118, + "Ġsimulates": 34119, + "mitters": 34120, + "Ġheatmap": 34121, + "ĠSDN": 34122, + "ĠSteps": 34123, + "Ġshallower": 34124, + "ĠTurbulent": 34125, + "YT": 34126, + "Ġnal": 34127, + "plicative": 34128, + "phae": 34129, + "ĠLeica": 34130, + "ĠAPPRO": 34131, + "Ġarrhythmia": 34132, + "Ġrewriting": 34133, + "Ġunsafe": 34134, + "Ġcoworkers": 34135, + "ĠGAD": 34136, + "ivol": 34137, + "Ġdisrupting": 34138, + "ĠUltraviolet": 34139, + "eree": 34140, + "ĠLopez": 34141, + "Ġnegation": 34142, + "Ġjaponica": 34143, + "ecessor": 34144, + "ĠPatch": 34145, + "Ġsoap": 34146, + "ĠYing": 34147, + "MSK": 34148, + "Ġtracheal": 34149, + "icos": 34150, + "Ġvp": 34151, + "FAIL": 34152, + "Ġcatabolism": 34153, + "solver": 34154, + "font": 34155, + "esp": 34156, + "ĠZou": 34157, + "Ġdarker": 34158, + "Ġlysozyme": 34159, + "covered": 34160, + "Ġmultitude": 34161, + "requently": 34162, + "Ġmetamorph": 34163, + "Ġchapters": 34164, + "hh": 34165, + "chl": 34166, + "redundant": 34167, + "acking": 34168, + "Ġentail": 34169, + "ĠPacket": 34170, + "ĠHabitat": 34171, + "imedia": 34172, + "ĠCof": 34173, + "phrase": 34174, + "Ġcloth": 34175, + "arsal": 34176, + "Ġdrums": 34177, + "TPUT": 34178, + "Args": 34179, + "ductory": 34180, + "ĠUltimately": 34181, + "icates": 34182, + "antigen": 34183, + "Though": 34184, + "ĠFlore": 34185, + "probs": 34186, + "Ġcirculatory": 34187, + "ĠContemporary": 34188, + "eplitz": 34189, + "Ġhatch": 34190, + "rized": 34191, + "ĠKop": 34192, + "mitting": 34193, + "Ġhyperspectral": 34194, + "ĠAbst": 34195, + "SIM": 34196, + "Ġfruitful": 34197, + "Ġrecipe": 34198, + "Ġimidazole": 34199, + "Ġsynonymous": 34200, + "Ġattribution": 34201, + "ĠMartÃŃnez": 34202, + "ĠRodrÃŃguez": 34203, + "particular": 34204, + "ĠInteracting": 34205, + "Conf": 34206, + "ORE": 34207, + "ĠTMA": 34208, + "ucidation": 34209, + "Ġbiochemistry": 34210, + "ĠLevy": 34211, + "Ġconcentrates": 34212, + "Ġinductor": 34213, + "Ġpyrophosph": 34214, + "Ġrespondent": 34215, + "Zhang": 34216, + "Ġrope": 34217, + "Ġdesignation": 34218, + "ĠClim": 34219, + "Ġconstrains": 34220, + "shelf": 34221, + "ĠdÏĥ": 34222, + "ĠTLC": 34223, + "ĠAhar": 34224, + "ĠMatch": 34225, + "ĠMOL": 34226, + "Ġfees": 34227, + "wealth": 34228, + "Ġhyperactivity": 34229, + "ĠBruker": 34230, + "ĠFreund": 34231, + "dichlorophenyl": 34232, + "rero": 34233, + "ĠFear": 34234, + "dotsc": 34235, + "Ġhyg": 34236, + "ĠTexture": 34237, + "Tak": 34238, + "ampled": 34239, + "Ġalgeb": 34240, + "subt": 34241, + "Ġdocumentary": 34242, + "ĠJE": 34243, + "CNS": 34244, + "Ġdeclar": 34245, + "Height": 34246, + "Ki": 34247, + "enoid": 34248, + "ĠCervical": 34249, + "fractory": 34250, + "Ġplanted": 34251, + "IFI": 34252, + "Ġconceptually": 34253, + "Ġfillers": 34254, + "icola": 34255, + "lean": 34256, + "Ġclump": 34257, + "Ġwriters": 34258, + "Generally": 34259, + "Ġost": 34260, + "opening": 34261, + "CLASS": 34262, + "Ġherpesvirus": 34263, + "Instit": 34264, + "Ġdrinks": 34265, + "ĠIntensive": 34266, + "Ġmusician": 34267, + "Ġanchors": 34268, + "Series": 34269, + "ĠFAM": 34270, + "ĠBott": 34271, + "ĠECC": 34272, + "Ġinversions": 34273, + "Ġacres": 34274, + "Ġswabs": 34275, + "ĠÍī": 34276, + "ĠBerkeley": 34277, + "Ġplum": 34278, + "Ġempower": 34279, + "Ġphotoemission": 34280, + "ĠRabi": 34281, + "East": 34282, + "Taylor": 34283, + "OSE": 34284, + "Ġdenied": 34285, + "ĠHTTP": 34286, + "MU": 34287, + "hew": 34288, + "Ġthri": 34289, + "ĠCERN": 34290, + "Ġsuffice": 34291, + "functionalized": 34292, + "Ġcrabs": 34293, + "Ġidempotent": 34294, + "Ġpostulate": 34295, + "ĠCBF": 34296, + "discrim": 34297, + "Character": 34298, + "ĠRecombination": 34299, + "Cache": 34300, + "omit": 34301, + "ĠAda": 34302, + "Ġcursor": 34303, + "EMT": 34304, + "Ġmesoscale": 34305, + "guide": 34306, + "Hyper": 34307, + "Ġht": 34308, + "renes": 34309, + "ussen": 34310, + "whereas": 34311, + "Ġintegrator": 34312, + "Ġsyncy": 34313, + "arous": 34314, + "Ġcounteract": 34315, + "halose": 34316, + "ĠNotation": 34317, + "ĠRelevance": 34318, + "vf": 34319, + "Ġinbred": 34320, + "Ġrecirc": 34321, + "Ġende": 34322, + "Ġpresidential": 34323, + "Ġlactose": 34324, + "acional": 34325, + "ospi": 34326, + "ĠVGG": 34327, + "oselectivity": 34328, + "ĠConfig": 34329, + "Ġfingerprints": 34330, + "Interface": 34331, + "purple": 34332, + "etus": 34333, + "ĠNin": 34334, + "ĠKras": 34335, + "ĠReports": 34336, + "ĠSeattle": 34337, + "ADC": 34338, + "Ġlipoproteins": 34339, + "cyclohexyl": 34340, + "opressin": 34341, + "Ġwavefront": 34342, + "tetrazol": 34343, + "thys": 34344, + "Ġdivor": 34345, + "aminophen": 34346, + "ĠPerry": 34347, + "ĠConsiderations": 34348, + "ĠHalo": 34349, + "Ġreflexive": 34350, + "thiazolidin": 34351, + "oxycycline": 34352, + "CW": 34353, + "odim": 34354, + "ĠChong": 34355, + "Ġequilibrated": 34356, + "rime": 34357, + "ymology": 34358, + "Ġdevoid": 34359, + "rigel": 34360, + "amatergic": 34361, + "Ġidentifications": 34362, + "Ġcontrollability": 34363, + "ecticut": 34364, + "ĠSynchronization": 34365, + "ulatus": 34366, + "Ġcorrelating": 34367, + "Ġmuons": 34368, + "Ġcompartmental": 34369, + "Ġinhomogeneities": 34370, + "Ġevacuation": 34371, + "respiratory": 34372, + "dimethoxy": 34373, + "Ġinterferometric": 34374, + "Ġastronomy": 34375, + "ZD": 34376, + "ĦĦ": 34377, + "elia": 34378, + "bler": 34379, + "Ġpioneering": 34380, + "Ġpits": 34381, + "Ġmansoni": 34382, + "ĠCOND": 34383, + "Ġcodeword": 34384, + "imura": 34385, + "ĠDopamine": 34386, + "ĠGiov": 34387, + "ĠCameroon": 34388, + "Sem": 34389, + "dong": 34390, + "otto": 34391, + "emies": 34392, + "Ġinterquartile": 34393, + "llbracket": 34394, + "otropies": 34395, + "Ġhappening": 34396, + "ĠPalm": 34397, + "Ġstuff": 34398, + "Ġparking": 34399, + "egal": 34400, + "ĠCOP": 34401, + "Ġorganizing": 34402, + "Ġpolyhedral": 34403, + "Ġprovenance": 34404, + "Js": 34405, + "chains": 34406, + "egu": 34407, + "mercap": 34408, + "leveland": 34409, + "Ġerythroid": 34410, + "ymptomatic": 34411, + "Ġzigzag": 34412, + "Ġinferring": 34413, + "Ġapprox": 34414, + "Ġdownlink": 34415, + "ĠDeficiency": 34416, + "rbracket": 34417, + "ĠTIM": 34418, + "STS": 34419, + "ainen": 34420, + "Ġunloading": 34421, + "ĠXP": 34422, + "ĠWhilst": 34423, + "ĠIDH": 34424, + "ĠTIMP": 34425, + "rrbracket": 34426, + "acities": 34427, + "Ġwhale": 34428, + "ĠWAR": 34429, + "Ġinfl": 34430, + "ĠPresentation": 34431, + "authorbsnm": 34432, + "Ġbactericidal": 34433, + "SPEC": 34434, + "Ġdysregulated": 34435, + "ĠICAM": 34436, + "nano": 34437, + "Ġwafers": 34438, + "ĠMUC": 34439, + "Ġalien": 34440, + "chke": 34441, + "Ġslabs": 34442, + "Ġbacking": 34443, + "nsis": 34444, + "Ġbalances": 34445, + "ethane": 34446, + "Linked": 34447, + "Chen": 34448, + "Hymenoptera": 34449, + "itations": 34450, + "ĠOUT": 34451, + "transplant": 34452, + "conditioned": 34453, + "ĠBenefits": 34454, + "Tyr": 34455, + "atmosp": 34456, + "ĠAdhesion": 34457, + "Ġthorac": 34458, + "activator": 34459, + "Ġphosphatidylinositol": 34460, + "Ġreportedly": 34461, + "ĠCLASS": 34462, + "Ġrenewed": 34463, + "ĠPharmacological": 34464, + "Ġminimise": 34465, + "glucosidase": 34466, + "adenosyl": 34467, + "Ġovip": 34468, + "initializer": 34469, + "Ġforage": 34470, + "rms": 34471, + "ĠImag": 34472, + "ĠAnnexin": 34473, + "ĠVehicles": 34474, + "Ġfles": 34475, + "sta": 34476, + "ĠGBS": 34477, + "ĠChat": 34478, + "measurements": 34479, + "ĠAuditory": 34480, + "Cut": 34481, + "Fv": 34482, + "Ġmaker": 34483, + "application": 34484, + "Ġreversing": 34485, + "Ġstip": 34486, + "Ġfaecalis": 34487, + "icycle": 34488, + "Ġtrimmed": 34489, + "Ġexacerbation": 34490, + "Ġtranscranial": 34491, + "ĠMomentum": 34492, + "Ġfc": 34493, + "ĠFOV": 34494, + "Ġangina": 34495, + "Ġnanostructure": 34496, + "Ġantagonism": 34497, + "ĠLEDs": 34498, + "ìĹIJ": 34499, + "Ġfals": 34500, + "aporation": 34501, + "ĠInvasive": 34502, + "ĠKm": 34503, + "ertation": 34504, + "Ġharness": 34505, + "Ġfertile": 34506, + "ĠTRUE": 34507, + "Ġshelter": 34508, + "ĠWolbachia": 34509, + "shoot": 34510, + "Ġsess": 34511, + "ĠHous": 34512, + "ĠAce": 34513, + "ĠCML": 34514, + "Ġproactive": 34515, + "Ġshots": 34516, + "Ġcoup": 34517, + "restling": 34518, + "uniformly": 34519, + "yam": 34520, + "olase": 34521, + "ĠICS": 34522, + "ĠEbola": 34523, + "rolling": 34524, + "trunc": 34525, + "ĠRepresentatives": 34526, + "Ġgrasping": 34527, + "ĠAnomaly": 34528, + "ĠMine": 34529, + "ĠMPO": 34530, + "leright": 34531, + "Ġinstitute": 34532, + "Ġsugarcane": 34533, + "ÑĢа": 34534, + "Ġoccluded": 34535, + "ĠMagellanic": 34536, + "BEC": 34537, + "Wi": 34538, + "oA": 34539, + "Ġgapped": 34540, + "ĠPRC": 34541, + "ĠMAE": 34542, + "Ġmusicians": 34543, + "ĠSignificantly": 34544, + "Ġforthcoming": 34545, + "Ġacclimation": 34546, + "required": 34547, + "verbal": 34548, + "ĠFX": 34549, + "ĠMLE": 34550, + "Ġcompass": 34551, + "ĠMultimodal": 34552, + "Grant": 34553, + "Ġtvb": 34554, + "Instruction": 34555, + "Ġsenses": 34556, + "urbed": 34557, + "hamn": 34558, + "Ġframed": 34559, + "Ġurothel": 34560, + "orin": 34561, + "seal": 34562, + "Ġflasks": 34563, + "shops": 34564, + "Ġwheels": 34565, + "ĠRadon": 34566, + "ĠPlanetary": 34567, + "Ġhedge": 34568, + "Ġdk": 34569, + "Ġevidently": 34570, + "threads": 34571, + "Ġtad": 34572, + "elim": 34573, + "imov": 34574, + "istem": 34575, + "andi": 34576, + "Ġleisure": 34577, + "ostom": 34578, + "Ġcaring": 34579, + "ĠSmoking": 34580, + "Ġcompetitors": 34581, + "AFS": 34582, + "xl": 34583, + "ĠSatur": 34584, + "ĠFerg": 34585, + "Ġchin": 34586, + "ĠCDR": 34587, + "ĠSOM": 34588, + "osaccharide": 34589, + "MODEL": 34590, + "ECC": 34591, + "Ġdas": 34592, + "agonist": 34593, + "stery": 34594, + "Ġrelays": 34595, + "zek": 34596, + "Ġneoplasm": 34597, + "Chip": 34598, + "Ġgill": 34599, + "lamed": 34600, + "cerning": 34601, + "Ġinconsistencies": 34602, + "aceans": 34603, + "ĠAdri": 34604, + "ĠAfghan": 34605, + "Ġniches": 34606, + "Ġtunnelling": 34607, + "gus": 34608, + "ĠIan": 34609, + "Ġburial": 34610, + "Transform": 34611, + "ocompatible": 34612, + "Ġseldom": 34613, + "Ġdisclosed": 34614, + "âĪķ": 34615, + "Ġrefining": 34616, + "Ġtyph": 34617, + "Ġcooperate": 34618, + "Ġasphalt": 34619, + "ĠConstitution": 34620, + "flavor": 34621, + "Ġwarp": 34622, + "ż": 34623, + "Ġcraw": 34624, + "ĠIndigenous": 34625, + "ĠPrevent": 34626, + "Ġtrigeminal": 34627, + "ĠFriedrich": 34628, + "ĠInterferon": 34629, + "iosity": 34630, + "warm": 34631, + "uson": 34632, + "Ġunderlies": 34633, + "Ġmultiplets": 34634, + "ĠSUPER": 34635, + "ĠManufacturing": 34636, + "Ġvimentin": 34637, + "ramine": 34638, + "Ġefficacious": 34639, + "iced": 34640, + "ĠVall": 34641, + "othorax": 34642, + "Ġaudi": 34643, + "Qs": 34644, + "ĠPAL": 34645, + "ĠHold": 34646, + "hattan": 34647, + "idding": 34648, + "wana": 34649, + "Ġpending": 34650, + "Ġperennial": 34651, + "Ġtouching": 34652, + "xpected": 34653, + "Distance": 34654, + "nav": 34655, + "Ġisomeric": 34656, + "ĠMCI": 34657, + "numbers": 34658, + "Ġreverses": 34659, + "Ġpolycystic": 34660, + "Hem": 34661, + "uities": 34662, + "optional": 34663, + "Ġsubcortical": 34664, + "ĠSupply": 34665, + "ĠCalder": 34666, + "Ġmangrove": 34667, + "Ġpads": 34668, + "urfaces": 34669, + "ĠFaster": 34670, + "Ġunderneath": 34671, + "Ġprolactin": 34672, + "Ġclearer": 34673, + "Ġscintillation": 34674, + "Ġhumidified": 34675, + "ĠWound": 34676, + "ĠHPA": 34677, + "Ġcollapsing": 34678, + "Ġbaryonic": 34679, + "ĠMEASU": 34680, + "ĠGü": 34681, + "Ġdetr": 34682, + "Ġsubstituent": 34683, + "ĠRomania": 34684, + "ĠInvolved": 34685, + "Ġduodenal": 34686, + "ĠAmp": 34687, + "ĠSIS": 34688, + "scher": 34689, + "auth": 34690, + "ĠRespond": 34691, + "ĠRanking": 34692, + "trip": 34693, + "xF": 34694, + "istin": 34695, + "Ġpauc": 34696, + "reflection": 34697, + "Ġcornea": 34698, + "Ġbolus": 34699, + "Ġpivot": 34700, + "October": 34701, + "ĠSERS": 34702, + "ĠXing": 34703, + "ANET": 34704, + "Chinese": 34705, + "ĠMusc": 34706, + "Dynamic": 34707, + "Mesh": 34708, + "Ġdiphosphate": 34709, + "Ġconspecific": 34710, + "lector": 34711, + "ĠEcu": 34712, + "ĠCoverage": 34713, + "ĠãĢĪ": 34714, + "COD": 34715, + "among": 34716, + "Ġposit": 34717, + "imumab": 34718, + "ĠpN": 34719, + "Ġcoaching": 34720, + "exports": 34721, + "Ġrealm": 34722, + "ĠFerreira": 34723, + "Ġnationally": 34724, + "Ġturtle": 34725, + "ubtedly": 34726, + "ĠDraft": 34727, + "Ġendl": 34728, + "ĠContinuum": 34729, + "embeddings": 34730, + "Ġá¹½": 34731, + "ĠCrime": 34732, + "Ġimmigration": 34733, + "ĠFilip": 34734, + "Ġgarnet": 34735, + "Ġobscure": 34736, + "ĠTYPE": 34737, + "Ġultrastructural": 34738, + "caemia": 34739, + "ĠSeman": 34740, + "rink": 34741, + "tiff": 34742, + "uccal": 34743, + "kee": 34744, + "itudinally": 34745, + "ĠAlloy": 34746, + "ĠAnalyzer": 34747, + "continue": 34748, + "ĠAlabama": 34749, + "QOL": 34750, + "Ġpollin": 34751, + "Ġcorrespondences": 34752, + "ĠResol": 34753, + "FIR": 34754, + "ulare": 34755, + "tawa": 34756, + "URCE": 34757, + "Ġurbanization": 34758, + "zd": 34759, + "Ġgloss": 34760, + "ERA": 34761, + "ĠDetermine": 34762, + "Date": 34763, + "ĠPSP": 34764, + "ĠShig": 34765, + "repta": 34766, + "ĠGait": 34767, + "neutrino": 34768, + "Ġpervasive": 34769, + "ĠâĢ¢âĢ¢âĢ¢": 34770, + "Ġhomozyg": 34771, + "Ġadaptively": 34772, + "graphic": 34773, + "ĠJohnston": 34774, + "zt": 34775, + "explicit": 34776, + "Ġhelmin": 34777, + "Ġpes": 34778, + "ARF": 34779, + "ĠFram": 34780, + "ĠAmsterdam": 34781, + "Ġlogarithms": 34782, + "ĠCreative": 34783, + "PageIndex": 34784, + "Ġpacing": 34785, + "ĠPCS": 34786, + "Ġforebrain": 34787, + "ĠCTCF": 34788, + "decomposition": 34789, + "Ġbearings": 34790, + "Ġanhydrous": 34791, + "Ġcb": 34792, + "ĠMON": 34793, + "ĠNodes": 34794, + "strum": 34795, + "ĠJans": 34796, + "Ġdelineate": 34797, + "Ġdichroism": 34798, + "conformal": 34799, + "Ġretreat": 34800, + "glial": 34801, + "Ġnuclease": 34802, + "ĠBaltimore": 34803, + "Ġpaying": 34804, + "Ġboreal": 34805, + "tipation": 34806, + "Root": 34807, + "SQL": 34808, + "sources": 34809, + "endo": 34810, + "ĠOrion": 34811, + "Plus": 34812, + "ĠDEL": 34813, + "ĠThan": 34814, + "Ġmonoph": 34815, + "Ġreflector": 34816, + "Ze": 34817, + "ĠLinking": 34818, + "sync": 34819, + "ĠCREB": 34820, + "national": 34821, + "urized": 34822, + "ĠPeptides": 34823, + "ĠBegin": 34824, + "borg": 34825, + "piperidyl": 34826, + "Ġoverestimation": 34827, + "RGB": 34828, + "TK": 34829, + "Ġbeings": 34830, + "Ġattains": 34831, + "Ġreservation": 34832, + "ĠMotivation": 34833, + "Ġtrimethyl": 34834, + "ĠTerminal": 34835, + "Ġintentional": 34836, + "Negative": 34837, + "ĠCronbach": 34838, + "dorferi": 34839, + "Daw": 34840, + "VAR": 34841, + "dP": 34842, + "imath": 34843, + "overex": 34844, + "Ġfibrotic": 34845, + "Ġsmartphones": 34846, + "Ġontologies": 34847, + "Good": 34848, + "utively": 34849, + "ĠVB": 34850, + "SPE": 34851, + "ĠMcDonald": 34852, + "galaxies": 34853, + "Ġbiochar": 34854, + "ĠEMS": 34855, + "ĠNf": 34856, + "orship": 34857, + "Ġbackscattering": 34858, + "Ġп": 34859, + "Ġanthocyanin": 34860, + "ĠPhoenix": 34861, + "contained": 34862, + "ĠPSII": 34863, + "hlung": 34864, + "ĠLAI": 34865, + "Ġlectures": 34866, + "Ġdispatch": 34867, + "VF": 34868, + "ĠMEC": 34869, + "ĠWes": 34870, + "Ġbackscatter": 34871, + "otite": 34872, + "ĠSRC": 34873, + "Ġcurrency": 34874, + "onyms": 34875, + "aspartate": 34876, + "Ġcoset": 34877, + "ĠCPP": 34878, + "orbing": 34879, + "ĠEmbeddings": 34880, + "ĠSurveys": 34881, + "Ġneurodevelopmental": 34882, + "ĠSRE": 34883, + "ĠInterior": 34884, + "ĠARDS": 34885, + "experiments": 34886, + "bromophenyl": 34887, + "ĠECL": 34888, + "ĠOPE": 34889, + "mediation": 34890, + "Ġthermoc": 34891, + "Ġinterpretable": 34892, + "ĠMicrobiome": 34893, + "eastern": 34894, + "¿": 34895, + "ĠTDP": 34896, + "athon": 34897, + "ĠByzantine": 34898, + "anyon": 34899, + "Ġepitaxy": 34900, + "Ġcriticized": 34901, + "Millipore": 34902, + "ĠDEP": 34903, + "ĠFreedom": 34904, + "junctions": 34905, + "ĠASM": 34906, + "ĠGren": 34907, + "Ġsigning": 34908, + "Ġconstituting": 34909, + "oproterozoic": 34910, + "ĠSynech": 34911, + "ĠVoice": 34912, + "Ġcholecyst": 34913, + "bilities": 34914, + "online": 34915, + "ĠEdd": 34916, + "ĠKup": 34917, + "ĠLett": 34918, + "ĠMarin": 34919, + "ĠGoal": 34920, + "ĠSYM": 34921, + "introduced": 34922, + "naphthyl": 34923, + "ĠLü": 34924, + "Ġmx": 34925, + "Ġblu": 34926, + "Ġrm": 34927, + "ĠDeletion": 34928, + "ĠConnecticut": 34929, + "Coleoptera": 34930, + "try": 34931, + "Ġsoot": 34932, + "ĠCountries": 34933, + "Ġsickle": 34934, + "Meta": 34935, + "ĠSib": 34936, + "ĠHNO": 34937, + "ĠUD": 34938, + "Ġexpr": 34939, + "Ġallowable": 34940, + "ĠIndirect": 34941, + "tisation": 34942, + "Ġadenomas": 34943, + "electronics": 34944, + "RNN": 34945, + "ĠTCF": 34946, + "Ġglucagon": 34947, + "ĠCitation": 34948, + "Ġgamb": 34949, + "andez": 34950, + "Ġtransmits": 34951, + "ajima": 34952, + "Ġholonomy": 34953, + "ìł": 34954, + "actam": 34955, + "ĠThreat": 34956, + "ĠPearl": 34957, + "Ġeruptions": 34958, + "ĠImmunohistochemistry": 34959, + "Yes": 34960, + "patrick": 34961, + "Ġama": 34962, + "Ġdrew": 34963, + "ĠTasks": 34964, + "ĠPIM": 34965, + "Ġdispat": 34966, + "ĠDetroit": 34967, + "Ġcoexist": 34968, + "arboxylase": 34969, + "IBM": 34970, + "ĠTUNEL": 34971, + "ĠUF": 34972, + "ĠANG": 34973, + "Ġsarcopenia": 34974, + "Ġhaptic": 34975, + "Ġcarbonates": 34976, + "Ġmitophagy": 34977, + "Ġcitizen": 34978, + "ĠCONTROL": 34979, + "fif": 34980, + "Ġwi": 34981, + "ĠGLO": 34982, + "ensored": 34983, + "ĠPara": 34984, + "ĠAbdel": 34985, + "oietin": 34986, + "Ġtoe": 34987, + "ĠSQU": 34988, + "ĠRag": 34989, + "Ġxylem": 34990, + "Ġliberal": 34991, + "ĠMargaret": 34992, + "Wa": 34993, + "kp": 34994, + "ĠPEM": 34995, + "ĠDDR": 34996, + "Ġgenotypic": 34997, + "ĠYM": 34998, + "INGS": 34999, + "keras": 35000, + "ĠEducational": 35001, + "ĠCultures": 35002, + "instr": 35003, + "ĠFuchs": 35004, + "agasc": 35005, + "factant": 35006, + "Ġtenth": 35007, + "ABL": 35008, + "Ġpermeable": 35009, + "ĠCameron": 35010, + "BrN": 35011, + "ĠMuller": 35012, + "ĠReversible": 35013, + "wild": 35014, + "Ġfusions": 35015, + "osulf": 35016, + "ĠEoS": 35017, + "ĠKö": 35018, + "detected": 35019, + "ĠCollagen": 35020, + "Ġdescendants": 35021, + "election": 35022, + "arange": 35023, + "Ġbounce": 35024, + "Ġcontag": 35025, + "Invalid": 35026, + "ĠCoating": 35027, + "tasks": 35028, + "arma": 35029, + "ĠKC": 35030, + "Ġdiar": 35031, + "ĠSuppress": 35032, + "Ġfractionated": 35033, + "Ġsnail": 35034, + "Ġmicrophone": 35035, + "ĠScienti": 35036, + "Ġchemiluminescence": 35037, + "software": 35038, + "Ġburgdorferi": 35039, + "Ġboot": 35040, + "ĠCSCs": 35041, + "ĠMSI": 35042, + "tsev": 35043, + "Ġheater": 35044, + "fractal": 35045, + "Ġendosomes": 35046, + "Uniform": 35047, + "Ġathlete": 35048, + "ĠDriven": 35049, + "Ġvivax": 35050, + "Kind": 35051, + "satisfies": 35052, + "Ġcorticosteroid": 35053, + "ĠEstablishment": 35054, + "calibration": 35055, + "Ġdimeric": 35056, + "Ġcereal": 35057, + "ĠSupervised": 35058, + "ĠSPM": 35059, + "MBER": 35060, + "Ġhemispheres": 35061, + "Ġpercentiles": 35062, + "Leu": 35063, + "Major": 35064, + "Ġexagger": 35065, + "ĠdsRNA": 35066, + "December": 35067, + "ĠZrO": 35068, + "Ġasymmetrical": 35069, + "ĠVAS": 35070, + "ĠJM": 35071, + "Ġintegrations": 35072, + "Ġhandover": 35073, + "Cycl": 35074, + "implant": 35075, + "Ġquote": 35076, + "Ġcyclone": 35077, + "ĠStephan": 35078, + "ĠFranco": 35079, + "Ġawake": 35080, + "Ġfeeder": 35081, + "CHAR": 35082, + "Condition": 35083, + "ĠCharl": 35084, + "ĠBrigade": 35085, + "Ġremediation": 35086, + "cig": 35087, + "ĠBohr": 35088, + "ĠVacuum": 35089, + "ĠToxoplasma": 35090, + "Ġghrelin": 35091, + "ĠTRAF": 35092, + "aye": 35093, + "Client": 35094, + "iliation": 35095, + "xyz": 35096, + "mingham": 35097, + "ĠSUB": 35098, + "ïĢł": 35099, + "Ġconversions": 35100, + "Ġmultipath": 35101, + "missive": 35102, + "Ġeqn": 35103, + "bulk": 35104, + "myc": 35105, + "Ġexacerbated": 35106, + "ت": 35107, + "Ġproteinase": 35108, + "Ġbuilder": 35109, + "ahara": 35110, + "Ġinvert": 35111, + "ĠReception": 35112, + "axanthin": 35113, + "Ġprimed": 35114, + "Ġcopula": 35115, + "Ġproceedings": 35116, + "Ġnondegenerate": 35117, + "Ġintox": 35118, + "Ġneedles": 35119, + "lengths": 35120, + "Ġtransposon": 35121, + "hon": 35122, + "ĠTPC": 35123, + "pland": 35124, + "oxyn": 35125, + "ICH": 35126, + "Ġintrauterine": 35127, + "Ġlaminated": 35128, + "ĠOBSERV": 35129, + "Match": 35130, + "ĠInsur": 35131, + "ĠAmyloid": 35132, + "Ġwarped": 35133, + "ematical": 35134, + "ĠPractices": 35135, + "ãģ®": 35136, + "ĠBrassica": 35137, + "Ġhyperthermia": 35138, + "Ġdn": 35139, + "ĠLIF": 35140, + "ĠMetropolitan": 35141, + "ĠBrdU": 35142, + "impact": 35143, + "filtered": 35144, + "ĠReagent": 35145, + "vp": 35146, + "ĠTip": 35147, + "ĠProportional": 35148, + "Ġbloodstream": 35149, + "Simple": 35150, + "Ġtyros": 35151, + "ĠHenri": 35152, + "Ġretrotrans": 35153, + "aciens": 35154, + "Ġmistakes": 35155, + "acylglycerol": 35156, + "ĠMirror": 35157, + "VERSION": 35158, + "vre": 35159, + "Ġbact": 35160, + "ocked": 35161, + "epsis": 35162, + "Ġsonication": 35163, + "ĠPurkinje": 35164, + "Ġmismatches": 35165, + "ĠAOD": 35166, + "Ġhypergraph": 35167, + "ĠMiami": 35168, + "ammed": 35169, + "Ġconversely": 35170, + "ĠGabor": 35171, + "ĠGDM": 35172, + "Ġcoiled": 35173, + "onica": 35174, + "Ġevolutions": 35175, + "ĠRBM": 35176, + "ĠReef": 35177, + "ĠAbram": 35178, + "ĠPrecise": 35179, + "increase": 35180, + "ĠPlatelet": 35181, + "Generator": 35182, + "Arch": 35183, + "ĠBened": 35184, + "preceq": 35185, + "measurable": 35186, + "CAS": 35187, + "ĠTourn": 35188, + "Ġgiants": 35189, + "Ġeddies": 35190, + "Ġcolumnar": 35191, + "aggregation": 35192, + "Ġzirconia": 35193, + "ducibility": 35194, + "Ġservo": 35195, + "Ġbeauty": 35196, + "Ġheap": 35197, + "ĠâĪĴâĪĴâĪĴ": 35198, + "Ġconductivities": 35199, + "Ġdarkness": 35200, + "Ġoccupying": 35201, + "ĠClean": 35202, + "bash": 35203, + "ulans": 35204, + "appy": 35205, + "ĠMarker": 35206, + "runtime": 35207, + "Ġhaemoglobin": 35208, + "Ġdesktop": 35209, + "mis": 35210, + "ĠSof": 35211, + "osse": 35212, + "Ġcomoving": 35213, + "Ġclutter": 35214, + "ourced": 35215, + "Ġsubj": 35216, + "arching": 35217, + "ĠSolomon": 35218, + "locking": 35219, + "Ġparap": 35220, + "Ġrotator": 35221, + "ĠACKNOWLEDGMENTS": 35222, + "Ter": 35223, + "yster": 35224, + "ĠWebb": 35225, + "Ġsubsample": 35226, + "osilicate": 35227, + "Training": 35228, + "orpha": 35229, + "Ġtimeout": 35230, + "otinamide": 35231, + "ĠFabry": 35232, + "ĠReceiver": 35233, + "Ġconjunctiv": 35234, + "ĠEcuador": 35235, + "ĠIda": 35236, + "Ġcasein": 35237, + "Ġïģ¸": 35238, + "ĠBarn": 35239, + "ĠSchools": 35240, + "elona": 35241, + "dip": 35242, + "ĠChrys": 35243, + "ICI": 35244, + "Ġposteriori": 35245, + "Ġbleaching": 35246, + "ĠPersonality": 35247, + "umbers": 35248, + "ĠModes": 35249, + "Ġnotification": 35250, + "Ġsupine": 35251, + "alued": 35252, + "keep": 35253, + "ĠFranz": 35254, + "Ġwounded": 35255, + "YL": 35256, + "Ġdilemma": 35257, + "ĠClara": 35258, + "ĠCarroll": 35259, + "Ġsickness": 35260, + "Ġproxies": 35261, + "ecks": 35262, + "ĠÏ«": 35263, + "Ġplanting": 35264, + "Ġciphertext": 35265, + "ĠFamilies": 35266, + "iesel": 35267, + "Ġincongru": 35268, + "ĠExcitation": 35269, + "Ġconferred": 35270, + "ĠButter": 35271, + "Impl": 35272, + "collision": 35273, + "idol": 35274, + "Ġacquires": 35275, + "ĠOwen": 35276, + "SAM": 35277, + "ĠGUT": 35278, + "lects": 35279, + "Ġdeleg": 35280, + "Shot": 35281, + "Ġanthrac": 35282, + "Russian": 35283, + "ĠPCE": 35284, + "ĠâĥĹ": 35285, + "ĠKab": 35286, + "NAC": 35287, + "Ġargparse": 35288, + "ĠViol": 35289, + "Ġanticoagulation": 35290, + "Ġcredibility": 35291, + "Ġrotavirus": 35292, + "ĠInvest": 35293, + "Ġrecol": 35294, + "variety": 35295, + "Ġdeformable": 35296, + "Ġenergetics": 35297, + "Ġconsultations": 35298, + "letics": 35299, + "ĠFoss": 35300, + "ĠLIGO": 35301, + "php": 35302, + "ĠChal": 35303, + "ĠMalawi": 35304, + "Ġstrokes": 35305, + "horm": 35306, + "Ġbs": 35307, + "Ġplural": 35308, + "strategy": 35309, + "Ġmisalignment": 35310, + "previous": 35311, + "filters": 35312, + "ĠDemographics": 35313, + "deterministic": 35314, + "Ġcyclophosphamide": 35315, + "Ġstreak": 35316, + "ĠBiosynthesis": 35317, + "Ġsubcutaneously": 35318, + "jn": 35319, + "Ġampicillin": 35320, + "ĠChag": 35321, + "iformes": 35322, + "IFICATION": 35323, + "Ġyourself": 35324, + "Ġtolerability": 35325, + "Ġautocl": 35326, + "rhs": 35327, + "Ġpupils": 35328, + "Ġgauged": 35329, + "Lay": 35330, + "ĠSanti": 35331, + "ĠDBP": 35332, + "ĠGary": 35333, + "drive": 35334, + "Ġtrustworth": 35335, + "Ġcontingency": 35336, + "Cube": 35337, + "Host": 35338, + "fu": 35339, + "Ġhsa": 35340, + "issner": 35341, + "ITT": 35342, + "ĠSrTiO": 35343, + "Ġcounselling": 35344, + "integrable": 35345, + "Ġunderway": 35346, + "Ġstandardised": 35347, + "bius": 35348, + "Firstly": 35349, + "Ġporphyrin": 35350, + "Area": 35351, + "iw": 35352, + "Ġub": 35353, + "ĠLynch": 35354, + "ĠWBC": 35355, + "ilden": 35356, + "Ġhomeless": 35357, + "Ġmagnetosphere": 35358, + "Ġnighttime": 35359, + "ncbi": 35360, + "Ġdownt": 35361, + "lethal": 35362, + "Ġinterim": 35363, + "ĠResil": 35364, + "Ġcontinually": 35365, + "ĠImmunofluorescence": 35366, + "Design": 35367, + "Ġadvocate": 35368, + "reptavidin": 35369, + "fw": 35370, + "story": 35371, + "ĠPSS": 35372, + "Ġfiled": 35373, + "Ġbedrock": 35374, + "Ġisoflurane": 35375, + "Ġreluct": 35376, + "eward": 35377, + "ĠIndependence": 35378, + "ĠBurkholder": 35379, + "Ġcinn": 35380, + "Ġcaptive": 35381, + "Ġcomposing": 35382, + "Ġrestraint": 35383, + "Ġquestionable": 35384, + "ĠTomato": 35385, + "Ġzeroth": 35386, + "rins": 35387, + "omez": 35388, + "Ġglia": 35389, + "ĠGlac": 35390, + "Independent": 35391, + "Ġobjectively": 35392, + "pA": 35393, + "Ġfavoring": 35394, + "ipelago": 35395, + "Ġincontinence": 35396, + "bium": 35397, + "ĠLZ": 35398, + "ĠLed": 35399, + "hexyl": 35400, + "Ġceased": 35401, + "Ġoleic": 35402, + "ĠImpairment": 35403, + "Ñĸ": 35404, + "ongo": 35405, + "Ġrunner": 35406, + "Ġcucumber": 35407, + "ĠPerform": 35408, + "Ġdoublets": 35409, + "Ġeigenfunction": 35410, + "Ġ̺": 35411, + "ĠHenderson": 35412, + "Klein": 35413, + "Tab": 35414, + "Ġbeer": 35415, + "ocom": 35416, + "unciation": 35417, + "------": 35418, + "ĠTSC": 35419, + "ogas": 35420, + "Ġrud": 35421, + "Ġincis": 35422, + "ĠLOG": 35423, + "FBQ": 35424, + "Ġinterconnection": 35425, + "î": 35426, + "arbox": 35427, + "ĠIBS": 35428, + "ĠNCT": 35429, + "ĠGand": 35430, + "Ġyaw": 35431, + "ĠTransverse": 35432, + "ĠSudan": 35433, + "Ġconstriction": 35434, + "Hor": 35435, + "Ġevasion": 35436, + "Ġmeromorphic": 35437, + "ĠPBMC": 35438, + "IUM": 35439, + "reed": 35440, + "ĠBö": 35441, + "ĠEMB": 35442, + "ukh": 35443, + "Ġwinners": 35444, + "Ġascites": 35445, + "Mes": 35446, + "Ġeclipse": 35447, + "ĠEocene": 35448, + "adiazol": 35449, + "Ġrecoveries": 35450, + "Starting": 35451, + "rema": 35452, + "ĠÃİ": 35453, + "monotonic": 35454, + "ĠMeOH": 35455, + "ĠFlood": 35456, + "Ġwatching": 35457, + "GTP": 35458, + "iel": 35459, + "müller": 35460, + "åħ": 35461, + "Ġpolyphenol": 35462, + "ĠLMI": 35463, + "redit": 35464, + "therm": 35465, + "Ġneurite": 35466, + "Quantum": 35467, + "rachlor": 35468, + "ĠRubin": 35469, + "Ġbfnm": 35470, + "Are": 35471, + "arachn": 35472, + "Ġduck": 35473, + "ĠTrajectory": 35474, + "ĠNitric": 35475, + "lv": 35476, + "uid": 35477, + "imag": 35478, + "ĠMULT": 35479, + "Ġgenre": 35480, + "arie": 35481, + "Ġtrifluor": 35482, + "ĠCorpus": 35483, + "oliosis": 35484, + "ĠCCK": 35485, + "Kit": 35486, + "father": 35487, + "Ġtennis": 35488, + "itsch": 35489, + "HCV": 35490, + "lantic": 35491, + "ĠAQ": 35492, + "izu": 35493, + "astatin": 35494, + "othio": 35495, + "ĠAnatomy": 35496, + "Ġáŀ": 35497, + "globulin": 35498, + "Ġinterpol": 35499, + "Ġtunnels": 35500, + "Ġnatri": 35501, + "imed": 35502, + "ĠDew": 35503, + "Ġsubscripts": 35504, + "tites": 35505, + "Ġhistologically": 35506, + "Opt": 35507, + "xn": 35508, + "Ġresampling": 35509, + "aney": 35510, + "Ġtrast": 35511, + "Ġsinensis": 35512, + "Ġsenescent": 35513, + "Fast": 35514, + "Ġhampered": 35515, + "Ġblocker": 35516, + "ushima": 35517, + "Ġhospitalizations": 35518, + "Lim": 35519, + "oons": 35520, + "ÿ": 35521, + "ĠAPS": 35522, + "ĠYok": 35523, + "ĠZam": 35524, + "Ġexperimenter": 35525, + "ĠDisks": 35526, + "Ġà¬": 35527, + "ĠScop": 35528, + "ĠAph": 35529, + "ĠParents": 35530, + "ĠPlots": 35531, + "ĠCONT": 35532, + "ĠÐĪ": 35533, + "Ġhomologue": 35534, + "ĠCooling": 35535, + "reth": 35536, + "Ġovari": 35537, + "ĠTamil": 35538, + "vrule": 35539, + "ĠPCP": 35540, + "arious": 35541, + "Active": 35542, + "oprotection": 35543, + "ĠAlfv": 35544, + "Ġinfra": 35545, + "ĠCoherence": 35546, + "closures": 35547, + "hydroxymethyl": 35548, + "EH": 35549, + "Ġmaser": 35550, + "ĠNIST": 35551, + "leck": 35552, + "concat": 35553, + "Ġtraine": 35554, + "Ġmixes": 35555, + "Ġribosomes": 35556, + "lia": 35557, + "puls": 35558, + "Ġascer": 35559, + "ĠBanks": 35560, + "ellin": 35561, + "applied": 35562, + "Ġclips": 35563, + "Ġmetap": 35564, + "Ġcopro": 35565, + "Ġepidid": 35566, + "ĠEpidemiological": 35567, + "ĠNicholas": 35568, + "ĠKings": 35569, + "Ġlarva": 35570, + "BsAg": 35571, + "ĠSánchez": 35572, + "ĠâĪİ": 35573, + "AMD": 35574, + "ĠHao": 35575, + "ĠBillboard": 35576, + "ĠAboriginal": 35577, + "Ġnylon": 35578, + "ĠNAN": 35579, + "cores": 35580, + "ĠCrop": 35581, + "Ġcommittees": 35582, + "Ġdihedral": 35583, + "ĠJuli": 35584, + "ĠAndy": 35585, + "hydration": 35586, + "corresponds": 35587, + "Mut": 35588, + "Ġtorn": 35589, + "ĠFEV": 35590, + "Ġxs": 35591, + "amphen": 35592, + "Ġsummarization": 35593, + "ĠErg": 35594, + "ËĨ": 35595, + "ĠJunction": 35596, + "ancouver": 35597, + "ĠExamining": 35598, + "ĠMarco": 35599, + "Pointer": 35600, + "Ġscarcity": 35601, + "uncing": 35602, + "Ġbijective": 35603, + "ĠMaine": 35604, + "ĠRHIC": 35605, + "Ġtowers": 35606, + "Ġgentamicin": 35607, + "Ġtonic": 35608, + "ĠkT": 35609, + "Ġclimbing": 35610, + "Ġrecruits": 35611, + "ĠHotel": 35612, + "ĠJews": 35613, + "ĠRUNX": 35614, + "Ġaustenite": 35615, + "ĠOfficer": 35616, + "inent": 35617, + "ucc": 35618, + "ĠBidirectional": 35619, + "Ġmayor": 35620, + "ĠAssays": 35621, + "ĠERG": 35622, + "SNPs": 35623, + "dine": 35624, + "China": 35625, + "starting": 35626, + "Ġirrational": 35627, + "ĠDIFFE": 35628, + "Ġmilliseconds": 35629, + "Lik": 35630, + "inone": 35631, + "ĠâģĦ": 35632, + "Ġconspicuous": 35633, + "Ġsurplus": 35634, + "ĠXiong": 35635, + "Ġupgrade": 35636, + "Ġtimep": 35637, + "ĠÄĮ": 35638, + "TeV": 35639, + "orbidities": 35640, + "invalid": 35641, + "Ġvide": 35642, + "terra": 35643, + "Ġantin": 35644, + "emens": 35645, + "ocese": 35646, + "ĠKI": 35647, + "Ġevolutionarily": 35648, + "Ker": 35649, + "ĠLES": 35650, + "clamp": 35651, + "Ġslowed": 35652, + "glycoprotein": 35653, + "entieth": 35654, + "Ġabroad": 35655, + "Ġinterpolating": 35656, + "Ġcatalyze": 35657, + "ĠBelgian": 35658, + "Ġphotographed": 35659, + "Ġpector": 35660, + "ĠSIV": 35661, + "ĠELECT": 35662, + "Ġdesal": 35663, + "oneph": 35664, + "ĠClos": 35665, + "Ġaffordable": 35666, + "birds": 35667, + "gom": 35668, + "Ġrr": 35669, + "Ġuni": 35670, + "ĠGenus": 35671, + "ĠRegge": 35672, + "ĠMultidimensional": 35673, + "Ġpsychopathology": 35674, + "Ġcertification": 35675, + "Pattern": 35676, + "ĠTower": 35677, + "Ġstern": 35678, + "Ġsublattice": 35679, + "Ġgrat": 35680, + "Ġlyrics": 35681, + "fmt": 35682, + "oceptive": 35683, + "ĠdP": 35684, + "ĠHolmes": 35685, + "Ġbudgets": 35686, + "Ġeutectic": 35687, + "ĠPv": 35688, + "ĠGott": 35689, + "Ġdisinfection": 35690, + "Ġretinoic": 35691, + "ĠObst": 35692, + "Ġreplen": 35693, + "Ġâĸł": 35694, + "Kutta": 35695, + "Please": 35696, + "ĠCAG": 35697, + "ĠStir": 35698, + "speaking": 35699, + "Ġinsecticides": 35700, + "ĠFungi": 35701, + "Hod": 35702, + "RON": 35703, + "coil": 35704, + "ĠVisible": 35705, + "Ġinception": 35706, + "ĠeGFR": 35707, + "Ġreionization": 35708, + "Ġdomination": 35709, + "ĠMetro": 35710, + "Ġswept": 35711, + "MDS": 35712, + "Ġsubsidence": 35713, + "ĠFalls": 35714, + "ĠDrum": 35715, + "ĠConserved": 35716, + "ĠMyers": 35717, + "Ġadaptability": 35718, + "Ġlyophil": 35719, + "ulina": 35720, + "arelli": 35721, + "ocycles": 35722, + "ĠSOA": 35723, + "ĠdsDNA": 35724, + "ĠCEO": 35725, + "Ġanchoring": 35726, + "Ġdeactivation": 35727, + "yler": 35728, + "Ġinterestingly": 35729, + "Ġiliac": 35730, + "ĠBorg": 35731, + "ĠPTC": 35732, + "ocyanin": 35733, + "Ġunused": 35734, + "ĠCarrier": 35735, + "Which": 35736, + "Ġintervening": 35737, + "Ġprivile": 35738, + "hit": 35739, + "Ġcheaper": 35740, + "ĠCyclin": 35741, + "plying": 35742, + "ĠCleveland": 35743, + "ĠHahn": 35744, + "Ġagglut": 35745, + "ĠAnch": 35746, + "ĠRedox": 35747, + "Will": 35748, + "ĠLinn": 35749, + "rones": 35750, + "ĠNewcastle": 35751, + "ĠExpected": 35752, + "ĠOpportunities": 35753, + "ĠLarger": 35754, + "Ġleach": 35755, + "Ġpepper": 35756, + "Sha": 35757, + "sector": 35758, + "you": 35759, + "Ġreplications": 35760, + "cholesterolem": 35761, + "ĠInvasion": 35762, + "Ġbony": 35763, + "ĠHuber": 35764, + "thend": 35765, + "Ġrealised": 35766, + "Ġinvestments": 35767, + "Cataly": 35768, + "ĠWitt": 35769, + "ĠKai": 35770, + "Ġetched": 35771, + "ĠSTEM": 35772, + "Ġexcludes": 35773, + "Exec": 35774, + "ĠStrongly": 35775, + "ĠSymposium": 35776, + "ĠTuberculosis": 35777, + "ilance": 35778, + "ĠRIS": 35779, + "apia": 35780, + "ensated": 35781, + "neb": 35782, + "ĠChains": 35783, + "Ġenthus": 35784, + "quadrup": 35785, + "decl": 35786, + "Ġbinned": 35787, + "Ġsynergistically": 35788, + "Ġgauges": 35789, + "whether": 35790, + "disease": 35791, + "Western": 35792, + "Ġhypothermia": 35793, + "ĠGardner": 35794, + "Ġaberration": 35795, + "Rod": 35796, + "Íĺ": 35797, + "Ġfd": 35798, + "Ġstood": 35799, + "Ġconditionally": 35800, + "Ġthrombol": 35801, + "PSC": 35802, + "Ġmk": 35803, + "ĠTER": 35804, + "odds": 35805, + "ĠKri": 35806, + "ĠIVF": 35807, + "Ġmites": 35808, + "ĠCHE": 35809, + "Ġqq": 35810, + "ĠInfants": 35811, + "ĠCharlot": 35812, + "becco": 35813, + "etom": 35814, + "ĠCDS": 35815, + "Ġarchaeal": 35816, + "ĠHNSCC": 35817, + "Ġmonodromy": 35818, + "amphenicol": 35819, + "apers": 35820, + "reactivity": 35821, + "Ġunderm": 35822, + "Internal": 35823, + "ĠLandsat": 35824, + "German": 35825, + "Ġcervix": 35826, + "idazole": 35827, + "ĠSketch": 35828, + "ĠLAM": 35829, + "ĠNerve": 35830, + "ĠTeh": 35831, + "Ġmussel": 35832, + "з": 35833, + "ĠMicroarray": 35834, + "wei": 35835, + "Ġwhey": 35836, + "Ġmixer": 35837, + "Ġreconfigurable": 35838, + "Ġvasculitis": 35839, + "Ġkwargs": 35840, + "Ġreus": 35841, + "correlations": 35842, + "Ġwoody": 35843, + "carbonate": 35844, + "ectomized": 35845, + "Ġretrans": 35846, + "Ġcytometric": 35847, + "ĠWildlife": 35848, + "ĠAnswering": 35849, + "Ġpencil": 35850, + "ĠDAS": 35851, + "akrish": 35852, + "CEPT": 35853, + "ĠÄĿ": 35854, + "ĠPersian": 35855, + "converting": 35856, + "Ġcater": 35857, + "Ġmeanwhile": 35858, + "TPA": 35859, + "Ġrum": 35860, + "ĠGros": 35861, + "upe": 35862, + "Ġregurg": 35863, + "Ġpenalties": 35864, + "Positive": 35865, + "****************************************************************************": 35866, + "XF": 35867, + "eenth": 35868, + "ĠCory": 35869, + "odulation": 35870, + "Ġquorum": 35871, + "codes": 35872, + "aram": 35873, + "ĠTSA": 35874, + "ĠPn": 35875, + "âĪij": 35876, + "prison": 35877, + "Ġconfidentiality": 35878, + "EPS": 35879, + "Xiv": 35880, + "iensis": 35881, + "estones": 35882, + "ĠZag": 35883, + "Ġpredecessor": 35884, + "Ġprize": 35885, + "Ġâݨ": 35886, + "steroidal": 35887, + "opard": 35888, + "Ġimpractical": 35889, + "Ġdemonstrations": 35890, + "Ġpredisposition": 35891, + "Ġkk": 35892, + "Ġmodifiers": 35893, + "Ġpreca": 35894, + "Ġexecutes": 35895, + "Ġbinning": 35896, + "Ġpedig": 35897, + "ĠKLF": 35898, + "ĠSkeletal": 35899, + "ĠCIN": 35900, + "atured": 35901, + "Ġdecomposes": 35902, + "Ġaphid": 35903, + "Bern": 35904, + "Pur": 35905, + "ĠEPO": 35906, + "merge": 35907, + "ĠCOSM": 35908, + "amyloid": 35909, + "monia": 35910, + "ĠScores": 35911, + "ĠRegistration": 35912, + "ĠAgrobacterium": 35913, + "Ġenterprises": 35914, + "locality": 35915, + "ĠITO": 35916, + "Ġtess": 35917, + "Ġfcc": 35918, + "ĠNc": 35919, + "Ġcoaxial": 35920, + "ĠAdvant": 35921, + "APC": 35922, + "ĠDemand": 35923, + "adjust": 35924, + "Points": 35925, + "Ġheterostructure": 35926, + "iffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiff": 35927, + "DQ": 35928, + "Ġtensions": 35929, + "abund": 35930, + "ĠHutch": 35931, + "brew": 35932, + "Ġvitreous": 35933, + "ĠEZH": 35934, + "Ġmerc": 35935, + "Ġdebated": 35936, + "Ġpalate": 35937, + "ocolate": 35938, + "Ġevapotranspiration": 35939, + "ĠẼ": 35940, + "ĠHoffman": 35941, + "ĠGALAXIES": 35942, + "CAL": 35943, + "caps": 35944, + "legal": 35945, + "died": 35946, + "ĠIsolates": 35947, + "Ġaggrav": 35948, + "qs": 35949, + "ĠICT": 35950, + "Ġseals": 35951, + "Ġspinel": 35952, + "ĠGeor": 35953, + "Blue": 35954, + "Ġureter": 35955, + "spline": 35956, + "ĠIntroducing": 35957, + "thendieck": 35958, + "opper": 35959, + "Ġafterglow": 35960, + "Ġendosomal": 35961, + "Ġrealizes": 35962, + "solving": 35963, + "Ġmistake": 35964, + "ĠAtheros": 35965, + "ĠSBS": 35966, + "ĠRut": 35967, + "exist": 35968, + "Prof": 35969, + "ĠNeisser": 35970, + "MSG": 35971, + "ĠEarlier": 35972, + "ĠdT": 35973, + "ĠSpread": 35974, + "ĠReflection": 35975, + "secondary": 35976, + "approximate": 35977, + "Ġnigra": 35978, + "Solution": 35979, + "anone": 35980, + "ĠItems": 35981, + "Ġwavelets": 35982, + "ĠSoluble": 35983, + "Ġcircularly": 35984, + "ĠCUDA": 35985, + "Ġregenerated": 35986, + "SPI": 35987, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 35988, + "aturing": 35989, + "REQ": 35990, + "Ġinteroper": 35991, + "reev": 35992, + "ONT": 35993, + "ischen": 35994, + "ĠChoosing": 35995, + "phosphorylated": 35996, + "áĪ": 35997, + "Ġdress": 35998, + "ĠConform": 35999, + "Ġrememb": 36000, + "Ġischaemic": 36001, + "Basic": 36002, + "ĠPang": 36003, + "Ġcrit": 36004, + "ĠOrn": 36005, + "Ġgm": 36006, + "ĠFog": 36007, + "ĠBd": 36008, + "racheal": 36009, + "Ġphenols": 36010, + "ĠDistingu": 36011, + "Ġâİ©": 36012, + "ĠGRBs": 36013, + "ĠCeO": 36014, + "ĠBiomass": 36015, + "Ġaptamer": 36016, + "visc": 36017, + "hetically": 36018, + "Ġsid": 36019, + "omeg": 36020, + "Ġproportionality": 36021, + "ÃŃs": 36022, + "toplasmic": 36023, + "ĠConnected": 36024, + "Ġlaminin": 36025, + "strahlung": 36026, + "ĠLad": 36027, + "TRAN": 36028, + "är": 36029, + "Ġbasalt": 36030, + "ĠCurvature": 36031, + "Ġmitigating": 36032, + "opaedic": 36033, + "ĠMuhammad": 36034, + "CAR": 36035, + "Gi": 36036, + "Ġetch": 36037, + "hair": 36038, + "Ġpurine": 36039, + "Ġbenchmarking": 36040, + "reich": 36041, + "Ġmethicillin": 36042, + "âĪ¥": 36043, + "Ġmanages": 36044, + "solvent": 36045, + "ĠShao": 36046, + "hc": 36047, + "Ġstruck": 36048, + "Ġnucleosome": 36049, + "ĠPublication": 36050, + "Metric": 36051, + "Ġwines": 36052, + "ĠMBL": 36053, + "ĠHub": 36054, + "ĠAssistant": 36055, + "Ġreliance": 36056, + "Ġrouters": 36057, + "ĠHerz": 36058, + "ĠTobacco": 36059, + "rogram": 36060, + "ĠHSD": 36061, + "ĠLBP": 36062, + "Ġinflection": 36063, + "school": 36064, + "Ġsponsored": 36065, + "ĠCenozoic": 36066, + "Ġentertainment": 36067, + "atian": 36068, + "architecture": 36069, + "browse": 36070, + "REC": 36071, + "isture": 36072, + "ĠCholesterol": 36073, + "ĠSimplified": 36074, + "Ġpolypeptides": 36075, + "Ġpunctures": 36076, + "arachnoid": 36077, + "Self": 36078, + "Ġanorexia": 36079, + "ĠOle": 36080, + "ĉĉĠĠĠĠ": 36081, + "GBT": 36082, + "Ġcardiomyocyte": 36083, + "ĠFloquet": 36084, + "analog": 36085, + "Ġsensitized": 36086, + "ĠCephe": 36087, + "catch": 36088, + "chial": 36089, + "Ġceremony": 36090, + "Ġterat": 36091, + "Ġameliorate": 36092, + "olysin": 36093, + "etooth": 36094, + "akin": 36095, + "haem": 36096, + "Ġentropies": 36097, + "Ġargu": 36098, + "Ġcopied": 36099, + "lington": 36100, + "ĠHerpes": 36101, + "ĠSchwann": 36102, + "yk": 36103, + "ĠCEA": 36104, + "ĠICH": 36105, + "Ġwrink": 36106, + "Ġrunners": 36107, + "Ġgalvan": 36108, + "Ġconsolidated": 36109, + "ĠâĢ¡": 36110, + "ĠClassic": 36111, + "Ġepidemiologic": 36112, + "ĠDriving": 36113, + "Ġtrastuzumab": 36114, + "CYP": 36115, + "NCT": 36116, + "tability": 36117, + "Ġslee": 36118, + "ĠNeck": 36119, + "Ġassesses": 36120, + "Ġsymmetrically": 36121, + "ĠPotts": 36122, + "ĠRibosomal": 36123, + "diction": 36124, + "gall": 36125, + "ĠAcceleration": 36126, + "CLA": 36127, + "ACTER": 36128, + "xed": 36129, + "Ġgeriatric": 36130, + "threonine": 36131, + "Ġabort": 36132, + "Ġartem": 36133, + "ĠDisney": 36134, + "ĠCorrespondence": 36135, + "Ġrent": 36136, + "ĠNUM": 36137, + "ĠChun": 36138, + "ĠRecogn": 36139, + "Ġcrystallized": 36140, + "Ġcontradicting": 36141, + "visors": 36142, + "malignant": 36143, + "rophysiology": 36144, + "Infrared": 36145, + "gz": 36146, + "Ġsublim": 36147, + "omatosis": 36148, + "osyltransferase": 36149, + "Ġholography": 36150, + "orenstein": 36151, + "¾±": 36152, + "ĠSebas": 36153, + "accum": 36154, + "Upper": 36155, + "antenna": 36156, + "Ġblur": 36157, + "Ġsmell": 36158, + "Ġthreefold": 36159, + "ĠPlayers": 36160, + "Ġalleviated": 36161, + "Bin": 36162, + "Ġninet": 36163, + "ĠDna": 36164, + "Ġgeneralizing": 36165, + "Ġbreakage": 36166, + "ĠMorrison": 36167, + "macro": 36168, + "Reader": 36169, + "ogravimetric": 36170, + "Ġdh": 36171, + "lew": 36172, + "xton": 36173, + "Ġdeceleration": 36174, + "ĠCorrelated": 36175, + "ĠLegion": 36176, + "Ġgambling": 36177, + "Binding": 36178, + "ĠInAs": 36179, + "lowering": 36180, + "Ġeuthanized": 36181, + "ĠDallas": 36182, + "ĠDw": 36183, + "ĠDijk": 36184, + "ĠPolic": 36185, + "ĠTIME": 36186, + "ĠHEL": 36187, + "ĠLanguages": 36188, + "Ġparabol": 36189, + "porating": 36190, + "Ġfrustration": 36191, + "μM": 36192, + "balls": 36193, + "ĠArmstrong": 36194, + "Ġcontractility": 36195, + "Ġmetalloproteinases": 36196, + "americ": 36197, + "ĠZak": 36198, + "ĠCosts": 36199, + "Alex": 36200, + "dog": 36201, + "pw": 36202, + "ĠTight": 36203, + "ĠAnterior": 36204, + "Ġpeaking": 36205, + "Ġnegativity": 36206, + "Ġhydride": 36207, + "ĠLiv": 36208, + "Ġsterilized": 36209, + "Ġverbatim": 36210, + "Alternatively": 36211, + "REQU": 36212, + "ĠTyphimurium": 36213, + "ĠWeinberg": 36214, + "DSC": 36215, + "rq": 36216, + "Ġcorrug": 36217, + "Ġmicrons": 36218, + "coord": 36219, + "ioid": 36220, + "sat": 36221, + "Ġflocc": 36222, + "ĠAccelerated": 36223, + "Ġsixteen": 36224, + "absence": 36225, + "ĠSpeaker": 36226, + "omological": 36227, + "ĠApr": 36228, + "Ġmatroid": 36229, + "tight": 36230, + "ogenetically": 36231, + "rump": 36232, + "ĠInhibits": 36233, + "ĠOlympus": 36234, + "Ġpossession": 36235, + "Ġsupervisor": 36236, + "Ġconcise": 36237, + "optimized": 36238, + "vivo": 36239, + "Ġstepped": 36240, + "ocyanine": 36241, + "Five": 36242, + "anas": 36243, + "arten": 36244, + "ĠCaco": 36245, + "Ġsolutes": 36246, + "ITAL": 36247, + "ĠReddy": 36248, + "Ġwarping": 36249, + "Ġoligomer": 36250, + "Ġcapped": 36251, + "Ġvoted": 36252, + "ĠRico": 36253, + "ĠTrem": 36254, + "Ġlime": 36255, + "ĠISP": 36256, + "ĠLayers": 36257, + "skin": 36258, + "ranged": 36259, + "áz": 36260, + "Ġbioactivity": 36261, + "Ġdurable": 36262, + "Ġhn": 36263, + "ĠCAB": 36264, + "Ġva": 36265, + "ĠUWB": 36266, + "ĠStuart": 36267, + "Ġlengthy": 36268, + "Ġinvasiveness": 36269, + "ĠâĩĶ": 36270, + "joining": 36271, + "ĠRBCs": 36272, + "Ġresilient": 36273, + "ĠManipulation": 36274, + "Germ": 36275, + "contribution": 36276, + "Ġqualify": 36277, + "ĠDashed": 36278, + "Ġaccelerations": 36279, + "ĠCytochrome": 36280, + "Ġcircumstellar": 36281, + "cavity": 36282, + "Ġanatase": 36283, + "ĠDevi": 36284, + "Ġpursu": 36285, + "ĠMicroRNAs": 36286, + "Ġnorthward": 36287, + "Ġsunflower": 36288, + "ĠEntertainment": 36289, + "Pacific": 36290, + "ĠHolographic": 36291, + "uj": 36292, + "erell": 36293, + "methanol": 36294, + "Surface": 36295, + "opositive": 36296, + "Ġthreatening": 36297, + "Ġtranscend": 36298, + "Depend": 36299, + "Ġqi": 36300, + "tised": 36301, + "ĠBristol": 36302, + "ummation": 36303, + "Ġextractor": 36304, + "Ġfavoured": 36305, + "ĠPyro": 36306, + "ĠEngineers": 36307, + "flatten": 36308, + "tolerance": 36309, + "Ġxt": 36310, + "ĠTot": 36311, + "Ġtestbed": 36312, + "ICU": 36313, + "ĠSwarm": 36314, + "Ġinternationally": 36315, + "Ġantine": 36316, + "ĠInsurance": 36317, + "bai": 36318, + "nh": 36319, + "Ñĭ": 36320, + "osac": 36321, + "ĠLec": 36322, + "thor": 36323, + "Ġoutermost": 36324, + "Ġdoors": 36325, + "Ġbiometric": 36326, + "glutamate": 36327, + "ĠWoods": 36328, + "ĠMunich": 36329, + "uximab": 36330, + "places": 36331, + "Ġamyotrophic": 36332, + "ĠParam": 36333, + "ĠChristensen": 36334, + "Age": 36335, + "enne": 36336, + "Ġanim": 36337, + "Ġrecrystallization": 36338, + "ĠPropositions": 36339, + "Ġsnails": 36340, + "Secondly": 36341, + "ĠPUFA": 36342, + "France": 36343, + "Src": 36344, + "vitro": 36345, + "omass": 36346, + "uru": 36347, + "ĠLever": 36348, + "ectonic": 36349, + "embl": 36350, + "PCL": 36351, + "Ġcoordinator": 36352, + "ĠFoxp": 36353, + "ĠBirmingham": 36354, + "ĠLiberal": 36355, + "Ġcruise": 36356, + "Ġiθ": 36357, + "Ġsymp": 36358, + "azaki": 36359, + "ĠParse": 36360, + "Ġhydrologic": 36361, + "Ġprolongation": 36362, + "ĠHayes": 36363, + "Ġsubmuc": 36364, + "Ġagglomeration": 36365, + "ARE": 36366, + "ĠFMR": 36367, + "ĠLomb": 36368, + "mathchar": 36369, + "Ġstructuring": 36370, + "Ġelectrophoretic": 36371, + "Ġdiminishing": 36372, + "Ġbrake": 36373, + "chenko": 36374, + "ĠPereira": 36375, + "lens": 36376, + "Ġbackend": 36377, + "Ġillustrations": 36378, + "Ġdemanded": 36379, + "Ġnoticeably": 36380, + "ĠKaiser": 36381, + "ĠDavidson": 36382, + "Ġbraking": 36383, + "Tp": 36384, + "Forward": 36385, + "μν": 36386, + "ĠCdS": 36387, + "Ġasteroids": 36388, + "Provider": 36389, + "ĠEut": 36390, + "Ġtril": 36391, + "ungs": 36392, + "Ġdiving": 36393, + "ĠUAVs": 36394, + "ĠiPSC": 36395, + "iint": 36396, + "Ġ×": 36397, + "thrombin": 36398, + "Ġcoordinating": 36399, + "extrem": 36400, + "Ġembolization": 36401, + "ĠAdip": 36402, + "plated": 36403, + "ĠHag": 36404, + "ĠETS": 36405, + "Ġbrood": 36406, + "Ang": 36407, + "ĠPCV": 36408, + "detail": 36409, + "RSS": 36410, + "bens": 36411, + "Ġtier": 36412, + "ĠCock": 36413, + "Ġgay": 36414, + "Ġquint": 36415, + "Ġagenda": 36416, + "Ġaffairs": 36417, + "ĠModerate": 36418, + "helical": 36419, + "ĠEquivalent": 36420, + "Ġproportionally": 36421, + "Column": 36422, + "FWHM": 36423, + "Air": 36424, + "Enum": 36425, + "ifice": 36426, + "arcsec": 36427, + "ĠTRIM": 36428, + "ĠLabeling": 36429, + "QAM": 36430, + "pies": 36431, + "Ġisotropy": 36432, + "ĠGó": 36433, + "Ġpointers": 36434, + "tigraphy": 36435, + "ramers": 36436, + "Ġmacaque": 36437, + "Ġmisses": 36438, + "Ġellipticity": 36439, + "presented": 36440, + "galactosidase": 36441, + "ÉĽ": 36442, + "inion": 36443, + "Ġmite": 36444, + "lll": 36445, + "Objective": 36446, + "Ġprisoners": 36447, + "ĠHercules": 36448, + "Ġantis": 36449, + "Ġclosures": 36450, + "ĠMartian": 36451, + "Ġterpen": 36452, + "robust": 36453, + "Ġsequelae": 36454, + "alarial": 36455, + "ĠCSA": 36456, + "ĠBland": 36457, + "ĠGent": 36458, + "Ġorphan": 36459, + "Ġindent": 36460, + "bigwedge": 36461, + "Ġdefinable": 36462, + "Ġoligosaccharides": 36463, + "ĠBattalion": 36464, + "Ġisometries": 36465, + "azolin": 36466, + "ĠShown": 36467, + "spectra": 36468, + "Visual": 36469, + "<<<<<<<<": 36470, + "Ġlentiviral": 36471, + "othelioma": 36472, + "Ġtedious": 36473, + "ĠBCI": 36474, + "Ġgeologic": 36475, + "Ġconsumes": 36476, + "ĠAblation": 36477, + "least": 36478, + "Ġthigh": 36479, + "Ġsecrecy": 36480, + "covering": 36481, + "eiro": 36482, + "õ": 36483, + "ĠTBS": 36484, + "Ġisomerase": 36485, + "Ġrecommends": 36486, + "ĠVortex": 36487, + "ĠBray": 36488, + "Ġsubd": 36489, + "ĠOptions": 36490, + "Ġmetamaterial": 36491, + "ĠSquares": 36492, + "trap": 36493, + "imon": 36494, + "Ġhesit": 36495, + "Ġabc": 36496, + "cessing": 36497, + "ĠRET": 36498, + "Ġpinned": 36499, + "Ġketones": 36500, + "Ġwelded": 36501, + "ĠMitochondria": 36502, + "Ġingested": 36503, + "ĠQFT": 36504, + "Ġcomparator": 36505, + "Ġoxidoreductase": 36506, + "Ġtetrad": 36507, + "ĠSensitive": 36508, + "Ġcatchments": 36509, + "Ġrefugees": 36510, + "Ġpuberty": 36511, + "Arab": 36512, + "Ġinterannual": 36513, + "scattered": 36514, + "ĠMetam": 36515, + "Ġcyclization": 36516, + "pertures": 36517, + "ĠLINC": 36518, + "rules": 36519, + "ĠPont": 36520, + "PTH": 36521, + "ĉĉĉĉĉĉĉĉ": 36522, + "Santa": 36523, + "ĠLNC": 36524, + "Ġsubmodular": 36525, + "rective": 36526, + "Ġtrif": 36527, + "Ġsentinel": 36528, + "ĠTwin": 36529, + "keletons": 36530, + "miral": 36531, + "aming": 36532, + "ĠGay": 36533, + "Ġinterspecific": 36534, + "Ġrelieve": 36535, + "Ġendomorphism": 36536, + "ĠExpanding": 36537, + "ĠRuntime": 36538, + "yang": 36539, + "requires": 36540, + "odine": 36541, + "ometabolic": 36542, + "Store": 36543, + "planet": 36544, + "Ġrenov": 36545, + "___": 36546, + "adenosine": 36547, + "uitive": 36548, + "Ġkel": 36549, + "ĠProlong": 36550, + "ĠAdvance": 36551, + "Ġantimicrobials": 36552, + "ĠMunicipal": 36553, + "ĠNeutrophil": 36554, + "FAs": 36555, + "ĠFame": 36556, + "ibus": 36557, + "ETE": 36558, + "Ġstepping": 36559, + "ĠBlot": 36560, + "ĠLaura": 36561, + "Ġrocky": 36562, + "ĠLima": 36563, + "Ġmitigated": 36564, + "ĠLambert": 36565, + "Ġunexplored": 36566, + "Ġtrigonometric": 36567, + "pig": 36568, + "ĠHeli": 36569, + "Ġfinely": 36570, + "Ġoxidizing": 36571, + "Ġcolonoscopy": 36572, + "activities": 36573, + "ĠEasy": 36574, + "Ġunexplained": 36575, + "aky": 36576, + "ASM": 36577, + "worker": 36578, + "ĠCrist": 36579, + "ãĢģ": 36580, + "ulk": 36581, + "ĠSugg": 36582, + "ĠMim": 36583, + "Ġiterates": 36584, + "Ġsulfoxide": 36585, + "glucan": 36586, + "Ġreactant": 36587, + "Ġphagocytic": 36588, + "Brain": 36589, + "ucted": 36590, + "ĠScand": 36591, + "ĠCaCO": 36592, + "Ġaffiliation": 36593, + "Policy": 36594, + "ĠInfantry": 36595, + "Functional": 36596, + "rtimes": 36597, + "Ġwond": 36598, + "ardment": 36599, + "ĠWeil": 36600, + "Ġdirectors": 36601, + "uffix": 36602, + "ĠRuiz": 36603, + "ĠPhenomena": 36604, + "Ġmicrob": 36605, + "cosm": 36606, + "Ġutilisation": 36607, + "persed": 36608, + "Ġconsole": 36609, + "ticulate": 36610, + "Ġdesens": 36611, + "Ġreplicas": 36612, + "Ġpluripotency": 36613, + "ĠUkrainian": 36614, + "Ġhydrolyzed": 36615, + "ĠBiodiversity": 36616, + "Efficient": 36617, + "ĠKash": 36618, + "minor": 36619, + "Ġconclusive": 36620, + "Ġtentative": 36621, + "jira": 36622, + "Ġmb": 36623, + "ĠIPA": 36624, + "ĠPis": 36625, + "Ġgoverns": 36626, + "ĠSouthwest": 36627, + "oeba": 36628, + "ĠMohammad": 36629, + "albumin": 36630, + "circles": 36631, + "ĠHedge": 36632, + "ĠAmph": 36633, + "BACK": 36634, + "Old": 36635, + "histor": 36636, + "acular": 36637, + "ĠNOR": 36638, + "henius": 36639, + "visions": 36640, + "missibility": 36641, + "Ġthromboembolism": 36642, + "atized": 36643, + "Ġwil": 36644, + "awing": 36645, + "ASI": 36646, + "Ġheterodimer": 36647, + "Ġbuffering": 36648, + "ĠIdeally": 36649, + "ĠEgg": 36650, + "ographies": 36651, + "ĠAppl": 36652, + "ĠCIs": 36653, + "meaning": 36654, + "ĠSMAD": 36655, + "Ġphenylalanine": 36656, + "ĠTitanium": 36657, + "ĠZariski": 36658, + "Ġnymph": 36659, + "Ġhired": 36660, + "ĠPPC": 36661, + "ĠKG": 36662, + "ĠGuill": 36663, + "oglycans": 36664, + "erial": 36665, + "Dele": 36666, + "ilus": 36667, + "ĠFitness": 36668, + "Ġwhales": 36669, + "grant": 36670, + "mostly": 36671, + "Ġclimates": 36672, + "ĠCampaign": 36673, + "MgO": 36674, + "Ġepistemic": 36675, + "Lipschitz": 36676, + "ĠLAT": 36677, + "Ġcladding": 36678, + "vacuum": 36679, + "agglutinin": 36680, + "kill": 36681, + "Ġsail": 36682, + "Ġartistic": 36683, + "answ": 36684, + "ĠSDF": 36685, + "ĠKeith": 36686, + "Ġsorafenib": 36687, + "Ġgallbladder": 36688, + "directory": 36689, + "Ġphotoreceptors": 36690, + "ĠFokker": 36691, + "DU": 36692, + "Ġeditors": 36693, + "Ġtelecommun": 36694, + "ardia": 36695, + "ĠPublications": 36696, + "Ġscrews": 36697, + "ĠMathematica": 36698, + "RSV": 36699, + "ĠApply": 36700, + "ĠSTS": 36701, + "ĠMurine": 36702, + "Ġdump": 36703, + "Ġlingu": 36704, + "ĠDixon": 36705, + "Ġovercomes": 36706, + "ĠPreoperative": 36707, + "Ġmigrant": 36708, + "Ġbelieves": 36709, + "BK": 36710, + "actively": 36711, + "ĠISC": 36712, + "quas": 36713, + "Ġalga": 36714, + "ichael": 36715, + "Ġdisasters": 36716, + "Ġpracticed": 36717, + "hydrophobic": 36718, + "ĠNiño": 36719, + "ĠEthanol": 36720, + "QE": 36721, + "ĠSJ": 36722, + "ĠDengue": 36723, + "Ġappl": 36724, + "ĠYoon": 36725, + "enzo": 36726, + "IFY": 36727, + "Ġchronological": 36728, + "erin": 36729, + "ĠPeg": 36730, + "ĠRelevant": 36731, + "Ġqualification": 36732, + "evine": 36733, + "Ġdendrite": 36734, + "DTD": 36735, + "cholinesterase": 36736, + "watch": 36737, + "ĠSanchez": 36738, + "Ġwashes": 36739, + "Ġpermafrost": 36740, + "ĠTertiary": 36741, + "Ġsynthesizing": 36742, + "Ġexpedition": 36743, + "routine": 36744, + "ĠSearching": 36745, + "ĠSé": 36746, + "residual": 36747, + "ĠLCD": 36748, + "entities": 36749, + "Ġendovascular": 36750, + "Ġparamount": 36751, + "pher": 36752, + "Ġstraightforwardly": 36753, + "Ġvasodil": 36754, + "ĠSchistosoma": 36755, + "Ġpermissions": 36756, + "centred": 36757, + "Ġfrustrated": 36758, + "structuring": 36759, + "ĠSchl": 36760, + "ĠInitiation": 36761, + "Ġcuticle": 36762, + "Ġforgetting": 36763, + "ĠSas": 36764, + "ĠSult": 36765, + "uno": 36766, + "Ġdisintegration": 36767, + "ĠVG": 36768, + "Ġwards": 36769, + "ĠIRE": 36770, + "upro": 36771, + "Ġsubgen": 36772, + "Ġsubclasses": 36773, + "ĠStand": 36774, + "ĠHeight": 36775, + "interpretation": 36776, + "Ġglycan": 36777, + "ĠSolvent": 36778, + "ĠMalignant": 36779, + "Ġunsuitable": 36780, + "ĠCoxeter": 36781, + "Ġspermatogenesis": 36782, + "Ġfullerene": 36783, + "Fox": 36784, + "SOC": 36785, + "wet": 36786, + "armstadt": 36787, + "Ġpropofol": 36788, + "indexed": 36789, + "Ġsnakes": 36790, + "Edit": 36791, + "ĠmJy": 36792, + "RIB": 36793, + "Ġey": 36794, + "ĠAlkal": 36795, + "Ġtriaxial": 36796, + "PSK": 36797, + "neo": 36798, + "Ġendo": 36799, + "Ġglycosides": 36800, + "Ġsyllables": 36801, + "Ġsorghum": 36802, + "loor": 36803, + "Ġgeothermal": 36804, + "guinal": 36805, + "ĠSerbia": 36806, + "æĸ": 36807, + "ĠSentinel": 36808, + "ighters": 36809, + "Ġkeyboard": 36810, + "Ġbanana": 36811, + "granular": 36812, + "Ġdeciduous": 36813, + "ĠHAR": 36814, + "neuron": 36815, + "ĠCarn": 36816, + "Ġburns": 36817, + "Boost": 36818, + "ĠDeterministic": 36819, + "pipe": 36820, + "ĠFAD": 36821, + "ĠBovine": 36822, + "ĠRou": 36823, + "Ġkan": 36824, + "autonomous": 36825, + "utrients": 36826, + "Ġhypothyroidism": 36827, + "ĠSINR": 36828, + "stret": 36829, + "Ġunaltered": 36830, + "ĠZika": 36831, + "valley": 36832, + "Ġlongitudinally": 36833, + "Ġfluorescein": 36834, + "catheter": 36835, + "ĠCongenital": 36836, + "Ġpiez": 36837, + "Ġabbreviated": 36838, + "ĠChlamydia": 36839, + "Ġaired": 36840, + "Ġqueen": 36841, + "Ġinstructive": 36842, + "Ġabruptly": 36843, + "Ġrecurrences": 36844, + "IMP": 36845, + "Ġexosome": 36846, + "ĠHSCs": 36847, + "Writer": 36848, + "elis": 36849, + "ĠArithmetic": 36850, + "enarios": 36851, + "Ġligated": 36852, + "ĠLocalized": 36853, + "ĠFreeman": 36854, + "Ġcarniv": 36855, + "ĠCereb": 36856, + "Ġgrac": 36857, + "ĠGond": 36858, + "ĠVancouver": 36859, + "obox": 36860, + "Ġtyped": 36861, + "ĠÄ¥": 36862, + "Upon": 36863, + "Future": 36864, + "ENG": 36865, + "dead": 36866, + "Ġserpent": 36867, + "ĠAssignment": 36868, + "ĠUpdated": 36869, + "Ġhistorian": 36870, + "Ġtropospheric": 36871, + "Cloud": 36872, + "bumin": 36873, + "ĠPras": 36874, + "ĠBasket": 36875, + "ĠâĪĴâĪĴ": 36876, + "benzodi": 36877, + "ĠTrauma": 36878, + "ĠBehaviors": 36879, + "Ġpter": 36880, + "irradiation": 36881, + "Ġspoke": 36882, + "ariatric": 36883, + "Ġplugin": 36884, + "Ġsupersonic": 36885, + "Ġdocetaxel": 36886, + "itigation": 36887, + "Ġdigestibility": 36888, + "nem": 36889, + "Ġpb": 36890, + "ĠCSR": 36891, + "Ġfouling": 36892, + "Ġrheology": 36893, + "Ġfloods": 36894, + "Ġgluing": 36895, + "agascar": 36896, + "jets": 36897, + "pti": 36898, + "eston": 36899, + "ĠKü": 36900, + "Ġopenings": 36901, + "Ġisolating": 36902, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 36903, + "Ġsemiconducting": 36904, + "rative": 36905, + "ecology": 36906, + "urization": 36907, + "Ġmultifactorial": 36908, + "shadow": 36909, + "Ġcrosslinked": 36910, + "Ġphyla": 36911, + "Ġpremises": 36912, + "ĠLOW": 36913, + "generalized": 36914, + "ĠPolynomials": 36915, + "Ġbismuth": 36916, + "ĠRoz": 36917, + "ĠDecoding": 36918, + "ĠClassifier": 36919, + "conducting": 36920, + "Ġlitterm": 36921, + "Mann": 36922, + "Ġfant": 36923, + "ĠCZ": 36924, + "ĠPSNR": 36925, + "Ġstarring": 36926, + "ĠPolyg": 36927, + "ĠHolm": 36928, + "rg": 36929, + "additional": 36930, + "guan": 36931, + "professional": 36932, + "Ġinquiry": 36933, + "ĠPg": 36934, + "ĠSchmid": 36935, + "Ġheaded": 36936, + "chaft": 36937, + "ĠExpand": 36938, + "Ġcompanions": 36939, + "Van": 36940, + "ĠSie": 36941, + "Ġcanals": 36942, + "oredoxin": 36943, + "Ġcolliding": 36944, + "absolute": 36945, + "ĠPhotos": 36946, + "ĠLegacy": 36947, + "Ġrevascularization": 36948, + "ĠPSM": 36949, + "Ġexpenses": 36950, + "ISMA": 36951, + "intervals": 36952, + "Ġmulticellular": 36953, + "Ġnonsm": 36954, + "Ġresemblance": 36955, + "Hep": 36956, + "Ġwool": 36957, + "Ġniger": 36958, + "essa": 36959, + "asci": 36960, + "Ġrotates": 36961, + "Ġcompetitions": 36962, + "Ġarrivals": 36963, + "Ġlutein": 36964, + "Ġscholarship": 36965, + "Fran": 36966, + "Ġreused": 36967, + "ĠEquivalence": 36968, + "ĠGLUT": 36969, + "grading": 36970, + "salt": 36971, + "Ġcommensal": 36972, + "Ġfraud": 36973, + "oxib": 36974, + "Ġgastroenter": 36975, + "Ġrainy": 36976, + "Ġasserts": 36977, + "Operation": 36978, + "Ġflattening": 36979, + "Put": 36980, + "XB": 36981, + "ĠpM": 36982, + "Ġconic": 36983, + "obtain": 36984, + "ĠRober": 36985, + "November": 36986, + "ĠJP": 36987, + "Ġfebrile": 36988, + "ĠBarriers": 36989, + "================================================================": 36990, + "Ġhemicell": 36991, + "ĠSCS": 36992, + "ĠNem": 36993, + "Ġraster": 36994, + "clude": 36995, + "Ġïģ¦": 36996, + "ĠElliott": 36997, + "border": 36998, + "ĠdÏĨ": 36999, + "ribose": 37000, + "ĠEnv": 37001, + "ĠDiffuse": 37002, + "ĠSupersymmetry": 37003, + "Pearson": 37004, + "FETs": 37005, + "yah": 37006, + "ulia": 37007, + "ĠDwarf": 37008, + "ĠHull": 37009, + "ĠAttribution": 37010, + "Ġrepositories": 37011, + "ĠGNSS": 37012, + "ĠVectors": 37013, + "Ġsuccesses": 37014, + "ĠManhattan": 37015, + "umbent": 37016, + "digit": 37017, + "Ġcircumferential": 37018, + "Between": 37019, + "Deg": 37020, + "oue": 37021, + "й": 37022, + "ĠDere": 37023, + "ĠRf": 37024, + "Ġride": 37025, + "ĠVoc": 37026, + "Ġprotest": 37027, + "Ġpurpos": 37028, + "ĠProofs": 37029, + "namese": 37030, + "Ġbanking": 37031, + "ĠGastrointestinal": 37032, + "ĠUnt": 37033, + "Ġwhence": 37034, + "ĠYue": 37035, + "ĠRehabilitation": 37036, + "Ġexchanging": 37037, + "ĠACTH": 37038, + "Ġcapping": 37039, + "amido": 37040, + "ĠBap": 37041, + "Ġplat": 37042, + "toString": 37043, + "Ġelectroencephal": 37044, + "Ġelectrospun": 37045, + "Mpc": 37046, + "jord": 37047, + "onv": 37048, + "Ġcraft": 37049, + "ĠCCl": 37050, + "ĠStrip": 37051, + "Ġmeditation": 37052, + "oxidative": 37053, + "ĠReduce": 37054, + "ĠCommonwealth": 37055, + "Ġrifamp": 37056, + "Flu": 37057, + "Ġreanalysis": 37058, + "otrich": 37059, + "ĠESA": 37060, + "Ġjth": 37061, + "helin": 37062, + "ĠGenotype": 37063, + "Ġdiagonalization": 37064, + "ĠGabriel": 37065, + "Ġquarantine": 37066, + "ĠCrab": 37067, + "ĠDict": 37068, + "accumulation": 37069, + "bek": 37070, + "ĠDifferentially": 37071, + "Ġlactis": 37072, + "tetrahydrofuran": 37073, + "laser": 37074, + "ĠUm": 37075, + "Ġmega": 37076, + "rme": 37077, + "ĠIndians": 37078, + "ĠLeonard": 37079, + "Ġcommodity": 37080, + "Ġfumigatus": 37081, + "iou": 37082, + "ĠEchin": 37083, + "ostream": 37084, + "Ġmembran": 37085, + "simulations": 37086, + "backend": 37087, + "ĠOBJECT": 37088, + "giving": 37089, + "ÅĻ": 37090, + "Ġinfective": 37091, + "Alg": 37092, + "ĠHuh": 37093, + "ĠMICR": 37094, + "Ġfollowers": 37095, + "ferro": 37096, + "Ġcyanide": 37097, + "Present": 37098, + "ĠEND": 37099, + "ĠMCs": 37100, + "Ġtimeline": 37101, + "ĠEmbryonic": 37102, + "Identifier": 37103, + "Ġinconclusive": 37104, + "ĠGammaproteobacteria": 37105, + "nets": 37106, + "ĠHeating": 37107, + "ankar": 37108, + "thr": 37109, + "ĠKIT": 37110, + "ĠChip": 37111, + "Ġblob": 37112, + "Ġcalculator": 37113, + "Ġtextural": 37114, + "Ġalloying": 37115, + "Application": 37116, + "ĠProteomic": 37117, + "Ġantidepressants": 37118, + "urk": 37119, + "Ġcrystallography": 37120, + "Ġcredits": 37121, + "Ġmussels": 37122, + "Tom": 37123, + "ĠFST": 37124, + "ĠFold": 37125, + "ĠHew": 37126, + "Ann": 37127, + "brook": 37128, + "Ġglycolytic": 37129, + "Torch": 37130, + "Ġvm": 37131, + "ĠMare": 37132, + "ĠJy": 37133, + "Ġheterojunction": 37134, + "ĠBorrelia": 37135, + "Risk": 37136, + "ĠNaturally": 37137, + "Ġsupplying": 37138, + "signature": 37139, + "lk": 37140, + "Ġarachid": 37141, + "olov": 37142, + "ĠSok": 37143, + "ĠHö": 37144, + "ĠRaz": 37145, + "ĠVander": 37146, + "Ġdelib": 37147, + "Ġmyth": 37148, + "Ġmidbrain": 37149, + "Ġdeceased": 37150, + "ĠSCO": 37151, + "ĠThromb": 37152, + "Ġcurr": 37153, + "Ġsummit": 37154, + "miRNAs": 37155, + "dimethylamino": 37156, + "Ġphotocatalyst": 37157, + "verbose": 37158, + "gomery": 37159, + "Ġwed": 37160, + "ĠMate": 37161, + "Ġsigni": 37162, + "rastructures": 37163, + "Ġreciprocity": 37164, + "bner": 37165, + "mast": 37166, + "neck": 37167, + "Ġcoins": 37168, + "ĠHistogram": 37169, + "crit": 37170, + "Bbbk": 37171, + "AW": 37172, + "town": 37173, + "displacement": 37174, + "ĠNeph": 37175, + "separable": 37176, + "Ġdiastere": 37177, + "ĠMODELS": 37178, + "Depth": 37179, + "ĠNeisseria": 37180, + "pdev": 37181, + "uvial": 37182, + "ĠBMS": 37183, + "ĠDennis": 37184, + "Ġrp": 37185, + "Ġnanometer": 37186, + "rocyt": 37187, + "ĠRomanian": 37188, + "Ġconceivable": 37189, + "COS": 37190, + "alveolar": 37191, + "astig": 37192, + "abwe": 37193, + "encode": 37194, + "rolactone": 37195, + "Ġreadmission": 37196, + "intersection": 37197, + "Ġamplicons": 37198, + "timulated": 37199, + "Ġcollapses": 37200, + "ochromatin": 37201, + "Haw": 37202, + "ectrum": 37203, + "ftype": 37204, + "rica": 37205, + "Ġamid": 37206, + "MPO": 37207, + "ĠExtensions": 37208, + "Ġvaric": 37209, + "Ġdiminishes": 37210, + "Ġcatheters": 37211, + "Nodes": 37212, + "Ġbbox": 37213, + "emination": 37214, + "Ġtsunami": 37215, + "diagnosis": 37216, + "cod": 37217, + "qr": 37218, + "ĠFen": 37219, + "Ġworthy": 37220, + "ĠâĩIJ": 37221, + "informatic": 37222, + "ographer": 37223, + "Ġundetected": 37224, + "ĠNCAA": 37225, + "Ġcarcinogenic": 37226, + "RU": 37227, + "Ġaneu": 37228, + "plitudes": 37229, + "keeper": 37230, + "ĠÄģ": 37231, + "Ġautistic": 37232, + "Ġcompromising": 37233, + "Ġunimodal": 37234, + "Ġrumin": 37235, + "apa": 37236, + "Ġintolerance": 37237, + "Ġdirecting": 37238, + "Ġpea": 37239, + "Ġcommenced": 37240, + "Ġshadowing": 37241, + "Center": 37242, + "Ġclad": 37243, + "Ġblues": 37244, + "binits": 37245, + "Ġmisclassification": 37246, + "ĠFAST": 37247, + "Wat": 37248, + "ĠmCherry": 37249, + "Ġbrig": 37250, + "estradiol": 37251, + "Ġwavefunctions": 37252, + "Ġblooms": 37253, + "Ġaccent": 37254, + "aji": 37255, + "occurring": 37256, + "arrest": 37257, + "Ġspecialty": 37258, + "Ġunconditional": 37259, + "Ġsponges": 37260, + "Ġdysfunctional": 37261, + "ĠNOX": 37262, + "Ġultracold": 37263, + "Ġmartensite": 37264, + "OUS": 37265, + "nier": 37266, + "isic": 37267, + "ĠMatsum": 37268, + "Ġleukemic": 37269, + "ĠBradley": 37270, + "Density": 37271, + "ĠSemiconductor": 37272, + "ĠCause": 37273, + "ĠInset": 37274, + "ĠKem": 37275, + "ĠUPR": 37276, + "para": 37277, + "echst": 37278, + "ymet": 37279, + "Ġagro": 37280, + "ĠYY": 37281, + "ĠRegeneration": 37282, + "Ġancestors": 37283, + "ĠTissues": 37284, + "Ġsulfuric": 37285, + "kd": 37286, + "Ġlasing": 37287, + "ĠPup": 37288, + "aei": 37289, + "Ġmammal": 37290, + "ĠBradford": 37291, + "Ġsegregated": 37292, + "isolated": 37293, + "ĠCuba": 37294, + "Ġblockage": 37295, + "Ġseamless": 37296, + "Ġperoxisome": 37297, + "hui": 37298, + "Ġinaug": 37299, + "Ġinfecting": 37300, + "ĠChampion": 37301, + "ĠAttitudes": 37302, + "calculate": 37303, + "Ġtighter": 37304, + "ĠSAC": 37305, + "ĠEpi": 37306, + "Ġatm": 37307, + "Ġphysico": 37308, + "Ġnth": 37309, + "ĠCanyon": 37310, + "Ġseroprevalence": 37311, + "Ġhomo": 37312, + "ĠUniversit": 37313, + "Evaluation": 37314, + "ĠAPOE": 37315, + "job": 37316, + "ĠmK": 37317, + "Ġreign": 37318, + "abo": 37319, + "ĠRugby": 37320, + "ĠNets": 37321, + "Ġrituximab": 37322, + "ativeness": 37323, + "Ġphy": 37324, + "ornis": 37325, + "Ġfeedbacks": 37326, + "United": 37327, + "Princ": 37328, + "imbabwe": 37329, + "ĠGirls": 37330, + "Ġunavoidable": 37331, + "ĠSemantics": 37332, + "Break": 37333, + "FISH": 37334, + "Mix": 37335, + "Ġnx": 37336, + "ĠBao": 37337, + "dimethylphenyl": 37338, + "ĠTOF": 37339, + "ĠCrown": 37340, + "ĠGGA": 37341, + "ĠJH": 37342, + "Ġsuperstring": 37343, + "ĠCRY": 37344, + "Ġkindly": 37345, + "YN": 37346, + "Ġundoped": 37347, + "excluding": 37348, + "ĠLeo": 37349, + "ĠPROPERT": 37350, + "peritoneally": 37351, + "mant": 37352, + "ê°": 37353, + "Ġfranch": 37354, + "ĠProst": 37355, + "DEs": 37356, + "Ġcotrans": 37357, + "Ġrk": 37358, + "Ġgeneralizability": 37359, + "Author": 37360, + "ĠAndrea": 37361, + "ĠConfocal": 37362, + "ĠAdipose": 37363, + "îĹ": 37364, + "erjee": 37365, + "Ġanimated": 37366, + "ĠFad": 37367, + "ĠCorrosion": 37368, + "ĠCircadian": 37369, + "Ġaccelerators": 37370, + "ĠArkansas": 37371, + "Ġmars": 37372, + "ĠCuc": 37373, + "ĠInterfaces": 37374, + "Ġretrievals": 37375, + "Ġmelanin": 37376, + "ĠssDNA": 37377, + "vastava": 37378, + "Ġallergens": 37379, + "bud": 37380, + "Ġinaccessible": 37381, + "ictions": 37382, + "ĠMood": 37383, + "inda": 37384, + "Ġameric": 37385, + "Ġsymbiosis": 37386, + "bersome": 37387, + "occur": 37388, + "ĠMarcus": 37389, + "ĠSuperconductivity": 37390, + "ĠCort": 37391, + "ĠHMS": 37392, + "Ġphased": 37393, + "ĠJess": 37394, + "Ġpropulsion": 37395, + "extract": 37396, + "Ġsuccinate": 37397, + "ĠÖĴ": 37398, + "inkel": 37399, + "Ġsilence": 37400, + "ĠSUV": 37401, + "Ġconstituency": 37402, + "Ġbacteriophage": 37403, + "gem": 37404, + "ĠMCL": 37405, + "orene": 37406, + "ĠGoss": 37407, + "ICD": 37408, + "Ġglutamic": 37409, + "Ġcoexisting": 37410, + "STEMS": 37411, + "opotential": 37412, + "ĠEy": 37413, + "ĠLecture": 37414, + "ellae": 37415, + "Ġimmunoprec": 37416, + "Ġtimber": 37417, + "ĠVulner": 37418, + "Ġaroma": 37419, + "Ġsands": 37420, + "ĠSpan": 37421, + "Ġhern": 37422, + "Ġincubating": 37423, + "Ġtransmitters": 37424, + "ĠHomogeneous": 37425, + "ĠConstructing": 37426, + "dit": 37427, + "Ġtc": 37428, + "alass": 37429, + "Ġstents": 37430, + "ĠMID": 37431, + "Ġanoxic": 37432, + "Ġprovisions": 37433, + "ĠCapac": 37434, + "neutron": 37435, + "ĠVOCs": 37436, + "January": 37437, + "VAS": 37438, + "once": 37439, + "ĠCache": 37440, + "opulation": 37441, + "ĠVTE": 37442, + "Ġinterphase": 37443, + "Ġblog": 37444, + "ocusing": 37445, + "hiro": 37446, + "ĠREC": 37447, + "Ġanisotropies": 37448, + "benef": 37449, + "Ġconstipation": 37450, + "ĠCanal": 37451, + "Ġportrait": 37452, + "silyl": 37453, + "ĠLinked": 37454, + "ĠBowl": 37455, + "Ġmonopoles": 37456, + "ĠPerez": 37457, + "WIN": 37458, + "ĠTAP": 37459, + "Ġruthenium": 37460, + "ĠAdherence": 37461, + "ĠEnzymatic": 37462, + "Ġspecificities": 37463, + "Ġski": 37464, + "ĠCST": 37465, + "Ġpoetry": 37466, + "ATES": 37467, + "rama": 37468, + "lores": 37469, + "ALU": 37470, + "Ġvasoconstr": 37471, + "Ġgranulocyte": 37472, + "ibi": 37473, + "Ġopts": 37474, + "avesdrop": 37475, + "eptin": 37476, + "··": 37477, + "ĠJeong": 37478, + "Ġmedullary": 37479, + "ĠDemonstration": 37480, + "ĠFIB": 37481, + "ĠBRD": 37482, + "ĠVV": 37483, + "Ġallo": 37484, + "Rule": 37485, + "Tf": 37486, + "Ġunrealistic": 37487, + "Ġlatitudinal": 37488, + "ROP": 37489, + "ĠCorrelates": 37490, + "IU": 37491, + "ĠPore": 37492, + "ocrit": 37493, + "ĠKall": 37494, + "Ġcharcoal": 37495, + "ĠMongolia": 37496, + "âĪħ": 37497, + "ĠEntity": 37498, + "Ġgrams": 37499, + "graphene": 37500, + "mine": 37501, + "entric": 37502, + "ĠPp": 37503, + "ĠWelfare": 37504, + "ĠJets": 37505, + "Ġaffirm": 37506, + "ĠBelle": 37507, + "ĠStrategic": 37508, + "APIENTR": 37509, + "KH": 37510, + "rmann": 37511, + "Ġassociating": 37512, + "ĠSurviv": 37513, + "Ġnicotinic": 37514, + "ĠWLAN": 37515, + "п": 37516, + "Ġtears": 37517, + "ĠRevised": 37518, + "Ġphosphodies": 37519, + "Ġhorseradish": 37520, + "ĠLAR": 37521, + "took": 37522, + "ĠDescent": 37523, + "ĠNOx": 37524, + "ĠSteiner": 37525, + "ĠPermian": 37526, + "ĠVenezuela": 37527, + "Ġdesiccation": 37528, + "DIS": 37529, + "ĠMSP": 37530, + "Ġpopl": 37531, + "rels": 37532, + "Ġ": 37533, + "Ġlearnt": 37534, + "ĠBiofilm": 37535, + "ĠPCNA": 37536, + "ĠAttribute": 37537, + "ĠGrothendieck": 37538, + "ĠAdolescent": 37539, + "nv": 37540, + "stderr": 37541, + "obalt": 37542, + "ĠYamamoto": 37543, + "Ġaliquot": 37544, + "rater": 37545, + "ĠOre": 37546, + "ĠKIR": 37547, + "acker": 37548, + "Ġïĥ»": 37549, + "Ġstratosphere": 37550, + "ĠCust": 37551, + "respect": 37552, + "Ġglutamatergic": 37553, + "Ġencourages": 37554, + "ctic": 37555, + "itched": 37556, + "phins": 37557, + "Ġsuburb": 37558, + "Ġhomeomorphic": 37559, + "hexah": 37560, + "Ġminiatur": 37561, + "CAN": 37562, + "ahead": 37563, + "ĠBLE": 37564, + "ĠRBF": 37565, + "Ġacutely": 37566, + "Ġ": 37567, + "Ġantenn": 37568, + "URN": 37569, + "ĠGirl": 37570, + "Ġbioreactor": 37571, + "ĠLeibniz": 37572, + "Ġvial": 37573, + "ĠLich": 37574, + "obac": 37575, + "ĠWhenever": 37576, + "inhibition": 37577, + "Cast": 37578, + "Ġstripped": 37579, + "ĠAstrophysics": 37580, + "presence": 37581, + "ĠFloer": 37582, + "ipotent": 37583, + "dichloro": 37584, + "CLE": 37585, + "finger": 37586, + "onates": 37587, + "stri": 37588, + "ĠSperm": 37589, + "ĠDBS": 37590, + "opeptide": 37591, + "separation": 37592, + "athing": 37593, + "mathp": 37594, + "ouples": 37595, + "Ġentropic": 37596, + "Ġswollen": 37597, + "Ġdonated": 37598, + "Ġsettlements": 37599, + "ovenous": 37600, + "Perm": 37601, + "ĠSard": 37602, + "egen": 37603, + "ĠAlph": 37604, + "ĠCooperation": 37605, + "ĠPDAC": 37606, + "Final": 37607, + "lapse": 37608, + "Ġrevol": 37609, + "ĠIx": 37610, + "ĠLens": 37611, + "Ġkth": 37612, + "relaxation": 37613, + "ClO": 37614, + "ichloro": 37615, + "Ġwrapper": 37616, + "ĠSimultaneously": 37617, + "Compute": 37618, + "ëĬ": 37619, + "implantation": 37620, + "ĠVLA": 37621, + "heme": 37622, + "ĠMayor": 37623, + "ĠFacilit": 37624, + "Ġbatt": 37625, + "immer": 37626, + "Ġcurated": 37627, + "Ġconfluent": 37628, + "generational": 37629, + "starts": 37630, + "Ġgranulosa": 37631, + "arboxylate": 37632, + "ĠRiesz": 37633, + "Ġtextbook": 37634, + "Ġconstitutional": 37635, + "ĠPeace": 37636, + "ĠCommander": 37637, + "Ġobscured": 37638, + "vil": 37639, + "addition": 37640, + "ĠWasserstein": 37641, + "coords": 37642, + "ĠProbes": 37643, + "Ġdelineated": 37644, + "TZVP": 37645, + "ĠINF": 37646, + "Ġdosages": 37647, + "Ġoligomerization": 37648, + "ĠNADP": 37649, + "MKII": 37650, + "omin": 37651, + "Ġlhs": 37652, + "ughen": 37653, + "ĠJong": 37654, + "ancel": 37655, + "letter": 37656, + "ĠANC": 37657, + "FUNCTION": 37658, + "Ġtram": 37659, + "Their": 37660, + "ĠGenerated": 37661, + "Ġpolycyclic": 37662, + "Ġculmin": 37663, + "Ġrectum": 37664, + "Ġceft": 37665, + "Ġmetamaterials": 37666, + "ĠBiotech": 37667, + "Ġmyself": 37668, + "Ġunifying": 37669, + "Ġeman": 37670, + "ĠSinger": 37671, + "triangleright": 37672, + "omel": 37673, + "ĠCFA": 37674, + "ocha": 37675, + "ĠGSM": 37676, + "Ġcentrifuge": 37677, + "ĠIndo": 37678, + "Ġtransporting": 37679, + "LIB": 37680, + "Ġoxalate": 37681, + "ĠDulbecco": 37682, + "Ġali": 37683, + "arginal": 37684, + "hoo": 37685, + "ischem": 37686, + "APIENTRYP": 37687, + "Apart": 37688, + "LDA": 37689, + "ensile": 37690, + "settings": 37691, + "Ġephem": 37692, + "ampa": 37693, + "Ġduplications": 37694, + "ĠWheeler": 37695, + "Physical": 37696, + "ĠCompletion": 37697, + "ĠOrdered": 37698, + "Logger": 37699, + "Ġinterferences": 37700, + "ĠPollution": 37701, + "Optimal": 37702, + "Sv": 37703, + "aicin": 37704, + "Ġpicks": 37705, + "diversity": 37706, + "tigens": 37707, + "Ġdimorphism": 37708, + "feres": 37709, + "ĠRobotic": 37710, + "Ġconfirmatory": 37711, + "Ġcathodic": 37712, + "Ġspirals": 37713, + "Ġspruce": 37714, + "Lagrange": 37715, + "wat": 37716, + "ĠAllan": 37717, + "denote": 37718, + "CID": 37719, + "always": 37720, + "ithe": 37721, + "ĠChim": 37722, + "conditional": 37723, + "barrier": 37724, + "Ġvisualizing": 37725, + "Ġïĥ¹": 37726, + "Schmidt": 37727, + "Ġconventionally": 37728, + "ĠQUANT": 37729, + "GROUND": 37730, + "Ġug": 37731, + "ĠCWE": 37732, + "ĠInspired": 37733, + "Ġbuyer": 37734, + "Ġthermost": 37735, + "Ġkinematical": 37736, + "anolic": 37737, + "Ġdif": 37738, + "Ġ": 37739, + "ĠGeo": 37740, + "Examples": 37741, + "consistency": 37742, + "ĠPalace": 37743, + "ĠVaccination": 37744, + "Ġnatriuretic": 37745, + "YAG": 37746, + "ĠCTCs": 37747, + "Univers": 37748, + "ĠAcknowledgement": 37749, + "membered": 37750, + "vv": 37751, + "ĠSession": 37752, + "Ġinstar": 37753, + "ĠLevin": 37754, + "AVI": 37755, + "Ġproliferator": 37756, + "oliths": 37757, + "ĠTemperatures": 37758, + "imming": 37759, + "ĠToeplitz": 37760, + "ICATIONS": 37761, + "ĠIntegrals": 37762, + "Ġspliced": 37763, + "Dest": 37764, + "resulting": 37765, + "ĠHope": 37766, + "Ġenclosure": 37767, + "ieves": 37768, + "flav": 37769, + "ĠAbdul": 37770, + "Ġleishmaniasis": 37771, + "ò": 37772, + "oskeleton": 37773, + "Ġadduct": 37774, + "ĠInfluences": 37775, + "EQU": 37776, + "ĠSitu": 37777, + "Ġseas": 37778, + "ĠReich": 37779, + "cyst": 37780, + "ĠEVOLUTION": 37781, + "Ġwithstand": 37782, + "ĠGinzburg": 37783, + "RNAi": 37784, + "ĠNonparametric": 37785, + "ĠPrincess": 37786, + "Ġintravascular": 37787, + "UTIONS": 37788, + "Ġglutar": 37789, + "Ġcoincided": 37790, + "ĠSaito": 37791, + "pretrained": 37792, + "combined": 37793, + "ĠTAM": 37794, + "Ġalarms": 37795, + "Ġcyclooxygenase": 37796, + "Ġbn": 37797, + "Ġplagi": 37798, + "Particle": 37799, + "GGG": 37800, + "etics": 37801, + "amber": 37802, + "ABSTRACT": 37803, + "ĠExtracts": 37804, + "ĉĉĉĠĠĠĠ": 37805, + "ĠPhylogeny": 37806, + "tow": 37807, + "ĠContaining": 37808, + "Ġendonuclease": 37809, + "incubation": 37810, + "Ġofficinal": 37811, + "Ġexplosions": 37812, + "layout": 37813, + "Ġtouchdown": 37814, + "ĠRevealed": 37815, + "Ġinfiltrate": 37816, + "enith": 37817, + "timulation": 37818, + "ĠKind": 37819, + "ervices": 37820, + "PDA": 37821, + "Ġcereus": 37822, + "Env": 37823, + "Ġlapa": 37824, + "kamp": 37825, + "mult": 37826, + "enthal": 37827, + "ĠGoldstone": 37828, + "siRNA": 37829, + "strept": 37830, + "Qual": 37831, + "mother": 37832, + "dio": 37833, + "Ġinfrequent": 37834, + "Ġcyclospor": 37835, + "hepatitis": 37836, + "thrombotic": 37837, + "GST": 37838, + "ĠLj": 37839, + "ĠUR": 37840, + "ofect": 37841, + "ĠArrow": 37842, + "ethnic": 37843, + "ĠBarcelona": 37844, + "Care": 37845, + "titious": 37846, + "Ġeta": 37847, + "Ġvirions": 37848, + "smash": 37849, + "ĠâIJ¤": 37850, + "Ġavenues": 37851, + "obarb": 37852, + "ĠComments": 37853, + "Ġanyway": 37854, + "afil": 37855, + "ĠBea": 37856, + "ĠBoys": 37857, + "ĠAutomata": 37858, + "ĠSuperconducting": 37859, + "Pic": 37860, + "kHz": 37861, + "Ġnorepinephrine": 37862, + "ĠGPC": 37863, + "Ġunderlined": 37864, + "brahim": 37865, + "Ġelectrospray": 37866, + "Ġsesqu": 37867, + "ĠTournament": 37868, + "Austr": 37869, + "ĠGrowing": 37870, + "ĠWebsite": 37871, + "LDH": 37872, + "covariance": 37873, + "several": 37874, + "stabilized": 37875, + "Ġdecarboxylase": 37876, + "Ġremed": 37877, + "rhoe": 37878, + "ĠSRS": 37879, + "ĠTreated": 37880, + "ĠMadagascar": 37881, + "ĠMagic": 37882, + "Ġweapon": 37883, + "ĠYoshida": 37884, + "Ġhypoglycemia": 37885, + "ĠBifidobacterium": 37886, + "entitious": 37887, + ":::": 37888, + "ĠSingles": 37889, + "Ġnicely": 37890, + "Ġunexpectedly": 37891, + "ibles": 37892, + "ariae": 37893, + "Ġcentroids": 37894, + "Ġbroadened": 37895, + "ĠJohns": 37896, + "ĠBacteroid": 37897, + "Ġframing": 37898, + "Primary": 37899, + "ĠPicture": 37900, + "government": 37901, + "Ġreq": 37902, + "ĠTry": 37903, + "ibo": 37904, + "Ġliquef": 37905, + "osensitivity": 37906, + "Ġslaughter": 37907, + "ĠDAR": 37908, + "Ġlogit": 37909, + "Ġpromises": 37910, + "Ġlawyer": 37911, + "ĠFPG": 37912, + "TCP": 37913, + "Ġintercalation": 37914, + "ĠBoe": 37915, + "Ġwideband": 37916, + "Ġjudgement": 37917, + "romagnets": 37918, + "Lastly": 37919, + "ĠIschemic": 37920, + "IMA": 37921, + "food": 37922, + "much": 37923, + "Ġavenue": 37924, + "Ġschistosomiasis": 37925, + "ĠExecution": 37926, + "DQU": 37927, + "GIS": 37928, + "kines": 37929, + "akage": 37930, + "echt": 37931, + "ĠScaff": 37932, + "ĠStrings": 37933, + "ĠMultilevel": 37934, + "Ġcumbersome": 37935, + "ĠRaymond": 37936, + "Ġirregularities": 37937, + "ĠAGNs": 37938, + "ĠMetastatic": 37939, + "ĠIberian": 37940, + "Mb": 37941, + "RNP": 37942, + "hong": 37943, + "isinin": 37944, + "Ġthirteen": 37945, + "ĠFAS": 37946, + "Ġsealing": 37947, + "Ġapatite": 37948, + "Ġserially": 37949, + "ĠÅĿ": 37950, + "DEL": 37951, + "Fo": 37952, + "ĠSoph": 37953, + "ĠBear": 37954, + "ĠJosh": 37955, + "reck": 37956, + "uller": 37957, + "Ġexcursion": 37958, + "Ġembodied": 37959, + "Ġhybridized": 37960, + "ĠLieutenant": 37961, + "Period": 37962, + "Ġmollus": 37963, + "CVD": 37964, + "Ren": 37965, + "REAM": 37966, + "ĠBACK": 37967, + "Ġaccreting": 37968, + "Ġculturing": 37969, + "ĠBurst": 37970, + "ĠSegment": 37971, + "Ġasterisk": 37972, + "ĠIdeal": 37973, + "Ġintertw": 37974, + "ĠAtoms": 37975, + "ĠSTE": 37976, + "Ġïģª": 37977, + "Ġremarked": 37978, + "Ġhairs": 37979, + "âľ": 37980, + "ĠMetropolis": 37981, + "ĠPartially": 37982, + "ĠObserver": 37983, + "Ġhematologic": 37984, + "obilization": 37985, + "ĠBergman": 37986, + "Ġcartesian": 37987, + "Ġclathrin": 37988, + "ĠSung": 37989, + "Ġration": 37990, + "Ġscoliosis": 37991, + "ohl": 37992, + "mutant": 37993, + "NNs": 37994, + "ĠRahman": 37995, + "ĠSpatially": 37996, + "PIP": 37997, + "Yb": 37998, + "Ġdiaz": 37999, + "vertebral": 38000, + "adzu": 38001, + "alski": 38002, + "answer": 38003, + "Ġgeochemistry": 38004, + "Ġstemming": 38005, + "wes": 38006, + "oxys": 38007, + "Ġmats": 38008, + "eva": 38009, + "ĠHyperbolic": 38010, + "arbage": 38011, + "Ġclipping": 38012, + "ĠSugar": 38013, + "ĠCognition": 38014, + "ĠDIV": 38015, + "Ġtempt": 38016, + "ĠPathogen": 38017, + "ĠPedro": 38018, + "Ġwak": 38019, + "entries": 38020, + "ĠGCM": 38021, + "projective": 38022, + "Ġproficiency": 38023, + "ĠKnown": 38024, + "Ġlexicon": 38025, + "ĠMendelian": 38026, + "Ġzoonotic": 38027, + "leans": 38028, + "ĠTalk": 38029, + "Ġkurtosis": 38030, + "NAS": 38031, + "ĠNowadays": 38032, + "ĠLil": 38033, + "ĠWMAP": 38034, + "Ġdisperse": 38035, + "Ġcolloids": 38036, + "ebra": 38037, + "OMET": 38038, + "ĠDCT": 38039, + "ĠRise": 38040, + "Ġintergenic": 38041, + "GTH": 38042, + "Ġtapered": 38043, + "Markovian": 38044, + "Protocol": 38045, + "ĠVegetation": 38046, + "rats": 38047, + "Ġdivalent": 38048, + "ĠCrust": 38049, + "zyg": 38050, + "Ġpigmentation": 38051, + "graduate": 38052, + "ĠRicc": 38053, + "Ġcounterexample": 38054, + "Ġsativ": 38055, + "Ġls": 38056, + "ĠCirculation": 38057, + "isotropic": 38058, + "ĠENSO": 38059, + "Ġtroponin": 38060, + "Ġdissolving": 38061, + "Ġcosmetic": 38062, + "Hf": 38063, + "further": 38064, + "Ġpanc": 38065, + "Ġhops": 38066, + "intra": 38067, + "ĠZhe": 38068, + "ĠReliable": 38069, + "ivolumab": 38070, + "MX": 38071, + "Rab": 38072, + "ĠPES": 38073, + "ĠBü": 38074, + "Ġadhered": 38075, + "Ġfluency": 38076, + "ĠClaus": 38077, + "Ġdelamination": 38078, + "Ġguanine": 38079, + "ĠMultiscale": 38080, + "ĠEquip": 38081, + "ĠIllustr": 38082, + "Ġtetrahydro": 38083, + "fel": 38084, + "lists": 38085, + "Îŀ": 38086, + "emulsion": 38087, + "ĠNZ": 38088, + "Ġwasn": 38089, + "aira": 38090, + "Ġarguing": 38091, + "miRNA": 38092, + "ĠExpressed": 38093, + "Ġspectrophotometric": 38094, + "Ġileum": 38095, + "Ġflames": 38096, + "Fit": 38097, + "Gon": 38098, + "ĠCulex": 38099, + "Ġunweighted": 38100, + "Ġnanob": 38101, + "SHV": 38102, + "Ġaligning": 38103, + "Ġshuttle": 38104, + "Ġchloroquine": 38105, + "Ġpyrite": 38106, + "ĠRica": 38107, + "Ġrift": 38108, + "Ġcathepsin": 38109, + "ĠPROCESS": 38110, + "Pf": 38111, + "Raw": 38112, + "rayfish": 38113, + "SAL": 38114, + "collapse": 38115, + "................": 38116, + "atases": 38117, + "Ġworkshops": 38118, + "ophile": 38119, + "ĠâĬĥ": 38120, + "Ġbifurcations": 38121, + "Trace": 38122, + "Ġpause": 38123, + "Ġorbiting": 38124, + "oliubov": 38125, + "ĠCurtis": 38126, + "ĠRevisiting": 38127, + "oret": 38128, + "Ġinfused": 38129, + "luents": 38130, + "Ġplastid": 38131, + "Ġïģ¹": 38132, + "Ġexecutions": 38133, + "ĠGraves": 38134, + "locally": 38135, + "ĠAtmosphere": 38136, + "diabetes": 38137, + "ĠPradesh": 38138, + "ĠCofactor": 38139, + "isomorphic": 38140, + "Ġbod": 38141, + "ĠCBD": 38142, + "Ġincap": 38143, + "Ġretrovirus": 38144, + "Ġlipophilic": 38145, + "Ġlinoleic": 38146, + "Ġtravelled": 38147, + "covalent": 38148, + "pick": 38149, + "upl": 38150, + "ĠPole": 38151, + "ĠThym": 38152, + "ĠTeich": 38153, + "Ġcollaborators": 38154, + "Ġinstantons": 38155, + "ĠMEGA": 38156, + "ĠHepatocellular": 38157, + "Ġinfestation": 38158, + "ĠPiezo": 38159, + "ĠLub": 38160, + "ĠNCs": 38161, + "Ġnucleoside": 38162, + "Ġosteogenesis": 38163, + "Eigen": 38164, + "RMSE": 38165, + "Ġlax": 38166, + "ĠKost": 38167, + "ĠVero": 38168, + "ĠChou": 38169, + "electrochemical": 38170, + "Ġcompeti": 38171, + "chia": 38172, + "Ġsubmodule": 38173, + "ĠAllow": 38174, + "Ġresolvent": 38175, + "Ġsweeps": 38176, + "Ġsuperconformal": 38177, + "pyrrolidine": 38178, + "lofen": 38179, + "åŃ": 38180, + "Ġdeserves": 38181, + "ĠZimbabwe": 38182, + "azines": 38183, + "ĠConsult": 38184, + "Ġcastle": 38185, + "Ġpharmaceuticals": 38186, + "Ġparacrine": 38187, + "Ġjejuni": 38188, + "Ġarguably": 38189, + "ĠeNOS": 38190, + "Ġherds": 38191, + "Ġvehicular": 38192, + "Ġtriangulated": 38193, + "Ġîµ": 38194, + "ĠGrande": 38195, + "Ġanthocyanins": 38196, + "ĠDuan": 38197, + "ĠVibration": 38198, + "Ġtriad": 38199, + "Ġhousekeeping": 38200, + "Bor": 38201, + "Ġpub": 38202, + "Ġmalformation": 38203, + "glucosamine": 38204, + "inhibitory": 38205, + "Dirac": 38206, + "ĠCSD": 38207, + "ĠRotating": 38208, + "ĠHTLV": 38209, + "Ġdemol": 38210, + "infiltr": 38211, + "Ġhemolytic": 38212, + "Ġcarbapenem": 38213, + "Ġluminescent": 38214, + "ĠPlanets": 38215, + "Ġmellifera": 38216, + "Ġcorticosterone": 38217, + "ĠAddress": 38218, + "Ġhubs": 38219, + "omethacin": 38220, + "åIJ": 38221, + "ĠChampions": 38222, + "ĠRevision": 38223, + "ĠHerbert": 38224, + "Ġambiguities": 38225, + "KERN": 38226, + "Ġdé": 38227, + "Ġlp": 38228, + "Ġenvis": 38229, + "ĠChol": 38230, + "ropin": 38231, + "Ġdrone": 38232, + "meyer": 38233, + "Ġisotype": 38234, + "ĠVu": 38235, + "ERC": 38236, + "Ġversatility": 38237, + "Speed": 38238, + "Ġaetiology": 38239, + "Ġgonadotropin": 38240, + "Ġcognate": 38241, + "ĠCotton": 38242, + "reasonable": 38243, + "disable": 38244, + "Ġdevastating": 38245, + "Pier": 38246, + "POL": 38247, + "ĠBé": 38248, + "incter": 38249, + "aluable": 38250, + "Ġpolyhedron": 38251, + "ĠRelay": 38252, + "Ġworkflows": 38253, + "FEM": 38254, + "inp": 38255, + "Ġmph": 38256, + "softmax": 38257, + "mur": 38258, + "vr": 38259, + "Ġerent": 38260, + "ĠKN": 38261, + "Ġstatin": 38262, + "Ġflatness": 38263, + "ĠArchitectures": 38264, + "ĠVeterinary": 38265, + "Ġnosocomial": 38266, + "Sk": 38267, + "XML": 38268, + "ĠFos": 38269, + "ĠLor": 38270, + "Ġradiography": 38271, + "ĠBlum": 38272, + "ĠDiscrimination": 38273, + "Ġpunc": 38274, + "Ġexits": 38275, + "ĠBilateral": 38276, + "msstrahlung": 38277, + "Ġcolonized": 38278, + "ĠFibrosis": 38279, + "Ġchaperones": 38280, + "aboratory": 38281, + "ĠPersistence": 38282, + "Ġlumped": 38283, + "Ġrabies": 38284, + "ĠBurns": 38285, + "Dense": 38286, + "ontium": 38287, + "acetylation": 38288, + "ĠFET": 38289, + "Ġhandful": 38290, + "biology": 38291, + "Ġundesired": 38292, + "Limit": 38293, + "ĠNBA": 38294, + "ĠSeoul": 38295, + "APT": 38296, + "ĠTransgenic": 38297, + "oxygenation": 38298, + "Button": 38299, + "ĠTreatments": 38300, + "ZV": 38301, + "isomorphism": 38302, + "octa": 38303, + "iffe": 38304, + "odeoxy": 38305, + "Ġorganelle": 38306, + "Ġcolloid": 38307, + "Ġceramide": 38308, + "Ġtqdm": 38309, + "GPS": 38310, + "ĠISR": 38311, + "oclinic": 38312, + "ĠLyme": 38313, + "Ġepig": 38314, + "ĠTrail": 38315, + "IPS": 38316, + "Ġsorts": 38317, + "ĠZebrafish": 38318, + "Ġhydroxylase": 38319, + "Smirnov": 38320, + "Bax": 38321, + "ĠDance": 38322, + "ĠHors": 38323, + "Ġreachability": 38324, + "Parallel": 38325, + "ĠESBL": 38326, + "Ġuplink": 38327, + "Ġpostprandial": 38328, + "solar": 38329, + "itabine": 38330, + "ordism": 38331, + "Neasy": 38332, + "Ġabandon": 38333, + "IMI": 38334, + "fake": 38335, + "statistical": 38336, + "ĠCars": 38337, + "ibia": 38338, + "ĠÃĩ": 38339, + "spc": 38340, + "MDP": 38341, + "tizations": 38342, + "International": 38343, + "ularis": 38344, + "Ġvacuoles": 38345, + "KC": 38346, + "ĠAPT": 38347, + "ĠBt": 38348, + "ĠBom": 38349, + "ĠGMP": 38350, + "Ġpioneer": 38351, + "ĠChairman": 38352, + "ĠTucker": 38353, + "ĠRAF": 38354, + "ĠNASH": 38355, + "ĠWIT": 38356, + "ynyl": 38357, + "Ġsupplier": 38358, + "ansky": 38359, + "Ġdecomposing": 38360, + "ĠUVB": 38361, + "ophenol": 38362, + "Ġbarium": 38363, + "ĠSMT": 38364, + "otocin": 38365, + "lytic": 38366, + "ranking": 38367, + "ĠDirections": 38368, + "Ġinnervation": 38369, + "switching": 38370, + "dac": 38371, + "ĠhT": 38372, + "Ġdoctr": 38373, + "ĠIncremental": 38374, + "ĠEarthquake": 38375, + "Has": 38376, + "Lee": 38377, + "mates": 38378, + "proline": 38379, + "ĠREE": 38380, + "Ġviolates": 38381, + "ðx": 38382, + "Ġhomogenates": 38383, + "Boolean": 38384, + "Ġdoxycycline": 38385, + "ĠMOF": 38386, + "iophen": 38387, + "Ġappreciation": 38388, + "finals": 38389, + "characteristic": 38390, + "ĠContinental": 38391, + "Bus": 38392, + "Esc": 38393, + "XP": 38394, + "ÛĮ": 38395, + "ĠCTA": 38396, + "Maxwell": 38397, + "Ġarchaea": 38398, + "Nik": 38399, + "NONE": 38400, + "TW": 38401, + "tering": 38402, + "ĠPerman": 38403, + "Ġrestores": 38404, + "opathogenic": 38405, + "ĠMontgomery": 38406, + "Ġglucocorticoids": 38407, + "Ġud": 38408, + "ĠNuss": 38409, + "ĠNé": 38410, + "ĠSturm": 38411, + "Ġattaching": 38412, + "Ġintraperitoneally": 38413, + "lasov": 38414, + "Ġstellate": 38415, + "Ġantiproliferative": 38416, + "Ġmicroorganism": 38417, + "Ġvisu": 38418, + "Ġjudges": 38419, + "randomized": 38420, + "allowed": 38421, + "Ġdeprived": 38422, + "development": 38423, + "scribed": 38424, + "etherian": 38425, + "ĠFraser": 38426, + "Ram": 38427, + "bib": 38428, + "Ġliner": 38429, + "Ġguns": 38430, + "resnet": 38431, + "ĠLTR": 38432, + "ighting": 38433, + "Initi": 38434, + "ĠZimm": 38435, + "ĠGeology": 38436, + "Ġantioxidative": 38437, + "Ġmagenta": 38438, + "ĠNigerian": 38439, + "galaxy": 38440, + "ĠMelanoma": 38441, + "Found": 38442, + "Ġbum": 38443, + "ĠTrop": 38444, + "ĠDos": 38445, + "Ġmetab": 38446, + "Ġinvoking": 38447, + "ĠSchizophrenia": 38448, + "CFG": 38449, + "Ġgelation": 38450, + "Ġopioids": 38451, + "pis": 38452, + "Ġchurches": 38453, + "Ġcanonically": 38454, + "Ġjug": 38455, + "Ġacceptors": 38456, + "DMEM": 38457, + "Ġobliqu": 38458, + "ĠMedicare": 38459, + "arpoon": 38460, + "ZIP": 38461, + "oreactive": 38462, + "Ġimprinting": 38463, + "ĠVinc": 38464, + "Ġ¿": 38465, + "Ġrestart": 38466, + "Ġdentate": 38467, + "enzymatic": 38468, + "Ġinguinal": 38469, + "ĠNt": 38470, + "Ġunobserved": 38471, + "uctuation": 38472, + "Ġbiasing": 38473, + "Ġintegrins": 38474, + "Ġurl": 38475, + "FPGAM": 38476, + "ĠCLUST": 38477, + "omatology": 38478, + "Ġmetallicities": 38479, + "Ġintentionally": 38480, + "FPGAMGR": 38481, + "Typ": 38482, + "Ġally": 38483, + "Ġcomic": 38484, + "ĠLions": 38485, + "Ġimputed": 38486, + "ĠÃŁ": 38487, + "lexia": 38488, + "ĠJanus": 38489, + "Ġbrass": 38490, + "ĠDownloaded": 38491, + "BUFF": 38492, + "identical": 38493, + "Ġpsychiatry": 38494, + "CCT": 38495, + "ifar": 38496, + "ĠMandel": 38497, + "Ġoptoelectronic": 38498, + "Ġisomerization": 38499, + "ĠFant": 38500, + "ĠLion": 38501, + "ĠLov": 38502, + "ĠNaf": 38503, + "esta": 38504, + "Ġbiocompatible": 38505, + "Ġsecretions": 38506, + "sci": 38507, + "ĠRetro": 38508, + "oisomerase": 38509, + "ĠSnap": 38510, + "Ġsplittings": 38511, + "Ġscavenger": 38512, + "procedure": 38513, + "Dawley": 38514, + "ëĭ¤": 38515, + "unate": 38516, + "ĠDye": 38517, + "ĠNEC": 38518, + "Ġnanocl": 38519, + "Ġplanetes": 38520, + "ĠTRPM": 38521, + "Ġvoices": 38522, + "ĠHierarchy": 38523, + "mv": 38524, + "Ġlasts": 38525, + "Ġhoped": 38526, + "Ġmedians": 38527, + "ĠAndreev": 38528, + "Ġheightened": 38529, + "ä»": 38530, + "Ġindefinite": 38531, + "ĠKamp": 38532, + "angel": 38533, + "grids": 38534, + "archae": 38535, + "Ġtherapists": 38536, + "ĠMiR": 38537, + "Ġnegotiation": 38538, + "HSP": 38539, + "ĠCustom": 38540, + "Ġstria": 38541, + "Ġunacceptable": 38542, + "retin": 38543, + "penet": 38544, + "ĠORR": 38545, + "ĠLifetime": 38546, + "ĠPhosphate": 38547, + "Ġtropics": 38548, + "ĠWelch": 38549, + "ĠPyr": 38550, + "Ġamputation": 38551, + "ĠArtin": 38552, + "ĠCaO": 38553, + "Ġconjectures": 38554, + "Ġatrium": 38555, + "ĠComplementary": 38556, + "ĠAluminum": 38557, + "Ġmicrow": 38558, + "iliated": 38559, + "ĠImmuno": 38560, + "Ġbinocular": 38561, + "ĠWeakly": 38562, + "Ġimmunogenic": 38563, + "Ġbathym": 38564, + "ĠPhenotype": 38565, + "Ġsialic": 38566, + "Six": 38567, + "Ġakin": 38568, + "rotor": 38569, + "helm": 38570, + "CCESS": 38571, + "Ġneuroprotection": 38572, + "ĠFifth": 38573, + "Ġcontingent": 38574, + "Ġsketched": 38575, + "Imp": 38576, + "Ġcached": 38577, + "urement": 38578, + "ĠBic": 38579, + "ĠKah": 38580, + "beration": 38581, + "atterson": 38582, + "Ġglycation": 38583, + "Ġinvestors": 38584, + "Assisted": 38585, + "iales": 38586, + "science": 38587, + "Ġpilots": 38588, + "uscripts": 38589, + "MICS": 38590, + "Ġorthopedic": 38591, + "warfs": 38592, + "greater": 38593, + "ĠArtery": 38594, + "Video": 38595, + "Ġarrange": 38596, + "avar": 38597, + "charges": 38598, + "dialdehyde": 38599, + "ĠTPA": 38600, + "Ġspelling": 38601, + "ĠSeiberg": 38602, + "Ġnavigate": 38603, + "ĠPowder": 38604, + "ĠRings": 38605, + "ĠChron": 38606, + "ĠAtg": 38607, + "Ġhomocysteine": 38608, + "ĠIdentify": 38609, + "Ġoak": 38610, + "Ġliability": 38611, + "Ġoperands": 38612, + "ĠCTD": 38613, + "Ġalleviates": 38614, + "mA": 38615, + "ĠLanger": 38616, + "Ġsubmanifolds": 38617, + "ĠJag": 38618, + "Ġradiance": 38619, + "constants": 38620, + "ĠMorocco": 38621, + "Engine": 38622, + "á¸": 38623, + "âĤ¬": 38624, + "revers": 38625, + "PCI": 38626, + "unsqueeze": 38627, + "oconversion": 38628, + "Ġintensified": 38629, + "Ġrefinements": 38630, + "ofectamine": 38631, + "ayas": 38632, + "Ġincidental": 38633, + "ĠThur": 38634, + "Ġoverd": 38635, + "Ġbitter": 38636, + "Ġignores": 38637, + "ан": 38638, + "ĠOTU": 38639, + "Ġserr": 38640, + "aby": 38641, + "ĠGCN": 38642, + "ĠConsumer": 38643, + "Ġconcordant": 38644, + "ĠMRC": 38645, + "ĠEconomy": 38646, + "satisfying": 38647, + "Ġbiotinylated": 38648, + "Numerical": 38649, + "ĠRashba": 38650, + "stochastic": 38651, + "ĠLal": 38652, + "Ġburdens": 38653, + "Alloc": 38654, + "ĠGraphics": 38655, + "ĠLRRK": 38656, + "AIC": 38657, + "ĠTed": 38658, + "ĠSark": 38659, + "owl": 38660, + "Ġhemost": 38661, + "ĠAnat": 38662, + "Ġhoming": 38663, + "ĠCharlie": 38664, + "ĠBruc": 38665, + "ihara": 38666, + "ingen": 38667, + "ĠVern": 38668, + "ĠYers": 38669, + "Ġids": 38670, + "ĠcircRNAs": 38671, + "Ġconducive": 38672, + "ĠBRST": 38673, + "Ġgallium": 38674, + "Ġdichotomy": 38675, + "Fr": 38676, + "etition": 38677, + "Ġcesarean": 38678, + "olan": 38679, + "Ġrn": 38680, + "ubstituted": 38681, + "ĠLeaves": 38682, + "ĠLeader": 38683, + "coloring": 38684, + "Draw": 38685, + "Ġserous": 38686, + "Err": 38687, + "Ġinnermost": 38688, + "ĠHamburg": 38689, + "Stor": 38690, + "jes": 38691, + "Ġtol": 38692, + "idade": 38693, + "Ġrv": 38694, + "ĠInversion": 38695, + "Ġmultiphase": 38696, + "Ġpseudor": 38697, + "ĠGoodman": 38698, + "ĠJSON": 38699, + "Ġcorridor": 38700, + "Ġpork": 38701, + "ĠSale": 38702, + "ĠNatal": 38703, + "Ġattacking": 38704, + "ĠSheet": 38705, + "Ġstreamwise": 38706, + "Ġatomistic": 38707, + "Ġfirmly": 38708, + "ĠAchie": 38709, + "Ġpir": 38710, + "ĠIKK": 38711, + "ĠFalk": 38712, + "ileptic": 38713, + "ĠTRPC": 38714, + "Ġadhesions": 38715, + "HRP": 38716, + "Ġpaucity": 38717, + "Split": 38718, + "UDI": 38719, + "ĠSend": 38720, + "ĠPine": 38721, + "ĠLon": 38722, + "ĠLost": 38723, + "efer": 38724, + "concaten": 38725, + "Ġloyal": 38726, + "Ġglycop": 38727, + "ĠObserving": 38728, + "ĠMohamed": 38729, + "YR": 38730, + "ĠFilters": 38731, + "cas": 38732, + "pages": 38733, + "ĠdA": 38734, + "Ġareal": 38735, + "adis": 38736, + "ĠLHS": 38737, + "ĠThereby": 38738, + "Ġvisualizations": 38739, + "Ġtwistor": 38740, + "unitary": 38741, + "Ġarchives": 38742, + "Ġphenolics": 38743, + "hik": 38744, + "sson": 38745, + "ĠIK": 38746, + "ĠStudying": 38747, + "Ġtwisting": 38748, + "ĠHydrodynamic": 38749, + "Ġsplitter": 38750, + "Ġurothelial": 38751, + "Ġalken": 38752, + "ĠGPI": 38753, + "Ġcortices": 38754, + "Ġcropping": 38755, + "Patient": 38756, + "ĠChlamyd": 38757, + "inberg": 38758, + "ĠAircraft": 38759, + "cele": 38760, + "ectral": 38761, + "Ġconferences": 38762, + "Ġcreatine": 38763, + "alty": 38764, + "proportional": 38765, + "Ġleptonic": 38766, + "Ġovulation": 38767, + "uerre": 38768, + "tezomib": 38769, + "dle": 38770, + "initeness": 38771, + "ĠSpecimens": 38772, + "Ġcoma": 38773, + "inephrine": 38774, + "Ġepim": 38775, + "ĠPercent": 38776, + "CoO": 38777, + "ĠLoading": 38778, + "Ġvenue": 38779, + "ĠTNM": 38780, + "Ġpacemaker": 38781, + "ĠHoffmann": 38782, + "Tech": 38783, + "nie": 38784, + "ĠOrleans": 38785, + "Ġmagnetron": 38786, + "Ġhospitality": 38787, + "ĠNordic": 38788, + "oproliferative": 38789, + "Ġundoubtedly": 38790, + "ĠSrin": 38791, + "Ġhumic": 38792, + "ĠIntegrative": 38793, + "ĠCampus": 38794, + "Ġplantarum": 38795, + "radiative": 38796, + "Ġiterator": 38797, + "ĠMesozoic": 38798, + "APs": 38799, + "carinic": 38800, + "Ġcheckpoints": 38801, + "ĠïĤ£": 38802, + "ĠmAbs": 38803, + "ĠLiverpool": 38804, + "ìĿ´": 38805, + "ĠEcosystem": 38806, + "Ġneovascularization": 38807, + "Ġdemoc": 38808, + "loops": 38809, + "ĠSURF": 38810, + "Ġpassivation": 38811, + "Ġconsecutively": 38812, + "ĠAlfvén": 38813, + "ĠSSE": 38814, + "Ġouts": 38815, + "stimulation": 38816, + "Ġphilosophical": 38817, + "ĠSask": 38818, + "Ġflakes": 38819, + "Ġfingerprinting": 38820, + "Ġbuffalo": 38821, + "ĠWikimedia": 38822, + "Ġreconstitution": 38823, + "Ġepithelia": 38824, + "onk": 38825, + "eny": 38826, + "ĠMQ": 38827, + "ĠFork": 38828, + "endance": 38829, + "Ġgeneralisation": 38830, + "Ġpeoples": 38831, + "Ġconnector": 38832, + "gesia": 38833, + "interference": 38834, + "Ġcoloration": 38835, + "calculation": 38836, + "ĠAxial": 38837, + "ĠDESIGN": 38838, + "Ġrecession": 38839, + "Ġdissolve": 38840, + "ĠPartitioning": 38841, + "QxMD": 38842, + "GES": 38843, + "Vo": 38844, + "khar": 38845, + "ĠEAE": 38846, + "Ġcoarser": 38847, + "Ġposttraumatic": 38848, + "Ġsynthesised": 38849, + "silica": 38850, + "tetrahydropy": 38851, + "ĠPorter": 38852, + "vark": 38853, + "entanyl": 38854, + "Ġconve": 38855, + "Ġrafts": 38856, + "brecht": 38857, + "Ġrectifier": 38858, + "Ġoroph": 38859, + "ĠCEP": 38860, + "Ġhistones": 38861, + "Ġstandpoint": 38862, + "Ġancillary": 38863, + "ĠHurricane": 38864, + "cro": 38865, + "Ġreb": 38866, + "ĠiT": 38867, + "Ġgeography": 38868, + "olarization": 38869, + "ĠManaging": 38870, + "Ġxylose": 38871, + "utherland": 38872, + "ĠTaqMan": 38873, + "KN": 38874, + "Ġtm": 38875, + "ĠTAS": 38876, + "istle": 38877, + "âĢ«": 38878, + "Ġmycorrhizal": 38879, + "ĠTerrestrial": 38880, + "hausen": 38881, + "observable": 38882, + "Brien": 38883, + "Ġneutropenia": 38884, + "Taken": 38885, + "ĠSMI": 38886, + "Ġpolishing": 38887, + "Ġphotop": 38888, + "Ġthermalization": 38889, + "Ġpseudoscalar": 38890, + "ĠDominic": 38891, + "romyalgia": 38892, + "Ġechocardiographic": 38893, + "Illumina": 38894, + "ĠIPC": 38895, + "ĠHuss": 38896, + "essive": 38897, + "uptake": 38898, + "Ġweekend": 38899, + "Ġcorroborate": 38900, + "ĠTasman": 38901, + "herty": 38902, + "Ġperine": 38903, + "Ġtransports": 38904, + "Ġglance": 38905, + "retinal": 38906, + "Proto": 38907, + "igenes": 38908, + "Ġprohibited": 38909, + "behavioral": 38910, + "opherol": 38911, + "ë¡": 38912, + "ĠNecess": 38913, + "obiology": 38914, + "okk": 38915, + "Ġtraversal": 38916, + "ĠAndes": 38917, + "Resource": 38918, + "olitic": 38919, + "ça": 38920, + "irie": 38921, + "arctan": 38922, + "Ġmorphogenetic": 38923, + "ĠHui": 38924, + "losses": 38925, + "Ġfulfilling": 38926, + "Ġhurricane": 38927, + "ombo": 38928, + "Ġgs": 38929, + "ĠLv": 38930, + "ĠNerv": 38931, + "ellosis": 38932, + "Ġconfront": 38933, + "Ġorthologous": 38934, + "Ġwettability": 38935, + "Ġcyanobacterial": 38936, + "Ġcassava": 38937, + "AUT": 38938, + "avi": 38939, + "hlen": 38940, + "ĠSLA": 38941, + "Ġconvol": 38942, + "Ġintermetallic": 38943, + "inside": 38944, + "Ġpolarizability": 38945, + "Ġensuing": 38946, + "Ġchloroplasts": 38947, + "lid": 38948, + "lips": 38949, + "Ġrebound": 38950, + "ĠCary": 38951, + "ĠLambda": 38952, + "ĠViv": 38953, + "Ġcalcination": 38954, + "ĠÌĨ": 38955, + "Ġcounterfactual": 38956, + "ĠSilica": 38957, + "Referee": 38958, + "Ġhomologues": 38959, + "ĠSpatiotemporal": 38960, + "ĠArrhenius": 38961, + "Ġinflamed": 38962, + "ĠZambia": 38963, + "Ġantipsychotic": 38964, + "helper": 38965, + "Blood": 38966, + "Ġpurchasing": 38967, + "ĠSchwinger": 38968, + "ĠWilkinson": 38969, + "Ġfainter": 38970, + "Ġrash": 38971, + "ĠJang": 38972, + "ĠConductivity": 38973, + "ropoda": 38974, + "ĠSeq": 38975, + "Ġpropolis": 38976, + "Ġtubule": 38977, + "ĠLieb": 38978, + "optimization": 38979, + "mounted": 38980, + "emes": 38981, + "canic": 38982, + "oradiotherapy": 38983, + "ĠJenkins": 38984, + "Nc": 38985, + "Together": 38986, + "Ġfove": 38987, + "Ġmv": 38988, + "ĠDefect": 38989, + "ät": 38990, + "ĠFinance": 38991, + "umarin": 38992, + "mittance": 38993, + "erel": 38994, + "ĠFren": 38995, + "ĠRhyth": 38996, + "ramified": 38997, + "Ġhypercholesterolem": 38998, + "Ġstimulatory": 38999, + "ĠRichmond": 39000, + "Ġadvancements": 39001, + "bles": 39002, + "xu": 39003, + "allation": 39004, + "Ġintral": 39005, + "iterpene": 39006, + "Concerning": 39007, + "Ġbulky": 39008, + "Ġá¾±": 39009, + "computation": 39010, + "ĠAgarwal": 39011, + "Central": 39012, + "XPS": 39013, + "Ġtalks": 39014, + "ĠTap": 39015, + "imilar": 39016, + "ĠNCI": 39017, + "Ġaccused": 39018, + "Ġtranscriptomes": 39019, + "Ġprovisioning": 39020, + "ĠEtOH": 39021, + "gm": 39022, + "Ġtid": 39023, + "ĠPOC": 39024, + "ffman": 39025, + "ĠIner": 39026, + "ĠUB": 39027, + "incubated": 39028, + "ĠAtrial": 39029, + "Ġfourteen": 39030, + "ĠAstronomical": 39031, + "ĠMiguel": 39032, + "ĠKov": 39033, + "Ġscipy": 39034, + "Ġthermoplastic": 39035, + "ĠManuel": 39036, + "ĠPromotion": 39037, + "ĠAccessed": 39038, + "Ġterritorial": 39039, + "inas": 39040, + "ĠMPs": 39041, + "monitoring": 39042, + "ĠSimulating": 39043, + "Ġpanor": 39044, + "Ġrheumatic": 39045, + "selectin": 39046, + "ĠLaparoscopic": 39047, + "HLA": 39048, + "ĠYale": 39049, + "spread": 39050, + "ETS": 39051, + "Ġglycans": 39052, + "Ġimmigrant": 39053, + "Donald": 39054, + "ĠCASE": 39055, + "ĠHII": 39056, + "glomer": 39057, + "Ġïĥİ": 39058, + "ĠExperiences": 39059, + "ĠVietnamese": 39060, + "Hodgkin": 39061, + "oader": 39062, + "heart": 39063, + "Ġremedy": 39064, + "Ġfacilitators": 39065, + "openhagen": 39066, + "dodec": 39067, + "ĠFriend": 39068, + "ĠTouch": 39069, + "arms": 39070, + "CRs": 39071, + "Ġultrahigh": 39072, + "ĠDriver": 39073, + "GEMENTS": 39074, + "ĠOu": 39075, + "Ġendocarditis": 39076, + "Ġautoencoder": 39077, + "Ġich": 39078, + "Ġfetch": 39079, + "urian": 39080, + "ĠORFs": 39081, + "Ġpermeabilized": 39082, + "ĠWiFi": 39083, + "ĠLithuan": 39084, + "Structure": 39085, + "Ln": 39086, + "houses": 39087, + "Ġought": 39088, + "ĠConcluding": 39089, + "Ġanniversary": 39090, + "ĠCreation": 39091, + "Ġblindness": 39092, + "ĠpcDNA": 39093, + "ĠSusan": 39094, + "ĠBenjamini": 39095, + "ĠSentence": 39096, + "Ġsnd": 39097, + "Ġfins": 39098, + "phis": 39099, + "ĠModules": 39100, + "Ġneuropsychiatric": 39101, + "ĠPotassium": 39102, + "Ġsacrifice": 39103, + "Ġdyspnea": 39104, + "Ġdeliberately": 39105, + "omegaly": 39106, + "Media": 39107, + "Temporal": 39108, + "Ġshark": 39109, + "SCAN": 39110, + "splitting": 39111, + "Ġmisuse": 39112, + "Ġbirefringence": 39113, + "ĠÖĴâĨĴ": 39114, + "Ġpier": 39115, + "Ġnurs": 39116, + "ĠSclerosis": 39117, + "adhy": 39118, + "Ġundetermined": 39119, + "Ġcomplementation": 39120, + "ĠAffect": 39121, + "ĠHamps": 39122, + "Ġgob": 39123, + "ĠFate": 39124, + "ĠHAL": 39125, + "ĠKiss": 39126, + "Ġmicrobe": 39127, + "Ġcarbonaceous": 39128, + "Ġliposome": 39129, + "ĠUsage": 39130, + "Ġquasiparticles": 39131, + "Ġcasp": 39132, + "ĠNarrow": 39133, + "Ġoutlook": 39134, + "ĠChord": 39135, + "Ġclaiming": 39136, + "Ġdiverging": 39137, + "ĠBioinformatics": 39138, + "ĠPsychiatric": 39139, + "ĠMasters": 39140, + "Ġllvm": 39141, + "ĠIQR": 39142, + "phases": 39143, + "ĠThy": 39144, + "erger": 39145, + "ĠDipl": 39146, + "SFR": 39147, + "Ġcredited": 39148, + "ĠTetra": 39149, + "âĭ¯": 39150, + "Ġamniotic": 39151, + "ĠCharlotte": 39152, + "Cox": 39153, + "Hard": 39154, + "article": 39155, + "ĠDEA": 39156, + "ĠEclipse": 39157, + "ĠLMP": 39158, + "Ġimprison": 39159, + "ĠVarying": 39160, + "ESCs": 39161, + "ĠTHEO": 39162, + "Ġnervosa": 39163, + "Ġprecedes": 39164, + "Ġgyro": 39165, + "ĠWORDS": 39166, + "ĠDakota": 39167, + "utory": 39168, + "ĠEmer": 39169, + "adam": 39170, + "ĠNah": 39171, + "ĠVirgo": 39172, + "Setting": 39173, + "PQ": 39174, + "å®": 39175, + "erus": 39176, + "Ġcep": 39177, + "Ġbd": 39178, + "dier": 39179, + "Ġimbalanced": 39180, + "Ġtimestep": 39181, + "än": 39182, + "ĠRabbit": 39183, + "Ġhamsters": 39184, + "Ġmedulla": 39185, + "ĠChromatography": 39186, + "INPUT": 39187, + "Ġlossy": 39188, + "Pseud": 39189, + "ĠPBL": 39190, + "ĠDomestic": 39191, + "iau": 39192, + "ancell": 39193, + "Ġmultilayers": 39194, + "Ġsubsidi": 39195, + "ĠUtilizing": 39196, + "tune": 39197, + "rehend": 39198, + "arte": 39199, + "Ġburs": 39200, + "ĠNHE": 39201, + "Ġcloseness": 39202, + "ĠColour": 39203, + "ĠHomo": 39204, + "Equations": 39205, + "Ġsutures": 39206, + "acus": 39207, + "Ġknocked": 39208, + "Ġsecretary": 39209, + "Ġascertained": 39210, + "Ġinpatients": 39211, + "irts": 39212, + "Ġplut": 39213, + "ansson": 39214, + "rami": 39215, + "Ġosteotomy": 39216, + "ĠPrimers": 39217, + "ĠLegislative": 39218, + "ĠCardiology": 39219, + "Ġadmitting": 39220, + "Ġexcavation": 39221, + "ĠHedgehog": 39222, + "WG": 39223, + "frozen": 39224, + "Ġliber": 39225, + "ĠICE": 39226, + "chosen": 39227, + "ĠKohn": 39228, + "Stop": 39229, + "Phil": 39230, + "phagia": 39231, + "ĠBCA": 39232, + "Ġempt": 39233, + "Ġzz": 39234, + "opers": 39235, + "ĠSixty": 39236, + "eckman": 39237, + "Ġtransferrin": 39238, + "Ġpenalized": 39239, + "Being": 39240, + "Ġextruded": 39241, + "Ġminiature": 39242, + "Ġeditorial": 39243, + "Ġinterconnect": 39244, + "gro": 39245, + "kv": 39246, + "olen": 39247, + "ĠSYSTEMS": 39248, + "ĠColonel": 39249, + "ĠMediated": 39250, + "ĠEMD": 39251, + "Ġknife": 39252, + "Ġcytogenetic": 39253, + "Ġdigitized": 39254, + "abinoids": 39255, + "arterial": 39256, + "Ġdiarrhoea": 39257, + "bag": 39258, + "Ġbuccal": 39259, + "stay": 39260, + "ĠLAMP": 39261, + "oko": 39262, + "ĠPolyt": 39263, + "masked": 39264, + "ĠTunable": 39265, + "Ġcoagul": 39266, + "paras": 39267, + "Ġterminating": 39268, + "ICAg": 39269, + "ĠExcellence": 39270, + "Ġregurgitation": 39271, + "DQUFD": 39272, + "Jack": 39273, + "Ġapertures": 39274, + "ĠIp": 39275, + "ĠHCMV": 39276, + "ĠGom": 39277, + "Ġnucleophilic": 39278, + "Ġparenteral": 39279, + "TIM": 39280, + "oine": 39281, + "ĠnT": 39282, + "ĠSense": 39283, + "ĠFocal": 39284, + "ranges": 39285, + "Ġhept": 39286, + "ĠPlat": 39287, + "Ġmyx": 39288, + "Ġcodebook": 39289, + "Expl": 39290, + "ĠRhoA": 39291, + "Ġrhinitis": 39292, + "ĠErratum": 39293, + "Oriented": 39294, + "Well": 39295, + "doping": 39296, + "Ġbup": 39297, + "ĠImpedance": 39298, + "Ġsubstitutes": 39299, + "actorily": 39300, + "Ġcollaborations": 39301, + "ĠWayne": 39302, + "Ġvowels": 39303, + "ĠShadow": 39304, + "Ġphenology": 39305, + "Ġconcurrency": 39306, + "having": 39307, + "ĠCES": 39308, + "ĠFIN": 39309, + "ĠLoh": 39310, + "oxa": 39311, + "ĠAlN": 39312, + "ĠAlvarez": 39313, + "instit": 39314, + "Ġgermplasm": 39315, + "ĠBoliv": 39316, + "ĠRCP": 39317, + "assador": 39318, + "Ġesp": 39319, + "Ġphenotyping": 39320, + "Ġskipping": 39321, + "ĠFractal": 39322, + "ĠPEDOT": 39323, + "wake": 39324, + "ĠFIT": 39325, + "ĠESD": 39326, + "ĠAntif": 39327, + "ubiquitin": 39328, + "ĠAerial": 39329, + "ĠPrognosis": 39330, + "ĠRELATED": 39331, + "Ġstratigraphy": 39332, + "vatron": 39333, + "ĠPROPERTIES": 39334, + "Ġicon": 39335, + "isers": 39336, + "Ġwal": 39337, + "Ġstamp": 39338, + "ĠOptimum": 39339, + "Ġoligomeric": 39340, + "Ġinnerv": 39341, + "YA": 39342, + "Abcam": 39343, + "Ġvials": 39344, + "ĠGrig": 39345, + "Ġunaware": 39346, + "Ġopera": 39347, + "ĠWarner": 39348, + "Ġprotonated": 39349, + "ĠDRG": 39350, + "Ġtroubles": 39351, + "Ġpropositional": 39352, + "ĠAfghanistan": 39353, + "ĠHampshire": 39354, + "Gd": 39355, + "lung": 39356, + "Ġaviation": 39357, + "Ġapartment": 39358, + "Ġinfusions": 39359, + "Ġbroilers": 39360, + "ĠDisability": 39361, + "ĠRobots": 39362, + "Ġdebugging": 39363, + "ĠìĿ": 39364, + "Wilson": 39365, + "uprofen": 39366, + "obarbital": 39367, + "JB": 39368, + "isance": 39369, + "itizer": 39370, + "MIS": 39371, + "ĠARF": 39372, + "Ġprostheses": 39373, + "Ġdichloromethane": 39374, + "mCherry": 39375, + "ĠSSS": 39376, + "ĠLPA": 39377, + "SCF": 39378, + "attract": 39379, + "Ġcalibrations": 39380, + "Ġfibril": 39381, + "Ġhaploid": 39382, + "usalem": 39383, + "ĠNut": 39384, + "Ġdeut": 39385, + "chronic": 39386, + "NAP": 39387, + "ĠCytokines": 39388, + "rageen": 39389, + "ĠCategories": 39390, + "rains": 39391, + "Ġsummands": 39392, + "Ġproliferate": 39393, + "rylov": 39394, + "Ġpleasure": 39395, + "Ġdensit": 39396, + "ĠSURVE": 39397, + "HIP": 39398, + "hall": 39399, + "ĠFUS": 39400, + "Ġwasting": 39401, + "ERY": 39402, + "Ġstatins": 39403, + "Ġeastward": 39404, + "sometimes": 39405, + "Ġwrapping": 39406, + "ĠTWO": 39407, + "vine": 39408, + "Ġsacchar": 39409, + "Ġamateur": 39410, + "ĠÃĽ": 39411, + "Ġmyster": 39412, + "ĠMyo": 39413, + "Ġrhabd": 39414, + "ĠProtease": 39415, + "Ġcholera": 39416, + "ĠGov": 39417, + "ĠGCC": 39418, + "Ġclays": 39419, + "transmission": 39420, + "ĠHollywood": 39421, + "Ġxenob": 39422, + "FLOAT": 39423, + "Ġascent": 39424, + "Ġsharks": 39425, + "Ġinterferes": 39426, + "ĠFormer": 39427, + "ĠHartmann": 39428, + "sha": 39429, + "ĠSave": 39430, + "Ġparks": 39431, + "ĠVenn": 39432, + "Ġunions": 39433, + "Ġdiscour": 39434, + "Ġsuperlattices": 39435, + "Ġcoupler": 39436, + "proteins": 39437, + "ĠStationary": 39438, + "ĠEthernet": 39439, + "ĠFréchet": 39440, + "Ġkines": 39441, + "Ġjazz": 39442, + "Asn": 39443, + "Ġextensional": 39444, + "Ġtelomeres": 39445, + "Ġpermitting": 39446, + "Ġexhausted": 39447, + "ĠSphing": 39448, + "Turn": 39449, + "mind": 39450, + "Ġsf": 39451, + "ĠHak": 39452, + "ranolol": 39453, + "portation": 39454, + "Consistent": 39455, + "Ġventilated": 39456, + "ĠDISTRIB": 39457, + "Ġtelling": 39458, + "Ġmannose": 39459, + "ÃŃaz": 39460, + "Ġborne": 39461, + "Ġintensification": 39462, + "Ġenjoyed": 39463, + "ĠBruno": 39464, + "ĠSaturday": 39465, + "Ġcocycle": 39466, + "itate": 39467, + "Ġgolf": 39468, + "approved": 39469, + "ĠNikol": 39470, + "itri": 39471, + "ĠSentiment": 39472, + "Ġglow": 39473, + "Ġgyp": 39474, + "ĠPCT": 39475, + "aber": 39476, + "ĠWis": 39477, + "porum": 39478, + "Ġhyphae": 39479, + "feas": 39480, + "ĠTraits": 39481, + "ĠConflicts": 39482, + "degrading": 39483, + "Raman": 39484, + "pharmac": 39485, + "Ġimmunocyt": 39486, + "ĠBlake": 39487, + "Ġpseudoc": 39488, + "ĠCharacterisation": 39489, + "ĠGalileo": 39490, + "Enabl": 39491, + "Jy": 39492, + "Ġclav": 39493, + "Ġϳ": 39494, + "Ġcommunicated": 39495, + "eutical": 39496, + "Ġnanotechnology": 39497, + "ĠHassan": 39498, + "ĠTec": 39499, + "Ġhanging": 39500, + "ĠBSD": 39501, + "ĠContour": 39502, + "Ġfragility": 39503, + "Ġdisruptions": 39504, + "Ġfiniteness": 39505, + "ĠPhilippine": 39506, + "nicity": 39507, + "Ùĩ": 39508, + "ĠCrim": 39509, + "ĠCNF": 39510, + "ĠISI": 39511, + "adapter": 39512, + "ĠUCP": 39513, + "Ġtextured": 39514, + "AAV": 39515, + "keto": 39516, + "Np": 39517, + "counting": 39518, + "hynchus": 39519, + "Ġprosec": 39520, + "ĠAnnot": 39521, + "ĠHarbor": 39522, + "degrees": 39523, + "akar": 39524, + "ĠVik": 39525, + "bfd": 39526, + "Ġdrip": 39527, + "ĠCaucas": 39528, + "Ġtrench": 39529, + "Ġweed": 39530, + "Ġdistractor": 39531, + "genetic": 39532, + "specifically": 39533, + "ulfite": 39534, + "ĠConsistently": 39535, + "Ġbreakfast": 39536, + "Ġbullet": 39537, + "Ġlegisl": 39538, + "ĠTraumatic": 39539, + "Ġcollectors": 39540, + "ĠBullet": 39541, + "ĠMYB": 39542, + "ĠPink": 39543, + "versive": 39544, + "ĠAttem": 39545, + "Ġculturally": 39546, + "Bell": 39547, + "undef": 39548, + "vii": 39549, + "Ġhistocompatibility": 39550, + "letcher": 39551, + "ĠStef": 39552, + "Amp": 39553, + "ĠRid": 39554, + "ĠEucl": 39555, + "Ġdecryption": 39556, + "ĠSpencer": 39557, + "ĠBitcoin": 39558, + "wic": 39559, + "Ġcomplicate": 39560, + "ĠProposal": 39561, + "ĠÄĪ": 39562, + "aviruses": 39563, + "ĠFay": 39564, + "ĠRd": 39565, + "ĠGale": 39566, + "ĠMetastasis": 39567, + "ĠImprovements": 39568, + "©": 39569, + "Ġpolyester": 39570, + "Ġstratospheric": 39571, + "ĠSAH": 39572, + "Ġamphip": 39573, + "ĠAFP": 39574, + "ĠHair": 39575, + "ĠEPI": 39576, + "ĠUltrast": 39577, + "Ġâĭ¯": 39578, + "Ġgapless": 39579, + "Ham": 39580, + "etto": 39581, + "Ġthreonine": 39582, + "ĠECO": 39583, + "Ġia": 39584, + "Ġundist": 39585, + "Ġradiology": 39586, + "Ġsuperlattice": 39587, + "ibraries": 39588, + "Ġturbid": 39589, + "ĠPotentials": 39590, + "ĠPipeline": 39591, + "Ġwarfarin": 39592, + "WISE": 39593, + "ĠLid": 39594, + "Ġrecurring": 39595, + "ĠMono": 39596, + "ĠGovern": 39597, + "ĠAwareness": 39598, + "olab": 39599, + "iflora": 39600, + "stris": 39601, + "INDEX": 39602, + "ĠDementia": 39603, + "Does": 39604, + "wright": 39605, + "Íī": 39606, + "Ġsb": 39607, + "ĠDOM": 39608, + "ĠHBsAg": 39609, + "clinic": 39610, + "ĠExped": 39611, + "Ġproteas": 39612, + "Ġsterilization": 39613, + "ĠBanerjee": 39614, + "ĠPersonnel": 39615, + "âĮĭ": 39616, + "onephritis": 39617, + "omite": 39618, + "ĠCCF": 39619, + "ositi": 39620, + "ĠEucalyptus": 39621, + "ĠIsotope": 39622, + "coli": 39623, + "possibility": 39624, + "Ġstrontium": 39625, + "Ġraref": 39626, + "ĠInterstellar": 39627, + "kinin": 39628, + "ylethanol": 39629, + "JT": 39630, + "north": 39631, + "Ġcensored": 39632, + "istive": 39633, + "Ġnoticing": 39634, + "Ġshipping": 39635, + "Embed": 39636, + "Observ": 39637, + "Ġzeolites": 39638, + "ubit": 39639, + "Ġflaps": 39640, + "Ġdrifts": 39641, + "Ġtherapist": 39642, + "Ġpollination": 39643, + "aliplatin": 39644, + "Johnson": 39645, + "Ġimperfections": 39646, + "NY": 39647, + "Ġthalamic": 39648, + "ocarb": 39649, + "ozotocin": 39650, + "Ġtetramer": 39651, + "Plas": 39652, + "Ġmultichannel": 39653, + "ĠInsight": 39654, + "opods": 39655, + "ĠNacional": 39656, + "Ġimatinib": 39657, + "actual": 39658, + "ĠXOR": 39659, + "Ġblight": 39660, + "ĠLeading": 39661, + "amese": 39662, + "ĠAmplitude": 39663, + "ĠMonitor": 39664, + "ĠNeurological": 39665, + "propagating": 39666, + "Ġpaddle": 39667, + "ĠHarvest": 39668, + "Ġodont": 39669, + "BUF": 39670, + "Ġtactics": 39671, + "ĠAnisotropy": 39672, + "adip": 39673, + "ĠAlpine": 39674, + "Ġfeels": 39675, + "Ġmedieval": 39676, + "Ġelucidation": 39677, + "Ġheterotrophic": 39678, + "Ġrelaxing": 39679, + "Ġhappiness": 39680, + "ĠCytotoxicity": 39681, + "ĠRANKL": 39682, + "Walker": 39683, + "mig": 39684, + "ĠSSL": 39685, + "ĠSepsis": 39686, + "ĠGes": 39687, + "Ġhydrochloric": 39688, + "Ġclarification": 39689, + "Ġdisparate": 39690, + "tested": 39691, + "Ġdatap": 39692, + "Ġnovels": 39693, + "ĠMicroc": 39694, + "ál": 39695, + "ĠARC": 39696, + "ĠYangtze": 39697, + "etomidine": 39698, + "ĠMatrigel": 39699, + "ihilation": 39700, + "ĠcDNAs": 39701, + "Ġprostat": 39702, + "ĠRailroad": 39703, + "UBLE": 39704, + "ĠPARTIC": 39705, + "ĠSax": 39706, + "Ġinsecurity": 39707, + "Ġcrushed": 39708, + "Ġhalves": 39709, + "giant": 39710, + "ĠCroatia": 39711, + "icyclo": 39712, + "ĠUnexpected": 39713, + "Ġloneliness": 39714, + "anu": 39715, + "Ġchampions": 39716, + "uberculosis": 39717, + "Ġequi": 39718, + "Ġaccreted": 39719, + "Ġinvading": 39720, + "Ġafferents": 39721, + "Ġalternation": 39722, + "Ġkinet": 39723, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 39724, + "ĠMAGNET": 39725, + "ĠFIFA": 39726, + "zadeh": 39727, + "iphenyl": 39728, + "ĠKro": 39729, + "ĠEvaluate": 39730, + "illiant": 39731, + "curvature": 39732, + "ĠPierce": 39733, + "better": 39734, + "nos": 39735, + "à¥": 39736, + "ĠKCN": 39737, + "ĠStrand": 39738, + "caemic": 39739, + "ĠHoechst": 39740, + "ĠEXT": 39741, + "ĠLLVM": 39742, + "BZ": 39743, + "tgt": 39744, + "ondialdehyde": 39745, + "ĠEvid": 39746, + "ĠGul": 39747, + "Ġmultiplications": 39748, + "Ġauth": 39749, + "ĠAustral": 39750, + "Ġstaying": 39751, + "ĠGlutamate": 39752, + "Ġstray": 39753, + "ĠISA": 39754, + "Ġlowland": 39755, + "Ġparallels": 39756, + "Ġattractiveness": 39757, + "Ġelectrospinning": 39758, + "Ġportrayed": 39759, + "ospecific": 39760, + "folate": 39761, + "Ġcoeff": 39762, + "ĠEstrogen": 39763, + "tumour": 39764, + "Ġhysterectomy": 39765, + "Ġinositol": 39766, + "ĠBaz": 39767, + "istein": 39768, + "Ġcrucially": 39769, + "Ġdinoflag": 39770, + "ÍĶÍĴ": 39771, + "ĠDragon": 39772, + "ĠSpor": 39773, + "ĠMater": 39774, + "ĠHero": 39775, + "plicing": 39776, + "ĠANT": 39777, + "ĠFormic": 39778, + "Queue": 39779, + "ocarcinomas": 39780, + "UPS": 39781, + "ĠPc": 39782, + "encoders": 39783, + "Ġinvaded": 39784, + "ĠPhases": 39785, + "Ġpostmortem": 39786, + "Ġslows": 39787, + "ĠMcL": 39788, + "ĠVerma": 39789, + "ĠViability": 39790, + "Ġcompensating": 39791, + "Ġclamped": 39792, + "jm": 39793, + "ĠRiv": 39794, + "upon": 39795, + "ĠDickinson": 39796, + "initiated": 39797, + "Ġsider": 39798, + "ĠSelen": 39799, + "ĠAka": 39800, + "idelberg": 39801, + "Ġqualifying": 39802, + "Ġenforcing": 39803, + "otrophs": 39804, + "ĠSNAP": 39805, + "Ġrust": 39806, + "imburs": 39807, + "Ġimmunocompromised": 39808, + "ĠFleming": 39809, + "Ġlizards": 39810, + "dialysis": 39811, + "ĠUnivariate": 39812, + "Ġgasoline": 39813, + "Ġtenure": 39814, + "Ġsustaining": 39815, + "Ġmotone": 39816, + "bay": 39817, + "wani": 39818, + "orestation": 39819, + "ĠXII": 39820, + "Ġradiofrequency": 39821, + "ĠGuided": 39822, + "Individual": 39823, + "ĠSpectrometer": 39824, + "ĠGoing": 39825, + "ĠMartins": 39826, + "Approxim": 39827, + "amak": 39828, + "ĠâĪı": 39829, + "ĠOmn": 39830, + "Ġoutpatients": 39831, + "Ġhyperbol": 39832, + "ĠPerceptual": 39833, + "ĠBurke": 39834, + "Boltzmann": 39835, + "ĠMd": 39836, + "Ġpaw": 39837, + "ĠCathedral": 39838, + "Ġhyaluron": 39839, + "Ġbrachial": 39840, + "Ġaflatoxin": 39841, + "imo": 39842, + "Ġenrol": 39843, + "Ġdetonation": 39844, + "Ġoverly": 39845, + "thest": 39846, + "Ġsecondly": 39847, + "ĠSchiz": 39848, + "ĠIGFBP": 39849, + "atechin": 39850, + "Ġsaves": 39851, + "tiers": 39852, + "ĠBates": 39853, + "Ġalliance": 39854, + "Ġattri": 39855, + "Ġastro": 39856, + "ĠPathological": 39857, + "Ġgambiae": 39858, + "Park": 39859, + "idable": 39860, + "ĠNil": 39861, + "ĠJas": 39862, + "Ġneeding": 39863, + "meier": 39864, + "Ġferroptosis": 39865, + "ĠGuidance": 39866, + "AZ": 39867, + "iol": 39868, + "Ġacknowledg": 39869, + "exual": 39870, + "Ġmenopause": 39871, + "Ġadjunct": 39872, + "capture": 39873, + "ĠDeputy": 39874, + "Ġbial": 39875, + "ifa": 39876, + "ĠChitosan": 39877, + "ĠTopics": 39878, + "ĠPlasmid": 39879, + "calculations": 39880, + "give": 39881, + "responders": 39882, + "ulla": 39883, + "ĠMoreno": 39884, + "Ġcommentary": 39885, + "ĠMahm": 39886, + "": 39887, + "onacci": 39888, + "ĠCould": 39889, + "ĠTRP": 39890, + "seconds": 39891, + "GraphPad": 39892, + "Little": 39893, + "hey": 39894, + "Ġalike": 39895, + "ĠDias": 39896, + "aroo": 39897, + "Ġı": 39898, + "Ġtaxes": 39899, + "phenanth": 39900, + "ĠCheung": 39901, + "ĠPiet": 39902, + "Df": 39903, + "GU": 39904, + "mectin": 39905, + "zee": 39906, + "Ġdλ": 39907, + "Ġsyntheses": 39908, + "ĠáĪ": 39909, + "Simulation": 39910, + "ĠEleven": 39911, + "worms": 39912, + "lymphocyte": 39913, + "Ġhaemorrhage": 39914, + "ĠOwn": 39915, + "ĠKant": 39916, + "Ġoverse": 39917, + "Ġideation": 39918, + "ĠHarper": 39919, + "Acknowledgments": 39920, + "vili": 39921, + "yna": 39922, + "ĠRecurrence": 39923, + "oza": 39924, + "Ġhenceforth": 39925, + "zees": 39926, + "Ġquasic": 39927, + "Ġchoroidal": 39928, + "Ġantimalarial": 39929, + "Ġcoarsening": 39930, + "Deb": 39931, + "diam": 39932, + "ĠWeights": 39933, + "Ġbuying": 39934, + "Ġmessaging": 39935, + "February": 39936, + "Extended": 39937, + "ĠRossi": 39938, + "Ġmistaken": 39939, + "Ġutero": 39940, + "jas": 39941, + "icitis": 39942, + "ĠTidal": 39943, + "Ġpharyngeal": 39944, + "click": 39945, + "Ġmyo": 39946, + "knock": 39947, + "Ġprominence": 39948, + "Ġamphiphilic": 39949, + "corn": 39950, + "Ġonboard": 39951, + "ĠDud": 39952, + "ĠWoman": 39953, + "ĠOutbreak": 39954, + "Ġpreferably": 39955, + "Ġsketches": 39956, + "Sat": 39957, + "fixing": 39958, + "ĠMey": 39959, + "ĠLetters": 39960, + "ITIES": 39961, + "ĠSDP": 39962, + "ĠLNCaP": 39963, + "DX": 39964, + "Fluor": 39965, + "Rv": 39966, + "Sect": 39967, + "ĠIons": 39968, + "Ġtrachom": 39969, + "Ġultrastructure": 39970, + "qvist": 39971, + "rophe": 39972, + "Ġreceipt": 39973, + "ĠQuint": 39974, + "Ġswapping": 39975, + "aminidase": 39976, + "Ġarchival": 39977, + "ĠCreating": 39978, + "ĠBarton": 39979, + "diagnosed": 39980, + "atological": 39981, + "olph": 39982, + "ĠPFA": 39983, + "ĠLAP": 39984, + "Ġunphysical": 39985, + "eqn": 39986, + "Ġquartiles": 39987, + "olytica": 39988, + "ĠFreed": 39989, + "Ġventilator": 39990, + "Ġkaryotype": 39991, + "Sta": 39992, + "still": 39993, + "ĠTate": 39994, + "urability": 39995, + "ĠGron": 39996, + "Ġtrimer": 39997, + "IPA": 39998, + "adeca": 39999, + "ĠImplementing": 40000, + "sity": 40001, + "itr": 40002, + "Ġbom": 40003, + "Ġnonrelativistic": 40004, + "Ġmicelle": 40005, + "ĠAdminist": 40006, + "Ġelectrolysis": 40007, + "harmon": 40008, + "OLOGICAL": 40009, + "Liter": 40010, + "ĠGUI": 40011, + "ĠQL": 40012, + "months": 40013, + "Ġsuperflu": 40014, + "cuts": 40015, + "Ġelicits": 40016, + "Ġmultiplexed": 40017, + "overlap": 40018, + "Ġcadaver": 40019, + "Ġou": 40020, + "ĠSheng": 40021, + "erea": 40022, + "ĠNBC": 40023, + "Ġdeter": 40024, + "tyrosine": 40025, + "ĠParts": 40026, + "Ġessay": 40027, + "kas": 40028, + "itted": 40029, + "ĠPZT": 40030, + "essler": 40031, + "Ġsimulators": 40032, + "Ġradiating": 40033, + "cutting": 40034, + "ĠCalculating": 40035, + "THER": 40036, + "ĠROCK": 40037, + "communic": 40038, + "Ġbonus": 40039, + "ĠCPA": 40040, + "ĠPUR": 40041, + "ulton": 40042, + "ĠZhi": 40043, + "Ġcaloric": 40044, + "Ġinterpolate": 40045, + "ĠSecretion": 40046, + "Ġneurocognitive": 40047, + "Ġgadolinium": 40048, + "frequencies": 40049, + "ĠTract": 40050, + "Ġminimax": 40051, + "ĠBrock": 40052, + "rypsin": 40053, + "ĠResonant": 40054, + "ĠACKNOWLEDGEMENTS": 40055, + "Dom": 40056, + "Ġholotype": 40057, + "Special": 40058, + "Ġimmunoreactive": 40059, + "ARNING": 40060, + "Panel": 40061, + "ĠJohannes": 40062, + "RFP": 40063, + "zzi": 40064, + "ĠPomer": 40065, + "Ġtransects": 40066, + "Ġpoured": 40067, + "EDs": 40068, + "ĠCircum": 40069, + "Ġabnormally": 40070, + "ĠPunj": 40071, + "Gol": 40072, + "Hop": 40073, + "Hex": 40074, + "ILE": 40075, + "Ġsourced": 40076, + "oclase": 40077, + "protobuf": 40078, + "Ġfrogs": 40079, + "ĠOttawa": 40080, + "Ġbiogeochemical": 40081, + "Ġlentivirus": 40082, + "Young": 40083, + "ĠIPS": 40084, + "assen": 40085, + "Ġunrestricted": 40086, + "Ġmatplotlib": 40087, + "Ġchloramphenicol": 40088, + "ĠContextual": 40089, + "ĠHawaiian": 40090, + "Legend": 40091, + "Sparse": 40092, + "bore": 40093, + "gaussian": 40094, + "uke": 40095, + "Ġâ̰": 40096, + "retest": 40097, + "SSE": 40098, + "preting": 40099, + "ĠPanama": 40100, + "ĠBroadband": 40101, + "conjugate": 40102, + "Bytes": 40103, + "GSH": 40104, + "Uns": 40105, + "rina": 40106, + "Ġdrained": 40107, + "Ġscap": 40108, + "Ġinvested": 40109, + "Ġsatisfactorily": 40110, + "Ġherbivores": 40111, + "Ġarachidonic": 40112, + "ymetrix": 40113, + "Ġnect": 40114, + "Ġconges": 40115, + "ĠMerr": 40116, + "ĠMai": 40117, + "Chain": 40118, + "Ġretrieving": 40119, + "Collection": 40120, + "ĠMTX": 40121, + "ĠFernando": 40122, + "hg": 40123, + "ĠRams": 40124, + "thresh": 40125, + "apsules": 40126, + "Ġconduit": 40127, + "swap": 40128, + "Ġblowing": 40129, + "ĠNyquist": 40130, + "Ġunconscious": 40131, + "ĠDIFFERENT": 40132, + "Techn": 40133, + "hiz": 40134, + "îĤ": 40135, + "Ġdξ": 40136, + "ĠSto": 40137, + "ĠFlavon": 40138, + "David": 40139, + "Ġfiltrate": 40140, + "lith": 40141, + "ĠWool": 40142, + "ĠKnot": 40143, + "Ġhalide": 40144, + "Ġbioassay": 40145, + "ĠGoldberg": 40146, + "ĠTrichoderma": 40147, + "Ġintraspecific": 40148, + "crystall": 40149, + "ĠRend": 40150, + "ourg": 40151, + "Ġundertake": 40152, + "ĠEnum": 40153, + "infect": 40154, + "Ġmidgut": 40155, + "attack": 40156, + "ĠCircle": 40157, + "Ġpleiotropic": 40158, + "escent": 40159, + "ĠFri": 40160, + "philis": 40161, + "astings": 40162, + "Ġbiogas": 40163, + "ĠÄľ": 40164, + "Ġaccompany": 40165, + "Ġrolled": 40166, + "Ġchirp": 40167, + "Ġsomatostatin": 40168, + "varkappa": 40169, + "Scal": 40170, + "Ġdrow": 40171, + "romed": 40172, + "ĠLup": 40173, + "ĠLuminosity": 40174, + "ĠNig": 40175, + "ferromagnetic": 40176, + "ĠToy": 40177, + "Ġcannabinoid": 40178, + "ĠHOX": 40179, + "iele": 40180, + "ĠCTX": 40181, + "Ġhydrop": 40182, + "Ġfavorite": 40183, + "Ġstretches": 40184, + "evaluated": 40185, + "ogroups": 40186, + "acal": 40187, + "ollo": 40188, + "Ġgenders": 40189, + "ĠGraft": 40190, + "Ġincidences": 40191, + "Ġreplacements": 40192, + "ĠTRUNC": 40193, + "CRF": 40194, + "Ġequalization": 40195, + "ĠRenew": 40196, + "Ġplethora": 40197, + "ĠEncoder": 40198, + "Mit": 40199, + "Ġcaches": 40200, + "orate": 40201, + "endors": 40202, + "ĠCaution": 40203, + "ĠAbel": 40204, + "compression": 40205, + "ĠLarsen": 40206, + "ĠElimination": 40207, + "Ġtester": 40208, + "Ġninth": 40209, + "ĠLö": 40210, + "Ġspiders": 40211, + "Ġpoem": 40212, + "Ġeducators": 40213, + "ĠEnhances": 40214, + "destructive": 40215, + "Fourier": 40216, + "Ġseismicity": 40217, + "ĠYunnan": 40218, + "Riemannian": 40219, + "WID": 40220, + "vular": 40221, + "ĠBorder": 40222, + "Ġcombin": 40223, + "singlet": 40224, + "ĠEddington": 40225, + "ĠTemplate": 40226, + "ĠPAX": 40227, + "Ġbasalts": 40228, + "Enh": 40229, + "Ġassistants": 40230, + "ĠCascade": 40231, + "Ġinbreeding": 40232, + "chini": 40233, + "Ġupgraded": 40234, + "ĠTransit": 40235, + "survival": 40236, + "Ġinjector": 40237, + "ĠPascal": 40238, + "DEVICE": 40239, + "Ġfost": 40240, + "ĠKand": 40241, + "Ġextragalactic": 40242, + "ependently": 40243, + "Ġexcite": 40244, + "Ġfulfil": 40245, + "Ġriparian": 40246, + "Ġuploaded": 40247, + "aun": 40248, + "lod": 40249, + "saving": 40250, + "ĠHib": 40251, + "ĠEra": 40252, + "obese": 40253, + "Ġui": 40254, + "Ġspectrally": 40255, + "keV": 40256, + "xxx": 40257, + "ĠOtto": 40258, + "Ġétale": 40259, + "LAT": 40260, + "dermal": 40261, + "diaz": 40262, + "ĠPli": 40263, + "Ġlegume": 40264, + "Ġinspect": 40265, + "Ġthymic": 40266, + "ĠHormone": 40267, + "áĢ": 40268, + "inot": 40269, + "ĠShib": 40270, + "ĠBCC": 40271, + "ĠVital": 40272, + "Ġprofits": 40273, + "ĠFederated": 40274, + "Ġflipped": 40275, + "Ġproprietary": 40276, + "incorporated": 40277, + "Ġbacteremia": 40278, + "Ġáŀĩ": 40279, + "fins": 40280, + "ä½": 40281, + "esia": 40282, + "ĠHollow": 40283, + "geons": 40284, + "Ġtrehalose": 40285, + "ERO": 40286, + "osterol": 40287, + "omus": 40288, + "ĠCrystall": 40289, + "Ġcuration": 40290, + "Ġmagnon": 40291, + "ĠAmend": 40292, + "Ġharb": 40293, + "Ġneutrality": 40294, + "ĠDelphi": 40295, + "Ġnonsense": 40296, + "ĠHomeostasis": 40297, + "Ġexpenditures": 40298, + "Sequential": 40299, + "imodular": 40300, + "Ġzenith": 40301, + "ĠMoran": 40302, + "Ġbootstrapping": 40303, + "iomy": 40304, + "lactic": 40305, + "iture": 40306, + "Ġnat": 40307, + "Ġgab": 40308, + "Ġchat": 40309, + "regional": 40310, + "Ġcrashes": 40311, + "ĠAFB": 40312, + "Ġcrowded": 40313, + "Ġtweet": 40314, + "engineered": 40315, + "ĠCharged": 40316, + "Sche": 40317, + "ITIONS": 40318, + "ĠCoral": 40319, + "ĠEli": 40320, + "Ġinverting": 40321, + "Ġpedag": 40322, + "ĠSanders": 40323, + "Meanwhile": 40324, + "ĠGriffiths": 40325, + "PSCs": 40326, + "tize": 40327, + "ĠMail": 40328, + "Ġundec": 40329, + "Ġhermitian": 40330, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 40331, + "ĠExplos": 40332, + "Ġwestward": 40333, + "ĠConfirm": 40334, + "Begin": 40335, + "Ġfactories": 40336, + "ĠPRL": 40337, + "shear": 40338, + "Header": 40339, + "ĠFLAGS": 40340, + "anomal": 40341, + "ĠQW": 40342, + "ĠÌħ": 40343, + "oinositi": 40344, + "Ġmammography": 40345, + "Ġdepositional": 40346, + "EXP": 40347, + "residue": 40348, + "Ġunsatisfactory": 40349, + "Aβ": 40350, + "MUX": 40351, + "Ġstaged": 40352, + "ĠMMT": 40353, + "ĠKus": 40354, + "llo": 40355, + "Ġtrainer": 40356, + "adden": 40357, + "Ġpinch": 40358, + "WARE": 40359, + "Ġcabinet": 40360, + "CSP": 40361, + "ecum": 40362, + "oteric": 40363, + "ĠHav": 40364, + "Ġresume": 40365, + "Ġnetworked": 40366, + "share": 40367, + "ĠColle": 40368, + "Ġchemotactic": 40369, + "ĠGlyc": 40370, + "olkit": 40371, + "Ġbotulinum": 40372, + "ĠNeighborhood": 40373, + "mV": 40374, + "ĠHQ": 40375, + "efaciens": 40376, + "gett": 40377, + "Ġgeost": 40378, + "ĠCDW": 40379, + "Ģ̇": 40380, + "Ġfloors": 40381, + "representing": 40382, + "odiode": 40383, + "ĠInstance": 40384, + "Ġmonodis": 40385, + "drying": 40386, + "reasing": 40387, + "igi": 40388, + "Ġgout": 40389, + "ĠIEC": 40390, + "Ġflush": 40391, + "Ġtraded": 40392, + "Review": 40393, + "ĠïĤ¢": 40394, + "Ġà¤": 40395, + "Ġabbreviations": 40396, + "otherapies": 40397, + "Ġindeterminate": 40398, + "Ġglutaraldehyde": 40399, + "Ġattrition": 40400, + "jump": 40401, + "inde": 40402, + "ĠGri": 40403, + "arction": 40404, + "TRAIN": 40405, + "Ġescaped": 40406, + "atement": 40407, + "ĠPam": 40408, + "ĠGAM": 40409, + "productive": 40410, + "ĠAmericas": 40411, + "agenesis": 40412, + "ĠMixtures": 40413, + "ĠHooft": 40414, + "ĠWindow": 40415, + "Ġnodular": 40416, + "Ġechin": 40417, + "DOF": 40418, + "ĠDDT": 40419, + "electrical": 40420, + "ĠDecentralized": 40421, + "Ġcontradict": 40422, + "French": 40423, + "Ġaustr": 40424, + "ĠAPD": 40425, + "ĠDIM": 40426, + "ĠSten": 40427, + "ronomic": 40428, + "ĠPolymorphism": 40429, + "Ġcocc": 40430, + "itings": 40431, + "Ġsubcritical": 40432, + "ĠUniqueness": 40433, + "OPEN": 40434, + "rotoxicity": 40435, + "GenBank": 40436, + "atabases": 40437, + "Nets": 40438, + "uistic": 40439, + "yric": 40440, + "ĠSID": 40441, + "Ġcooked": 40442, + "ĠJudge": 40443, + "Ġparameterizations": 40444, + "Ġenumerated": 40445, + "ĠAsthma": 40446, + "Develop": 40447, + "Ġcake": 40448, + "ĠAges": 40449, + "venile": 40450, + "Ġflor": 40451, + "Ġcouldn": 40452, + "detach": 40453, + "Ġpipette": 40454, + "ĠInstant": 40455, + "Ġtentatively": 40456, + "ĠINTEGR": 40457, + "HQ": 40458, + "Mapping": 40459, + "cq": 40460, + "åĪ": 40461, + "SUM": 40462, + "fractions": 40463, + "ĠClaud": 40464, + "Formula": 40465, + "Axis": 40466, + "ĠBilly": 40467, + "ĠMethane": 40468, + "ĠIGM": 40469, + "cannot": 40470, + "س": 40471, + "Ġciting": 40472, + "ĠDynam": 40473, + "Ġlett": 40474, + "egler": 40475, + "ĠPhysicians": 40476, + "xFF": 40477, + "Ġoyster": 40478, + "ĠTOC": 40479, + "Ġsubarachnoid": 40480, + "ĠCOM": 40481, + "ITER": 40482, + "Ġbenzodiazep": 40483, + "Ġuncomplicated": 40484, + "tillo": 40485, + "Carbon": 40486, + "atem": 40487, + "Ġsel": 40488, + "ingo": 40489, + "IVITY": 40490, + "Ġcavern": 40491, + "Ġspacelike": 40492, + "ĠCollisions": 40493, + "straint": 40494, + "Ġmycobacterial": 40495, + "Ġtrachomatis": 40496, + "Ai": 40497, + "mf": 40498, + "ĠTric": 40499, + "tico": 40500, + "ĠElection": 40501, + "ĠKDM": 40502, + "ĠExosomes": 40503, + "afluor": 40504, + "Ġformalized": 40505, + "ĠELF": 40506, + "vphantom": 40507, + "ĠSME": 40508, + "ichuan": 40509, + "ĠVMs": 40510, + "Ġrostral": 40511, + "ofer": 40512, + "ramanian": 40513, + "intercal": 40514, + "Merck": 40515, + "ĠFerguson": 40516, + "HU": 40517, + "lj": 40518, + "Ġrack": 40519, + "Ġmicrograph": 40520, + "CTS": 40521, + "Ġpassively": 40522, + "ĠMasses": 40523, + "rangians": 40524, + "ĠADM": 40525, + "ĠProvided": 40526, + "ĠVeterans": 40527, + "sound": 40528, + "gex": 40529, + "ĠSpiral": 40530, + "Ġfossa": 40531, + "Ġthermodynamically": 40532, + "ĠStaining": 40533, + "Ġkar": 40534, + "eflon": 40535, + "ĠBruns": 40536, + "VAE": 40537, + "olyticus": 40538, + "Ġintranasal": 40539, + "ĠProspects": 40540, + "athers": 40541, + "Ġnumbering": 40542, + "ĠReplacement": 40543, + "ĠNoncommutative": 40544, + "quisitions": 40545, + "ĠSIMD": 40546, + "ĠArterial": 40547, + "ĠHGF": 40548, + "ĠGPP": 40549, + "Ġfluvial": 40550, + "neri": 40551, + "ĠCompressed": 40552, + "VIDIA": 40553, + "Ġshocked": 40554, + "dys": 40555, + "invariance": 40556, + "enstein": 40557, + "ĠSCM": 40558, + "ĠDod": 40559, + "Ġsho": 40560, + "Chlor": 40561, + "duino": 40562, + "Ġurgently": 40563, + "soc": 40564, + "etching": 40565, + "Ġdiffractive": 40566, + "ĠZF": 40567, + "Ġhyperplanes": 40568, + "Ġmyri": 40569, + "Ġferromagnetism": 40570, + "filament": 40571, + "Ġjustifies": 40572, + "fault": 40573, + "ĠHTS": 40574, + "ĠEPC": 40575, + "too": 40576, + "ĠTRAP": 40577, + "ión": 40578, + "rv": 40579, + "ĠBPD": 40580, + "ĠNod": 40581, + "posit": 40582, + "ĠConvers": 40583, + "Ġzeroes": 40584, + "ĠGlen": 40585, + "ĠDisturb": 40586, + "Ġtableau": 40587, + "Ġpseudot": 40588, + "ĠCollider": 40589, + "Ġadsorbents": 40590, + "ĠGrove": 40591, + "Ġkingdom": 40592, + "Est": 40593, + "Xs": 40594, + "czyk": 40595, + "ĠWille": 40596, + "ĠVOL": 40597, + "scar": 40598, + "ĠAdler": 40599, + "ĠOrchestra": 40600, + "Ġsparsely": 40601, + "glycosylation": 40602, + "Lac": 40603, + "otions": 40604, + "ĠIle": 40605, + "Ġbeacon": 40606, + "ĠRn": 40607, + "ullah": 40608, + "Ġtimelike": 40609, + "ĠForests": 40610, + "Ġupload": 40611, + "jit": 40612, + "ĠEDM": 40613, + "Ġtransplants": 40614, + "marker": 40615, + "ĠBreeding": 40616, + "ÎĶÎĶ": 40617, + "Ġfavorably": 40618, + "ĠTransformations": 40619, + "abeled": 40620, + "ĠPolitics": 40621, + "episode": 40622, + "Ġfut": 40623, + "Ġdithi": 40624, + "ĠMw": 40625, + "Ġtranspiration": 40626, + "Ġunlimited": 40627, + "ĠAntiv": 40628, + "PPV": 40629, + "Ġnomogram": 40630, + "Ġinvented": 40631, + "ĠSchedule": 40632, + "allows": 40633, + "Ġtransvers": 40634, + "Ġworkpiece": 40635, + "blacksquare": 40636, + "callback": 40637, + "ĠAthletic": 40638, + "hans": 40639, + "poles": 40640, + "Ġeavesdrop": 40641, + "ĠCone": 40642, + "oclim": 40643, + "ĠGhost": 40644, + "iterations": 40645, + "Ġweaken": 40646, + "Ġalkaloid": 40647, + "Ġveterans": 40648, + "Ġprostatectomy": 40649, + "Ġbog": 40650, + "ĠCed": 40651, + "ĠFever": 40652, + "ylan": 40653, + "archive": 40654, + "Ġattackers": 40655, + "Making": 40656, + "bane": 40657, + "ĠPull": 40658, + "ĠFLO": 40659, + "Ġcoaches": 40660, + "ĠVSM": 40661, + "okh": 40662, + "ĠSpo": 40663, + "amilial": 40664, + "principle": 40665, + "Ġaggressiveness": 40666, + "Ġgardens": 40667, + "SIG": 40668, + "Ġmbar": 40669, + ".....": 40670, + "Ġoptimizes": 40671, + "Ġmorphologic": 40672, + "hani": 40673, + "Ġgermanium": 40674, + "Enabled": 40675, + "wb": 40676, + "Ġforamen": 40677, + "ĠSPA": 40678, + "Ġmagnified": 40679, + "ĠSlater": 40680, + "ĠSyrian": 40681, + "Ġtert": 40682, + "Ġtraditions": 40683, + "Ġoffensive": 40684, + "Ġhydrology": 40685, + "ergetics": 40686, + "Phot": 40687, + "Ġperovskites": 40688, + "Ġwavenumbers": 40689, + "Ġosteoclasts": 40690, + "imedean": 40691, + "ĠBasketball": 40692, + "benzodiox": 40693, + "ĠTRUNCATED": 40694, + "Ġbishop": 40695, + "ĠSgr": 40696, + "ĠSatisfaction": 40697, + "agnostic": 40698, + "numeric": 40699, + "Ġnormals": 40700, + "Ġhumor": 40701, + "Ġcontinents": 40702, + "NATION": 40703, + "Lagrangian": 40704, + "Ġknees": 40705, + "ĠIDE": 40706, + "adas": 40707, + "adia": 40708, + "ĠOU": 40709, + "onds": 40710, + "ĠChaud": 40711, + "Ġslicing": 40712, + "ĠActor": 40713, + "Alt": 40714, + "Ġbroadcasts": 40715, + "osaurs": 40716, + "Ġpickle": 40717, + "Ġunfamiliar": 40718, + "allus": 40719, + "Ġhashing": 40720, + "incidence": 40721, + "Ġmetabolized": 40722, + "Ġhomogeneously": 40723, + "ĠFalcon": 40724, + "ĠÑģ": 40725, + "ĠCere": 40726, + "ĠCLA": 40727, + "ĠPaste": 40728, + "ĠFry": 40729, + "ĠDre": 40730, + "adult": 40731, + "Ġdiscounted": 40732, + "sensitized": 40733, + "erculous": 40734, + "ĠPixel": 40735, + "ĠBram": 40736, + "allo": 40737, + "ipative": 40738, + "ipality": 40739, + "ĠStrict": 40740, + "ĠTrinity": 40741, + "ĠClassifiers": 40742, + "ĠBasel": 40743, + "ĠCurcumin": 40744, + "ĠLUMO": 40745, + "Ġmediastinal": 40746, + "ĠFFA": 40747, + "Ġplenty": 40748, + "prised": 40749, + "Ġprinter": 40750, + "Ġcalcare": 40751, + "insn": 40752, + "ontology": 40753, + "Ġgrounding": 40754, + "ĠALDH": 40755, + "STRING": 40756, + "ĠFemales": 40757, + "ĠFocusing": 40758, + "assessment": 40759, + "ĠBluetooth": 40760, + "ëĬĶ": 40761, + "Ġego": 40762, + "ĠDAC": 40763, + "onding": 40764, + "randa": 40765, + "ĠLudwig": 40766, + "Ġantecedent": 40767, + "ĠErnst": 40768, + "dX": 40769, + "odeling": 40770, + "âĢĭ": 40771, + "Inser": 40772, + "ognormal": 40773, + "ĠTevatron": 40774, + "Ġcovariances": 40775, + "riging": 40776, + "ĠMgSO": 40777, + "carbonitrile": 40778, + "ĠLoren": 40779, + "Ġpolytopes": 40780, + "ĠParental": 40781, + "Ġunhealthy": 40782, + "itherto": 40783, + "ĠMotif": 40784, + "DataType": 40785, + "ĠMIPS": 40786, + "ĠPhosphorus": 40787, + "MoO": 40788, + "ĠPerturbations": 40789, + "Ġaphids": 40790, + "Ġanhydride": 40791, + "ideration": 40792, + "ĠMits": 40793, + "gravit": 40794, + "Ġdestinations": 40795, + "Commun": 40796, + "Ġtetrahedron": 40797, + "implicit": 40798, + "Ġassort": 40799, + "ĠSubt": 40800, + "ĠAcetyl": 40801, + "ecium": 40802, + "ĠNie": 40803, + "Ġoperand": 40804, + "ĠScher": 40805, + "azoles": 40806, + "tlement": 40807, + "ĠBlocking": 40808, + "Ġbottlenecks": 40809, + "ĠOccupational": 40810, + "HAS": 40811, + "Teller": 40812, + "Ġvague": 40813, + "esting": 40814, + "SNE": 40815, + "Ġphotoionization": 40816, + "Ġcomplaint": 40817, + "uspid": 40818, + "owler": 40819, + "Ġendocytic": 40820, + "Ġflocks": 40821, + "epsin": 40822, + "colors": 40823, + "otopes": 40824, + "ĠDepletion": 40825, + "ELLAR": 40826, + "armed": 40827, + "ĠTIR": 40828, + "Ġbullying": 40829, + "Ġâݧ": 40830, + "osporidium": 40831, + "Mr": 40832, + "ĠCic": 40833, + "ogal": 40834, + "Ġsectioned": 40835, + "Chapter": 40836, + "ĠContents": 40837, + "ĠPaths": 40838, + "ĠExplain": 40839, + "computing": 40840, + "Ġshrub": 40841, + "ĠMalaysian": 40842, + "Beta": 40843, + "Mad": 40844, + "Ros": 40845, + "Ġeyel": 40846, + "ĠACF": 40847, + "ĠMm": 40848, + "texture": 40849, + "Ġinterpretability": 40850, + "ĠTopic": 40851, + "Ġbadly": 40852, + "ĠmAh": 40853, + "Eg": 40854, + "RQ": 40855, + "pins": 40856, + "etc": 40857, + "ĠVogel": 40858, + "Ġhypoc": 40859, + "Ġrunaway": 40860, + "Ġpersonally": 40861, + "Ġbinders": 40862, + "sensory": 40863, + "ĠIPv": 40864, + "ranked": 40865, + "Ġfibrations": 40866, + "Ġstrawberry": 40867, + "arotomy": 40868, + "FLI": 40869, + "rator": 40870, + "odys": 40871, + "iran": 40872, + "ĠBead": 40873, + "ĠDAM": 40874, + "âĪĥ": 40875, + "Ġillusion": 40876, + "pidium": 40877, + "Place": 40878, + "Region": 40879, + "Ġallocations": 40880, + "Ġohmic": 40881, + "Ġnf": 40882, + "imino": 40883, + "ĠBris": 40884, + "itizing": 40885, + "proper": 40886, + "subgroup": 40887, + "Ġsalience": 40888, + "rangement": 40889, + "ĠMeaning": 40890, + "Ġbarcode": 40891, + "Ġneuropeptide": 40892, + "Ġendosperm": 40893, + "imab": 40894, + "Ġnanod": 40895, + "ĠMetz": 40896, + "Ġcollocation": 40897, + "ĠInfected": 40898, + "Ġpackaged": 40899, + "ĠADA": 40900, + "ĠBarth": 40901, + "ĠCNC": 40902, + "Ġcascaded": 40903, + "ĠStockholm": 40904, + "itas": 40905, + "ĠMMR": 40906, + "ĠDrought": 40907, + "Ġpermissible": 40908, + "Ġsciatic": 40909, + "Ġfringes": 40910, + "Ġexecutable": 40911, + "Ġstemness": 40912, + "ĠEndoscopic": 40913, + "aporin": 40914, + "TOP": 40915, + "eB": 40916, + "tur": 40917, + "ĠStages": 40918, + "anches": 40919, + "Ġnonperturbative": 40920, + "Ġmaritime": 40921, + "Ġcoverslips": 40922, + "Ġlagoon": 40923, + "Experiments": 40924, + "Ġcodewords": 40925, + "Encoder": 40926, + "das": 40927, + "prac": 40928, + "Ġpaddy": 40929, + "Ġdraining": 40930, + "Ġkids": 40931, + "Ġenemies": 40932, + "Ġmotile": 40933, + "Ġslack": 40934, + "bees": 40935, + "ĠSuppl": 40936, + "ĠBarber": 40937, + "ĠSPH": 40938, + "Ġcrystallite": 40939, + "fitted": 40940, + "cyclopent": 40941, + "ĠRMSD": 40942, + "Ġparkinson": 40943, + "Ġuncorrected": 40944, + "ĠSyntax": 40945, + "Ġmultinomial": 40946, + "ĠIncorporating": 40947, + "akrishnan": 40948, + "JL": 40949, + "NESS": 40950, + "mim": 40951, + "ĠTET": 40952, + "ĠPorph": 40953, + "ĠSchwe": 40954, + "Ġcatalogs": 40955, + "ĠAuthentication": 40956, + "Bro": 40957, + "ugar": 40958, + "ĠAmpl": 40959, + "Ġsapiens": 40960, + "ĠGANs": 40961, + "Ġnecessitates": 40962, + "tg": 40963, + "edal": 40964, + "ĠRear": 40965, + "opeptidase": 40966, + "ĠInformed": 40967, + "Ġtailor": 40968, + "ĠNNLO": 40969, + "Ġhemodynamics": 40970, + "Sy": 40971, + "dating": 40972, + "achers": 40973, + "ĠTodd": 40974, + "ĠMario": 40975, + "ĠUGT": 40976, + "ĠValent": 40977, + "Ġstreamlines": 40978, + "Ġwarrants": 40979, + "Ġrew": 40980, + "ĠMud": 40981, + "ĠGK": 40982, + "Ġcoke": 40983, + "ĠUran": 40984, + "Ġgrooves": 40985, + "ronate": 40986, + "ĠRadius": 40987, + "ĠSuite": 40988, + "atumoral": 40989, + "Workspace": 40990, + "ĠSynergistic": 40991, + "ĠAtherosclerosis": 40992, + "maz": 40993, + "argmax": 40994, + "shield": 40995, + "ontin": 40996, + "Ġlistener": 40997, + "ocytoma": 40998, + "ĠGrav": 40999, + "ĠJerusalem": 41000, + "pyrrolidin": 41001, + "ĠSprings": 41002, + "Ġseafloor": 41003, + "Ġdips": 41004, + "istani": 41005, + "obis": 41006, + "Ġphotodynamic": 41007, + "ADO": 41008, + "Ġionisation": 41009, + "Ġbarn": 41010, + "igenetics": 41011, + "Ġeconomies": 41012, + "ĠGlacier": 41013, + "Ġç": 41014, + "imes": 41015, + "ĠSasaki": 41016, + "chio": 41017, + "Ġassisting": 41018, + "ostin": 41019, + "Ġindiff": 41020, + "ĠShot": 41021, + "ĠNeuron": 41022, + "CDD": 41023, + "ĠCONST": 41024, + "ĠBSs": 41025, + "tas": 41026, + "association": 41027, + "parg": 41028, + "Ġescal": 41029, + "exercise": 41030, + "ĠAdela": 41031, + "Ġmyogenic": 41032, + "ĠNOAA": 41033, + "yclo": 41034, + "linal": 41035, + "ĠHut": 41036, + "Ġintroductory": 41037, + "Ġheterochromatin": 41038, + "Ġchemoresistance": 41039, + "Ġsimplifications": 41040, + "pyridin": 41041, + "Ġamyloidosis": 41042, + "Ġnanofiber": 41043, + "ĠSutton": 41044, + "ĠResilience": 41045, + "Parent": 41046, + "ĠLMS": 41047, + "Ġlets": 41048, + "ĠElderly": 41049, + "Ġirrevers": 41050, + "sheets": 41051, + "Effects": 41052, + "Ġellipses": 41053, + "ĠPhilosophy": 41054, + "Ġphotographic": 41055, + "HEAD": 41056, + "Ġreversibility": 41057, + "Ġfederated": 41058, + "ĠPhosphoserine": 41059, + "estimation": 41060, + "ĠHumph": 41061, + "Json": 41062, + "Ġfills": 41063, + "Ġverm": 41064, + "ĠSeif": 41065, + "withstanding": 41066, + "ĠYamada": 41067, + "eria": 41068, + "ĠFLA": 41069, + "ĠVick": 41070, + "toid": 41071, + "annier": 41072, + "Ġcancerous": 41073, + "PRINT": 41074, + "ĠMechanistic": 41075, + "Ġdusty": 41076, + "ĠAppend": 41077, + "ycin": 41078, + "Ġazo": 41079, + "Ġsizing": 41080, + "Ġcrayfish": 41081, + "avis": 41082, + "ĠAdvent": 41083, + "ĠCommunist": 41084, + "ĠIMU": 41085, + "pixels": 41086, + "Hall": 41087, + "past": 41088, + "ĠRous": 41089, + "ressional": 41090, + "aird": 41091, + "ĠADD": 41092, + "Ġsummarizing": 41093, + "Ġelectrol": 41094, + "Station": 41095, + "ĠLyα": 41096, + "ĠTMEM": 41097, + "Ġpeptidase": 41098, + "Dual": 41099, + "git": 41100, + "ĠBOD": 41101, + "ĠRham": 41102, + "ĠKak": 41103, + "Ġreadiness": 41104, + "ĠCompare": 41105, + "ĠRamos": 41106, + "significantly": 41107, + "Ġhairy": 41108, + "Ġvasopressin": 41109, + "ĠGuideline": 41110, + "BNP": 41111, + "Ġdirty": 41112, + "Ġinfimum": 41113, + "ĠAless": 41114, + "ĠVolcano": 41115, + "Magn": 41116, + "YY": 41117, + "ughlin": 41118, + "boplatin": 41119, + "ĠCantor": 41120, + "Ġclothes": 41121, + "ĠRw": 41122, + "Ġuseless": 41123, + "ĠKdV": 41124, + "operoxidase": 41125, + "ĠCorrect": 41126, + "Ġfatality": 41127, + "ĠRestriction": 41128, + "Computer": 41129, + "Department": 41130, + "Il": 41131, + "gang": 41132, + "ĠElectroc": 41133, + "obaric": 41134, + "Phen": 41135, + "Ġned": 41136, + "adh": 41137, + "issing": 41138, + "tooth": 41139, + "Ġmanuscripts": 41140, + "Ġbiotechnology": 41141, + "Supp": 41142, + "ĠPairwise": 41143, + "ĠParsing": 41144, + "dH": 41145, + "melt": 41146, + "rz": 41147, + "ĠCatalyst": 41148, + "emption": 41149, + "Ġshowers": 41150, + "BLEM": 41151, + "ĠBrothers": 41152, + "banon": 41153, + "Ġbrachy": 41154, + "metallicity": 41155, + "ĠCIS": 41156, + "ĠCopenhagen": 41157, + "Ġelder": 41158, + "Ġfinanc": 41159, + "odesic": 41160, + "Ġdevise": 41161, + "Ġsurvives": 41162, + "ĠðtÃŀ": 41163, + "Ġfascinating": 41164, + "Ġparallax": 41165, + "HOR": 41166, + "yth": 41167, + "onins": 41168, + "ĠEHR": 41169, + "ĠGates": 41170, + "obase": 41171, + "ĠConway": 41172, + "operations": 41173, + "manuel": 41174, + "ĠAbdominal": 41175, + "ĠARG": 41176, + "ĠGrö": 41177, + "Ġphotosens": 41178, + "ĠCoulter": 41179, + "ĠJulian": 41180, + "ĠLevine": 41181, + "Ġsarcoidosis": 41182, + "Ġpillars": 41183, + "ĠdR": 41184, + "ĠWG": 41185, + "Ġspeculation": 41186, + "anski": 41187, + "ĠGaussians": 41188, + "Schw": 41189, + "ĠNambu": 41190, + "parents": 41191, + "intrinsic": 41192, + "ĠKendall": 41193, + "ĠRg": 41194, + "Ġprototypical": 41195, + "brella": 41196, + "Ġtetrap": 41197, + "ĠPathophys": 41198, + "nmt": 41199, + "Ġergodicity": 41200, + "ĠYersinia": 41201, + "QO": 41202, + "ĠIAV": 41203, + "Ġchocolate": 41204, + "Ġconferring": 41205, + "ClNO": 41206, + "otia": 41207, + "Complete": 41208, + "ĠAMPA": 41209, + "ïĢŃ": 41210, + "Ġḡ": 41211, + "ĠiPSCs": 41212, + "ĠApparently": 41213, + "Ġintoxication": 41214, + "ĠFather": 41215, + "percent": 41216, + "Ġshaker": 41217, + "Ġfinancing": 41218, + "Ġgenitalia": 41219, + "members": 41220, + "Ġstagnation": 41221, + "hmatic": 41222, + "rored": 41223, + "Ġconidia": 41224, + "ataloader": 41225, + "ĠNeil": 41226, + "Ġliteratures": 41227, + "ĠGlc": 41228, + "ĠDevelopments": 41229, + "differentiation": 41230, + "ĠRevisited": 41231, + "nil": 41232, + "tom": 41233, + "diol": 41234, + "ĠAbell": 41235, + "Ġplastics": 41236, + "ĠLuke": 41237, + "adjacent": 41238, + "ĠBHs": 41239, + "ĠPositioning": 41240, + "ør": 41241, + "overexpressing": 41242, + "Ec": 41243, + "Pref": 41244, + "orting": 41245, + "Ġinch": 41246, + "ĠCatherine": 41247, + "ĠDMP": 41248, + "ĠOe": 41249, + "endothelial": 41250, + "ICES": 41251, + "ĠHadron": 41252, + "Ġrevisit": 41253, + "ĠPictures": 41254, + "ĠKnockdown": 41255, + "ilian": 41256, + "ĠALA": 41257, + "opamine": 41258, + "ĠLah": 41259, + "climate": 41260, + "Ġdistraction": 41261, + "arski": 41262, + "ĠAccount": 41263, + "reflex": 41264, + "Ġelongate": 41265, + "ĠAmbient": 41266, + "Cx": 41267, + "Machine": 41268, + "ĠJPEG": 41269, + "Ġclassifies": 41270, + "ĠRegulate": 41271, + "oplasia": 41272, + "injury": 41273, + "neighbors": 41274, + "ĠFORMATION": 41275, + "FIS": 41276, + "Sz": 41277, + "ĠOSC": 41278, + "Ġassembling": 41279, + "Ġintracerebral": 41280, + "supers": 41281, + "ĠpF": 41282, + "Ġheal": 41283, + "ĠVries": 41284, + "arche": 41285, + "ĠDecom": 41286, + "ĠDiffic": 41287, + "agenta": 41288, + "ĠSpirit": 41289, + "ĠIntersection": 41290, + "Ġendorsed": 41291, + "ĠNobel": 41292, + "iÏī": 41293, + "wu": 41294, + "phaly": 41295, + "Ġqueu": 41296, + "ĠForum": 41297, + "lander": 41298, + "Ġspectrometric": 41299, + "ĠHankel": 41300, + "ĠCSE": 41301, + "Ġresumed": 41302, + "ĠGRE": 41303, + "ACES": 41304, + "CTA": 41305, + "Ġbehaved": 41306, + "Monitor": 41307, + "ĠNikon": 41308, + "ĠCHARACTER": 41309, + "ĠSAL": 41310, + "ĠIch": 41311, + "ĠHSF": 41312, + "Ġgenotoxic": 41313, + "ificance": 41314, + "ĠChiang": 41315, + "ĠZen": 41316, + "ĠArrows": 41317, + "ĠPDT": 41318, + "ĠFLASH": 41319, + "ocortex": 41320, + "onstructing": 41321, + "Treatment": 41322, + "ĉĠĠĠĠĠĠ": 41323, + "edullary": 41324, + "ilty": 41325, + "indentation": 41326, + "Ġamended": 41327, + "Ġfled": 41328, + "rophication": 41329, + "ĠGLM": 41330, + "ĠOpera": 41331, + "HLH": 41332, + "Lite": 41333, + "bmod": 41334, + "Ġaversion": 41335, + "ĠSweet": 41336, + "Ġstreptavidin": 41337, + "ĠPairs": 41338, + "ugos": 41339, + "epoxy": 41340, + "Ġunspecified": 41341, + "Ġmicrochannel": 41342, + "ĠVictorian": 41343, + "Could": 41344, + "informed": 41345, + "Ġsits": 41346, + "Ġrx": 41347, + "Ġnep": 41348, + "touch": 41349, + "ROI": 41350, + "Ġheaders": 41351, + "flush": 41352, + "ĠPathogenic": 41353, + "Ġspacings": 41354, + "hetti": 41355, + "Ġmotivating": 41356, + "Ġstakeholder": 41357, + "ĠSymbolic": 41358, + "ĠCrani": 41359, + "Ġdispute": 41360, + "Ġassists": 41361, + "indler": 41362, + "ĠSpatio": 41363, + "ohm": 41364, + "Ġextrapolate": 41365, + "Ġelaboration": 41366, + "ĠGTPases": 41367, + "Ġcellulase": 41368, + "ĠTuc": 41369, + "olide": 41370, + "ĠAIM": 41371, + "plast": 41372, + "ĠBible": 41373, + "opoly": 41374, + "ubo": 41375, + "acean": 41376, + "ĠPenrose": 41377, + "ĠMapReduce": 41378, + "ĠKwon": 41379, + "Wall": 41380, + "Ġgcd": 41381, + "ĠArbitrary": 41382, + "Product": 41383, + "ĠGitHub": 41384, + "Fn": 41385, + "Ġck": 41386, + "ĠAus": 41387, + "Ġgrave": 41388, + "Ġmetabolically": 41389, + "Ġlisten": 41390, + "Ġextractions": 41391, + "ĠTrunc": 41392, + "ĠRadiology": 41393, + "conserving": 41394, + "ĠCompositional": 41395, + "reporting": 41396, + "sustain": 41397, + "îĢ": 41398, + "ĠObl": 41399, + "ĠkN": 41400, + "Stre": 41401, + "ĠSupergravity": 41402, + "ĠPVP": 41403, + "Ġcivilian": 41404, + "ĠTunnel": 41405, + "Ġhelicopter": 41406, + "ĠCambrian": 41407, + "Ġrg": 41408, + "ĠUPF": 41409, + "Ġpolyd": 41410, + "Ġobservability": 41411, + "container": 41412, + "nitros": 41413, + "ĠCutting": 41414, + "Ġdecouple": 41415, + "Ġcarboxy": 41416, + "crow": 41417, + "Ġcx": 41418, + "ĠKell": 41419, + "Ġprojectors": 41420, + "Ġmyocarditis": 41421, + "itoneum": 41422, + "conditioning": 41423, + "ĠETH": 41424, + "oyama": 41425, + "Ġphosphates": 41426, + "ĠSubjective": 41427, + "ĠSerre": 41428, + "Ġcollagenase": 41429, + "Ġvibrating": 41430, + "streptomycin": 41431, + "zhen": 41432, + "Ġcres": 41433, + "Ġcull": 41434, + "Ġhaven": 41435, + "ĠGPL": 41436, + "lessness": 41437, + "Ġviewpoints": 41438, + ",,,": 41439, + "ochromic": 41440, + "uyama": 41441, + "Ġpartnerships": 41442, + "LICENSE": 41443, + "ĠSIFT": 41444, + "resources": 41445, + "ĠGos": 41446, + "ivac": 41447, + "Ġneurogenic": 41448, + "Adj": 41449, + "Ġaquifers": 41450, + "ĠGlycos": 41451, + "ĠMatthews": 41452, + "ĠFriday": 41453, + "ĠpX": 41454, + "Ġante": 41455, + "ĠFenton": 41456, + "ĠEukary": 41457, + "ibal": 41458, + "ideae": 41459, + "Attention": 41460, + "ĠPolymerization": 41461, + "Ġflipping": 41462, + "ĠMediates": 41463, + "Ġstationarity": 41464, + "Ġechoes": 41465, + "alidomide": 41466, + "Ġdelineation": 41467, + "Ġnaval": 41468, + "ĠSomatic": 41469, + "Ġstub": 41470, + "ĠBever": 41471, + "ĠRiz": 41472, + "Ġresummation": 41473, + "Ġassault": 41474, + "Ġpreexisting": 41475, + "Ġhypermethylation": 41476, + "Ġconserving": 41477, + "recorded": 41478, + "amn": 41479, + "Ġchow": 41480, + "ĠKill": 41481, + "ĠProduced": 41482, + "Ġrefs": 41483, + "ĠEnzymes": 41484, + "Ġdeepest": 41485, + "&&&": 41486, + "ĠFRP": 41487, + "Ġmilieu": 41488, + "Ġirrigated": 41489, + "ĠAnatomical": 41490, + "Ġdissect": 41491, + "iliensis": 41492, + "razolo": 41493, + "ĠProbable": 41494, + "solve": 41495, + "confirmed": 41496, + "ohydrodynamic": 41497, + "library": 41498, + "ĠCiti": 41499, + "ĠPHA": 41500, + "itsky": 41501, + "Ġelectrone": 41502, + "naive": 41503, + "Ġribs": 41504, + "ĠPhotonic": 41505, + "Ġsubstantia": 41506, + "ĠESTIM": 41507, + "Ġduodenum": 41508, + "ĠChagas": 41509, + "ĠSURVEY": 41510, + "Press": 41511, + "bian": 41512, + "¤": 41513, + "hei": 41514, + "ĠVAR": 41515, + "Ġcolocalization": 41516, + "Ġpolyl": 41517, + "Ġdough": 41518, + "Ġmicrocontroller": 41519, + "Ġinternalized": 41520, + "Ġdischarging": 41521, + "ĠChlamydomonas": 41522, + "orad": 41523, + "itel": 41524, + "ĠWend": 41525, + "Ġlogits": 41526, + "Ġelectrocataly": 41527, + "ĠAmar": 41528, + "Ġappreciably": 41529, + "Ġneurotransmitters": 41530, + "formerly": 41531, + "cul": 41532, + "rata": 41533, + "ĠBalk": 41534, + "ĠOsm": 41535, + "Ġsymptomatology": 41536, + "ĠFIELD": 41537, + "ĠAPs": 41538, + "Ġgymn": 41539, + "ĠMMS": 41540, + "Ġrefresh": 41541, + "ĠIndices": 41542, + "Ġimplantable": 41543, + "shuffle": 41544, + "ĠHeath": 41545, + "Ġcrisp": 41546, + "Ġdissertation": 41547, + "ĠUlt": 41548, + "Description": 41549, + "ĠOriginally": 41550, + "ĠFn": 41551, + "ĠFLOW": 41552, + "ubility": 41553, + "Ġexams": 41554, + "ĠShor": 41555, + "ĠCdTe": 41556, + "psycho": 41557, + "Ġdictates": 41558, + "Ġparenchymal": 41559, + "ĠPretreatment": 41560, + "Ġremembered": 41561, + "Ġbras": 41562, + "otid": 41563, + "Ġrecommender": 41564, + "Ġflesh": 41565, + "pitch": 41566, + "inist": 41567, + "Ġbtitle": 41568, + "Ġlc": 41569, + "assigned": 41570, + "ĠAdvisory": 41571, + "ĠGeneva": 41572, + "weighting": 41573, + "ĠABTS": 41574, + "Ġhexagon": 41575, + "ovskite": 41576, + "ĠAPIs": 41577, + "Ġbolometric": 41578, + "Ġmultifaceted": 41579, + "iak": 41580, + "Ġtn": 41581, + "ĠBibli": 41582, + "prosy": 41583, + "ĠJama": 41584, + "Ġinfrastructures": 41585, + "ĠShare": 41586, + "Ġintrogression": 41587, + "transforms": 41588, + "Report": 41589, + "ĠTRANS": 41590, + "ĠEXP": 41591, + "ĠCBT": 41592, + "ĠUbiquitin": 41593, + "ĠThickness": 41594, + "pub": 41595, + "toxin": 41596, + "ĠFriction": 41597, + "ĠLAG": 41598, + "mails": 41599, + "ĠImmediately": 41600, + "Ġweakest": 41601, + "ĠMRS": 41602, + "Ġcalcareous": 41603, + "bath": 41604, + "Ġcg": 41605, + "urational": 41606, + "tero": 41607, + "ĠInoue": 41608, + "Ġinstructor": 41609, + "acceptor": 41610, + "ĠEvolving": 41611, + "ĠLuther": 41612, + "Ġresigned": 41613, + "ĠChond": 41614, + "ERF": 41615, + "Ġselector": 41616, + "Ġnewspapers": 41617, + "GRA": 41618, + "Spe": 41619, + "VH": 41620, + "rA": 41621, + "otine": 41622, + "ĠFACT": 41623, + "composition": 41624, + "riding": 41625, + "PCM": 41626, + "Ġmiddleware": 41627, + "ĠGRP": 41628, + "Phosph": 41629, + "ĠEPIC": 41630, + "speech": 41631, + "vortex": 41632, + "ĠHerschel": 41633, + "amis": 41634, + "otube": 41635, + "ĠGomez": 41636, + "comyc": 41637, + "ĠPhyto": 41638, + "ĠConserv": 41639, + "Ġcava": 41640, + "arrhyth": 41641, + "ĠRestricted": 41642, + "ilicity": 41643, + "ogap": 41644, + "CTP": 41645, + "ĠLatino": 41646, + "attenuated": 41647, + "mobility": 41648, + "anen": 41649, + "Ġnif": 41650, + "ĠVideos": 41651, + "ĠSchubert": 41652, + "Features": 41653, + "opropanol": 41654, + "ĠThirdly": 41655, + "atula": 41656, + "ĠCemetery": 41657, + "entist": 41658, + "Ġdeli": 41659, + "trials": 41660, + "Ġgranulation": 41661, + "TTG": 41662, + "Ġteleost": 41663, + "morill": 41664, + "orse": 41665, + "otypically": 41666, + "ĠAbility": 41667, + "Amino": 41668, + "aqueous": 41669, + "ĠpCO": 41670, + "econ": 41671, + "ĠLign": 41672, + "essels": 41673, + "Ġformulating": 41674, + "ĠToo": 41675, + "ĠTranslational": 41676, + "ourses": 41677, + "ubiquit": 41678, + "statistic": 41679, + "Ġbursting": 41680, + "Ġestuaries": 41681, + "ĠNanocom": 41682, + "Ġexports": 41683, + "Ġê": 41684, + "contaminated": 41685, + "Ġtubing": 41686, + "Ġautomobile": 41687, + "Ġmissile": 41688, + "Ġhierarchically": 41689, + "Ġrepairs": 41690, + "ĠImproves": 41691, + "ĠEFFECTS": 41692, + "QDs": 41693, + "roz": 41694, + "aric": 41695, + "Ġparsed": 41696, + "ĠBrink": 41697, + "Ġprogressing": 41698, + "ĠpermNeigh": 41699, + "Agg": 41700, + "ZX": 41701, + "sink": 41702, + "Ġwise": 41703, + "etence": 41704, + "ĠIc": 41705, + "loo": 41706, + "meida": 41707, + "Ġpolariton": 41708, + "ĠConnections": 41709, + "Ġhallmarks": 41710, + "Longrightarrow": 41711, + "Ġtheater": 41712, + "esar": 41713, + "Ġreimburs": 41714, + "Ġlogo": 41715, + "Ġexcreted": 41716, + "ĠNoisy": 41717, + "Ġleaks": 41718, + "ĠDaph": 41719, + "Ġparagraphs": 41720, + "Ġlandslides": 41721, + "Ġpreclude": 41722, + "Ġcoercivity": 41723, + "ĠBurkholderia": 41724, + "ĠGómez": 41725, + "price": 41726, + "Theory": 41727, + "surgery": 41728, + "fname": 41729, + "failure": 41730, + "liness": 41731, + "refer": 41732, + "rique": 41733, + "ĠDogs": 41734, + "ĠEUV": 41735, + "ĠVapor": 41736, + "CSR": 41737, + "Biggl": 41738, + "Constraint": 41739, + "gravitational": 41740, + "Ġcombinatorics": 41741, + "Ġarticulated": 41742, + "ĠBaxter": 41743, + "ĠUltrasonic": 41744, + "LTE": 41745, + "lop": 41746, + "Ġinteratomic": 41747, + "intuitive": 41748, + "simplex": 41749, + "Ġexperimented": 41750, + "organizing": 41751, + "ĠOsaka": 41752, + "hadron": 41753, + "Ġdendrimers": 41754, + "ĠElsevier": 41755, + "CIP": 41756, + "ĠBAP": 41757, + "ĠAlonso": 41758, + "artet": 41759, + "antis": 41760, + "Ġextracorporeal": 41761, + "Ġpowdered": 41762, + "ĠSettings": 41763, + "etallic": 41764, + "ĠTEC": 41765, + "ĠArena": 41766, + "Ġanod": 41767, + "ĠReagents": 41768, + "licenses": 41769, + "ĠRemove": 41770, + "Ġpronunciation": 41771, + "thinspace": 41772, + "ĠClinically": 41773, + "gative": 41774, + "Ġwage": 41775, + "ĠHap": 41776, + "ĠGrac": 41777, + "fft": 41778, + "Ġformate": 41779, + "infeld": 41780, + "ĠQuin": 41781, + "Ġglomerul": 41782, + "Way": 41783, + "Ġkills": 41784, + "Ġtransversely": 41785, + "variation": 41786, + "ennas": 41787, + "ĠPLL": 41788, + "Ġinstrumented": 41789, + "ĠSpark": 41790, + "Ġpillar": 41791, + "ĠCaval": 41792, + "aders": 41793, + "issen": 41794, + "scene": 41795, + "otherm": 41796, + "ées": 41797, + "Ġpracticing": 41798, + "ĠBMSCs": 41799, + "ĠFernandez": 41800, + "Ġbeside": 41801, + "few": 41802, + "ĠCru": 41803, + "Ġprod": 41804, + "anders": 41805, + "azoline": 41806, + "Ġlegislative": 41807, + "balances": 41808, + "URL": 41809, + "Ġstereotactic": 41810, + "Ġtribes": 41811, + "Ġá¹¼": 41812, + "ĠPANI": 41813, + "adreno": 41814, + "gotten": 41815, + "cranial": 41816, + "ĠMick": 41817, + "ĠMMC": 41818, + "adiazole": 41819, + "entiation": 41820, + "ĠGln": 41821, + "ĠHolstein": 41822, + "ĠExplorer": 41823, + "Ġosse": 41824, + "arthy": 41825, + "ĠEVALU": 41826, + "adrenaline": 41827, + "JJ": 41828, + "ĠCMA": 41829, + "ĠInactivation": 41830, + "ABS": 41831, + "ĠSTZ": 41832, + "Configuration": 41833, + "ĠOlfactory": 41834, + "ĠSulfur": 41835, + "symbols": 41836, + "ĠASTM": 41837, + "divergence": 41838, + "ĠOCR": 41839, + "medical": 41840, + "Ġviewer": 41841, + "Ġbombardment": 41842, + "fair": 41843, + "nice": 41844, + "elberg": 41845, + "ĠGPT": 41846, + "ĠKow": 41847, + "Ġphotosphere": 41848, + "Ġlabile": 41849, + "ĠShang": 41850, + "Ġhomotopic": 41851, + "SVD": 41852, + "becomes": 41853, + "Ġgonor": 41854, + "Ġdeuteron": 41855, + "Ġphylogenies": 41856, + "ĠSAF": 41857, + "rapment": 41858, + "ĠCHF": 41859, + "Plan": 41860, + "ĠLegal": 41861, + "ĠFredholm": 41862, + "Ġsharper": 41863, + "Ġnanorib": 41864, + "ĠBuffalo": 41865, + "BMD": 41866, + "Ġlg": 41867, + "osup": 41868, + "ĠOPC": 41869, + "Ġendophytic": 41870, + "ATR": 41871, + "ĠExpressions": 41872, + "ĠMusical": 41873, + "Introduction": 41874, + "ĠSLM": 41875, + "çois": 41876, + "oglycos": 41877, + "aglia": 41878, + "mussen": 41879, + "formans": 41880, + "Ġsubstructures": 41881, + "ympan": 41882, + "hae": 41883, + "shi": 41884, + "ĠInterpret": 41885, + "Ġcatabolic": 41886, + "Ġoccupations": 41887, + "ĠBifurc": 41888, + "Hydroxy": 41889, + "ĠKauf": 41890, + "sleep": 41891, + "amas": 41892, + "ĠSf": 41893, + "ĠMBP": 41894, + "Ġnonalcoholic": 41895, + "Ġdiscordant": 41896, + "Ġepigen": 41897, + "PRI": 41898, + "ĠRedshift": 41899, + "warn": 41900, + "Ġlaptop": 41901, + "Ġabrasive": 41902, + "îĤĿ": 41903, + "lh": 41904, + "ĠKnee": 41905, + "Ġscrat": 41906, + "Ġpoloidal": 41907, + "ĠUniv": 41908, + "omyosin": 41909, + "ĠAugmented": 41910, + "Ġtaxonom": 41911, + "ZrO": 41912, + "Ġphytochemicals": 41913, + "iten": 41914, + "ĠPatterson": 41915, + "thym": 41916, + "dihydropy": 41917, + "Ġky": 41918, + "ĠMetazoa": 41919, + "ALLY": 41920, + "Ġretinoblastoma": 41921, + "concatenate": 41922, + "Male": 41923, + "Ġomission": 41924, + "icher": 41925, + "ĠAzer": 41926, + "opp": 41927, + "pleasant": 41928, + "ningham": 41929, + "Ġaxially": 41930, + "HDFS": 41931, + "Ġfictional": 41932, + "Ï«": 41933, + "Ġnarc": 41934, + "Ġundertook": 41935, + "Ġmicrocirc": 41936, + "ONLY": 41937, + "IVER": 41938, + "ĠCycles": 41939, + "Meas": 41940, + "ĠGriffin": 41941, + "ĠPliocene": 41942, + "ĠpI": 41943, + "ĠAviation": 41944, + "ĠCategorical": 41945, + "ĠNils": 41946, + "Ġresidency": 41947, + "ĠLaur": 41948, + "Ġprefers": 41949, + "ĠassertEquals": 41950, + "Ġliquor": 41951, + "dM": 41952, + "osperm": 41953, + "ĠFUT": 41954, + "AlO": 41955, + "Ġcytometer": 41956, + "Ġstabilizers": 41957, + "Ġpremium": 41958, + "Serial": 41959, + "ĠWalking": 41960, + "íķľ": 41961, + "Ġconfronted": 41962, + "encapsulated": 41963, + "Card": 41964, + "ĠSeeds": 41965, + "abular": 41966, + "ukov": 41967, + "Listener": 41968, + "Choose": 41969, + "ĠSjö": 41970, + "Make": 41971, + "Ġisoc": 41972, + "amount": 41973, + "ATC": 41974, + "ija": 41975, + "Ġsulcus": 41976, + "ĠMöbius": 41977, + "ĠPrenatal": 41978, + "Ġß": 41979, + "Ġisochron": 41980, + "Ġbeans": 41981, + "ĠDens": 41982, + "ĠWelling": 41983, + "ĠOman": 41984, + "Stats": 41985, + "ĠValid": 41986, + "ĠReward": 41987, + "GK": 41988, + "Ġâ©": 41989, + "Ġelectroporation": 41990, + "ĠSNRs": 41991, + "Ġgarlic": 41992, + "ĠParticipant": 41993, + "ĠSplitting": 41994, + "ĠMeteorological": 41995, + "morillonite": 41996, + "Ġoedema": 41997, + "ĠDots": 41998, + "ĠClare": 41999, + "Ġstarter": 42000, + "Ġclimatology": 42001, + "Ġcommence": 42002, + "Ġfallen": 42003, + "ĠAuNPs": 42004, + "attrs": 42005, + "Ġconsultant": 42006, + "twisted": 42007, + "Solving": 42008, + "Ġcoercive": 42009, + "ë¡ľ": 42010, + "Kar": 42011, + "Ġstit": 42012, + "ĠSSB": 42013, + "ĠIW": 42014, + "Ġcanvas": 42015, + "pyruvate": 42016, + "methylsulfanyl": 42017, + "Ġastrophysics": 42018, + "ĠTraditionally": 42019, + "Ġexcitonic": 42020, + "wear": 42021, + "ĠTin": 42022, + "rosh": 42023, + "ĠClient": 42024, + "ĠCorrections": 42025, + "ĠPopular": 42026, + "ĠLiquids": 42027, + "finder": 42028, + "Ġstran": 42029, + "pline": 42030, + "orella": 42031, + "Ġincur": 42032, + "Ġarche": 42033, + "Ġmedically": 42034, + "Mur": 42035, + "peter": 42036, + "Ġbeverage": 42037, + "ĠNWs": 42038, + "Ġfolic": 42039, + "Ġspeculative": 42040, + "Ġñ": 42041, + "Ġribbons": 42042, + "ĠPriest": 42043, + "Quanti": 42044, + "Ġundisturbed": 42045, + "atche": 42046, + "assi": 42047, + "ĠPerforming": 42048, + "ĠElong": 42049, + "Ġmatchings": 42050, + "Ġfranchise": 42051, + "gio": 42052, + "ĠSarg": 42053, + "Ġaboard": 42054, + "cyclodextrin": 42055, + "ĠTHER": 42056, + "Ġsaturate": 42057, + "ĠKinematics": 42058, + "Ġpeptidoglycan": 42059, + "ĠShelf": 42060, + "tocopherol": 42061, + "Bottom": 42062, + "mith": 42063, + "rdx": 42064, + "zos": 42065, + "ĠtRNAs": 42066, + "utf": 42067, + "ENA": 42068, + "Ġlesson": 42069, + "Ġpolaron": 42070, + "braska": 42071, + "Ġathletic": 42072, + "Ġscrambled": 42073, + "Ġpursuing": 42074, + "Ġbodily": 42075, + "Ġcac": 42076, + "imen": 42077, + "ĠIκB": 42078, + "ĠRö": 42079, + "ĠRFC": 42080, + "ĠLPC": 42081, + "ĠiÏī": 42082, + "Ġdiary": 42083, + "Ġqueueing": 42084, + "ĠDivergence": 42085, + "ĠShigella": 42086, + "ĠUltrastruct": 42087, + "Ġtriphosphate": 42088, + "ĠImplant": 42089, + "Ġferrous": 42090, + "ĠBurton": 42091, + "ĠHertz": 42092, + "fabric": 42093, + "turing": 42094, + "ĠSSM": 42095, + "ograd": 42096, + "Ġmetazo": 42097, + "Chang": 42098, + "Ġadipogenesis": 42099, + "Ġnuisance": 42100, + "Ġanonymity": 42101, + "Ġrefrigerator": 42102, + "ìľ": 42103, + "oction": 42104, + "Ġsparing": 42105, + "Ġchalcogen": 42106, + "Ġobservatory": 42107, + "Ġbooster": 42108, + "ĠAndré": 42109, + "ĠSTO": 42110, + "yryl": 42111, + "ĠEDX": 42112, + "ĠDenver": 42113, + "Ġhomogenate": 42114, + "Callback": 42115, + "aC": 42116, + "hours": 42117, + "kova": 42118, + "ĠAUD": 42119, + "Ġspare": 42120, + "Ġpartons": 42121, + "ĠIntake": 42122, + "Ġrecognizable": 42123, + "ĠGoldstein": 42124, + "Ġstrikingly": 42125, + "Ġsanitation": 42126, + "Finder": 42127, + "Generation": 42128, + "boy": 42129, + "tam": 42130, + "ĠRPM": 42131, + "ivious": 42132, + "ylak": 42133, + "ophiles": 42134, + "Ġpriest": 42135, + "Ġeasiest": 42136, + "Ġdeliveries": 42137, + "Elmer": 42138, + "Ġzirconium": 42139, + "ĠMishra": 42140, + "ĠâĶ": 42141, + "ĠWDM": 42142, + "Ġperid": 42143, + "ĠZT": 42144, + "Ġlocalizes": 42145, + "ĠORs": 42146, + "ĠIDO": 42147, + "Ġpleasant": 42148, + "ĠMWCNTs": 42149, + "ĠJimmy": 42150, + "ĠYeh": 42151, + "gathered": 42152, + "kil": 42153, + "ĠKappa": 42154, + "Ġcartoon": 42155, + "ĠHeuristic": 42156, + "Ġsz": 42157, + "Ġorifice": 42158, + "Ġmannit": 42159, + "ĠCOMM": 42160, + "ICK": 42161, + "Ġfarmer": 42162, + "ĠSilencing": 42163, + "Ġprefixes": 42164, + "qc": 42165, + "ineurin": 42166, + "Ġinflated": 42167, + "ĠRez": 42168, + "Ġhydrodynamical": 42169, + "Ġoscillate": 42170, + "Ġpedestrians": 42171, + "ĠAngiotensin": 42172, + "ĠViscosity": 42173, + "Ġoligodendrocytes": 42174, + "Ġparotid": 42175, + "Layout": 42176, + "rageenan": 42177, + "Ġè": 42178, + "ĠmN": 42179, + "Ġdozen": 42180, + "exclusion": 42181, + "Ġpanic": 42182, + "ĠPDI": 42183, + "Ġtwentieth": 42184, + "ĠElectroph": 42185, + "Ġmicrobiology": 42186, + "Server": 42187, + "ĠParticipation": 42188, + "DET": 42189, + "Poss": 42190, + "ĠNemat": 42191, + "ĠNRF": 42192, + "arguments": 42193, + "Ġamylase": 42194, + "Ġargv": 42195, + "Ġresolves": 42196, + "Ġrevisions": 42197, + "Packet": 42198, + "Tools": 42199, + "YE": 42200, + "Ġtire": 42201, + "induction": 42202, + "asive": 42203, + "tonic": 42204, + "ém": 42205, + "carrying": 42206, + "ĠImmunoblot": 42207, + "ĠIPF": 42208, + "Ġdeteriorated": 42209, + "Ġjurisdiction": 42210, + "released": 42211, + "osmotic": 42212, + "Ġrestaurants": 42213, + "ï¸": 42214, + "ĠNm": 42215, + "Ġflips": 42216, + "Ġseparability": 42217, + "ĠRecursive": 42218, + "Ġpasture": 42219, + "ĠÄī": 42220, + "Ġblastocyst": 42221, + "MCP": 42222, + "Tb": 42223, + "uene": 42224, + "esulf": 42225, + "essim": 42226, + "Ġhen": 42227, + "ĠKull": 42228, + "ylum": 42229, + "arev": 42230, + "uests": 42231, + "ĠZip": 42232, + "Ġboats": 42233, + "Command": 42234, + "Continu": 42235, + "ĠBogoliubov": 42236, + "Ġmannitol": 42237, + "Know": 42238, + "г": 42239, + "ĠHack": 42240, + "Ġmassively": 42241, + "ĠAlloys": 42242, + "ĠCDP": 42243, + "ĠStereo": 42244, + "ĠElectrode": 42245, + "Ġisoflav": 42246, + "Ġinteroperability": 42247, + "ĠAdelaide": 42248, + "ĠPPD": 42249, + "ĠKou": 42250, + "Ġdiap": 42251, + "Ġconserve": 42252, + "Ġaggregating": 42253, + "Gluc": 42254, + "Ġîģ": 42255, + "Ġgust": 42256, + "ĠLeb": 42257, + "ETIC": 42258, + "ĠConsol": 42259, + "ĠMorita": 42260, + "Relative": 42261, + "Ġpaleo": 42262, + "Ġwitnesses": 42263, + "ĠLauren": 42264, + "azepine": 42265, + "ĠTY": 42266, + "ĠIdi": 42267, + "ĠMent": 42268, + "ĠRCA": 42269, + "igenin": 42270, + "ĠDefence": 42271, + "Ġpyrimidine": 42272, + "ĠTiN": 42273, + "Ġendothelin": 42274, + "Ġpandas": 42275, + "Ġswallowing": 42276, + "Ġcongestive": 42277, + "Ġvinc": 42278, + "ĠDIP": 42279, + "ĠHough": 42280, + "Ġzw": 42281, + "ĠKimura": 42282, + "representations": 42283, + "ĠPromote": 42284, + "ĠTerry": 42285, + "Ġhatched": 42286, + "lookup": 42287, + "Electron": 42288, + "Ġdormancy": 42289, + "Ġresign": 42290, + "Ġvaluations": 42291, + "Ġmakeup": 42292, + "ĠAmy": 42293, + "CLUD": 42294, + "SEP": 42295, + "tubule": 42296, + "Ġsoldier": 42297, + "ĠTz": 42298, + "ĠTrump": 42299, + "ĠKramer": 42300, + "coni": 42301, + "Ġengraft": 42302, + "Ġvacuole": 42303, + "Ġreplicating": 42304, + "itonitis": 42305, + "ĠBacteri": 42306, + "vaccinated": 42307, + "olt": 42308, + "ĠAhn": 42309, + "Ġanem": 42310, + "ĠBIT": 42311, + "geo": 42312, + "Ġmicrogravity": 42313, + "ĠShir": 42314, + "ĠWorldwide": 42315, + "Ġignor": 42316, + "ĠËĩ": 42317, + "Ġlubrication": 42318, + "java": 42319, + "vt": 42320, + "Ġyl": 42321, + "Ġhills": 42322, + "ĠFOL": 42323, + "Ġbasaltic": 42324, + "Neill": 42325, + "ĠEthiopian": 42326, + "ĠNOTCH": 42327, + "ĠMOSFET": 42328, + "leaving": 42329, + "ĠPter": 42330, + "ĠWeld": 42331, + "aple": 42332, + "Ġsandwic": 42333, + "Ġazide": 42334, + "ĠStimuli": 42335, + "Ġlizard": 42336, + "ĠCinc": 42337, + "ĠHain": 42338, + "icals": 42339, + "Ġcontacting": 42340, + "ĠMarx": 42341, + "Ġpsychotherapy": 42342, + "ĠRetin": 42343, + "Ġcatheterization": 42344, + "ĠNanoparticle": 42345, + "ĠTCC": 42346, + "vermectin": 42347, + "ĠBASE": 42348, + "Ġnotor": 42349, + "Ġelectronically": 42350, + "steroid": 42351, + "Ġbilaterally": 42352, + "Ġnephritis": 42353, + "Ġirritation": 42354, + "ĠProlonged": 42355, + "Your": 42356, + "heuristic": 42357, + "urgeon": 42358, + "Ġleftmost": 42359, + "ĠREVIEW": 42360, + "Ġgastrectomy": 42361, + "ENTIAL": 42362, + "Means": 42363, + "ĠDyson": 42364, + "Ġbrands": 42365, + "yields": 42366, + "mercapto": 42367, + "rub": 42368, + "ouncement": 42369, + "errno": 42370, + "Ġviewers": 42371, + "butan": 42372, + "ĠMalay": 42373, + "ylindrical": 42374, + "Ġprominently": 42375, + "Ġescaping": 42376, + "Ġquerying": 42377, + "Storage": 42378, + "Fos": 42379, + "codec": 42380, + "ĠcM": 42381, + "strates": 42382, + "glove": 42383, + "ĠTrajectories": 42384, + "Ġsterol": 42385, + "Ġhematopoiesis": 42386, + "Ġcuprates": 42387, + "Ok": 42388, + "daily": 42389, + "ĠBIO": 42390, + "ĠLICENSE": 42391, + "ellations": 42392, + "assy": 42393, + "SURE": 42394, + "Ġepinephrine": 42395, + "Ġdownwards": 42396, + "corner": 42397, + "assertTrue": 42398, + "Ġáºij": 42399, + "ĠSouza": 42400, + "MAG": 42401, + "porph": 42402, + "Ġeffluents": 42403, + "loem": 42404, + "oaddition": 42405, + "obutyl": 42406, + "elestial": 42407, + "Fem": 42408, + "mpi": 42409, + "ĠRs": 42410, + "ellates": 42411, + "ĠKag": 42412, + "Ġuncoupled": 42413, + "Ġlegumes": 42414, + "Ġomitting": 42415, + "û": 42416, + "ĠTABLE": 42417, + "haled": 42418, + "ĠÅģ": 42419, + "Ġmisfit": 42420, + "Ġmolars": 42421, + "otechnological": 42422, + "Markov": 42423, + "Ġpraised": 42424, + "ĠDab": 42425, + "ĠVij": 42426, + "entilation": 42427, + "ĠChatter": 42428, + "Ġboiled": 42429, + "Ġcatches": 42430, + "annotation": 42431, + "Signal": 42432, + "Ġleverages": 42433, + "Ġadvisory": 42434, + "song": 42435, + "ondition": 42436, + "Ġfug": 42437, + "raps": 42438, + "ĠMCD": 42439, + "particip": 42440, + "obian": 42441, + "Ġcounsel": 42442, + "ĠPRP": 42443, + "ediol": 42444, + "ĠŨ": 42445, + "Ġbruce": 42446, + "Shanghai": 42447, + "DataFrame": 42448, + "ĠCorrespondingly": 42449, + "Ġacrylamide": 42450, + "fellow": 42451, + "lob": 42452, + "igt": 42453, + "ĠCrystallization": 42454, + "Ġindomethacin": 42455, + "ĠPDR": 42456, + "giate": 42457, + "ĠPanels": 42458, + "complexes": 42459, + "ĠNicol": 42460, + "Ġfoliar": 42461, + "cubic": 42462, + "ĠdE": 42463, + "ĠCCM": 42464, + "plating": 42465, + "Ġresistors": 42466, + "ĠGaz": 42467, + "Ġoverturn": 42468, + "Ġrepress": 42469, + "Ġpots": 42470, + "ĠPIK": 42471, + "Ġdermis": 42472, + "Represent": 42473, + "ĠAndersson": 42474, + "Ġretrotranspos": 42475, + "ASA": 42476, + "Counter": 42477, + "Tet": 42478, + "imin": 42479, + "performed": 42480, + "ĠNept": 42481, + "Ġheel": 42482, + "rold": 42483, + "aires": 42484, + "Ġreadability": 42485, + "Ġbenefited": 42486, + "Ġpulsation": 42487, + "ĠBalancing": 42488, + "Ġevaporator": 42489, + "Ġeigens": 42490, + "ĠHospit": 42491, + "Ġtrails": 42492, + "ĠCoordinate": 42493, + "accase": 42494, + "ĠHRMS": 42495, + "signaling": 42496, + "ĠNPY": 42497, + "Ġameliorated": 42498, + "tuples": 42499, + "Ġmetasurface": 42500, + "ĠFrancesco": 42501, + "Ġspoof": 42502, + "îŸ": 42503, + "Fu": 42504, + "JK": 42505, + "ej": 42506, + "Ġgoss": 42507, + "ĠHim": 42508, + "Ġprioritized": 42509, + "Ġmesothelioma": 42510, + "idxs": 42511, + "Ġreconnaissance": 42512, + "Ġlamps": 42513, + "ãĢĤ": 42514, + "Ġreformulation": 42515, + "Ġdelirium": 42516, + "ĠNPR": 42517, + "ĠGamb": 42518, + "illas": 42519, + "-----": 42520, + "Ġdrilled": 42521, + "ĠGenotyping": 42522, + "ĠBlank": 42523, + "Ġpropeller": 42524, + "Ġcereals": 42525, + "ĠAirborne": 42526, + "ĠPhotocatalytic": 42527, + "ĠCavity": 42528, + "Ġdolphins": 42529, + "ĠsgRNA": 42530, + "understood": 42531, + "eous": 42532, + "Ġsax": 42533, + "olayer": 42534, + "ĠPend": 42535, + "ĠGET": 42536, + "cled": 42537, + "Ġü": 42538, + "Ġcytosine": 42539, + "Ġparallelization": 42540, + "MMs": 42541, + "ĠOrganisation": 42542, + "Models": 42543, + "Ġaccommodated": 42544, + "Ġcholest": 42545, + "Ġinactivity": 42546, + "ĠBoss": 42547, + "ĠGCS": 42548, + "Ġsoaked": 42549, + "ĠSecreted": 42550, + "Ġvacuolar": 42551, + "zoan": 42552, + "ĠGreene": 42553, + "Ġbolt": 42554, + "bj": 42555, + "ĠTall": 42556, + "Ġstor": 42557, + "ĠMob": 42558, + "Ġblurred": 42559, + "INO": 42560, + "ĠMetallic": 42561, + "uffs": 42562, + "ĠNOTE": 42563, + "Ġsonicated": 42564, + "obutyric": 42565, + "ĠtDCS": 42566, + "ĠNes": 42567, + "ospir": 42568, + "weigh": 42569, + "ĠRegulator": 42570, + "Ġhemolysis": 42571, + "Ġsounding": 42572, + "Ġcruciate": 42573, + "Ġcapsaicin": 42574, + "ĠTyrosine": 42575, + "ĠTell": 42576, + "ĠPEP": 42577, + "ĠRc": 42578, + "ĠEating": 42579, + "ĠGoals": 42580, + "uret": 42581, + "Ġearn": 42582, + "Ġcolleges": 42583, + "Ġchemoattract": 42584, + "Ġỹ": 42585, + "ĠEchocardi": 42586, + "Fort": 42587, + "sodium": 42588, + "amined": 42589, + "ĠNPP": 42590, + "ĠKalu": 42591, + "Ġdecipher": 42592, + "tetramethyl": 42593, + "ĠOPN": 42594, + "straight": 42595, + "Ġtempered": 42596, + "ĠHindu": 42597, + "ĠOrdinary": 42598, + "ĠAChE": 42599, + "JNK": 42600, + "fos": 42601, + "vcpu": 42602, + "enamide": 42603, + "ĠCrack": 42604, + "apical": 42605, + "Ġantiserum": 42606, + "triplet": 42607, + "decision": 42608, + "Ġcancels": 42609, + "ĠPMN": 42610, + "Ġporphy": 42611, + "ĠDSA": 42612, + "Ġsubmatrix": 42613, + "Ġjas": 42614, + "Ġreptiles": 42615, + "ĠSoon": 42616, + "ĠStatistically": 42617, + "Ġleveraged": 42618, + "Williams": 42619, + "FLD": 42620, + "folk": 42621, + "Ġbang": 42622, + "ĠSCL": 42623, + "asses": 42624, + "Ġtendons": 42625, + "founded": 42626, + "ĠRicketts": 42627, + "inset": 42628, + "Ġspun": 42629, + "Ġunramified": 42630, + "Ġrape": 42631, + "ĠZZ": 42632, + "ĠNebula": 42633, + "Ġthrombotic": 42634, + "ĠBoron": 42635, + "ĠArgon": 42636, + "pooling": 42637, + "ĠMarginal": 42638, + "Ġfellowship": 42639, + "Ġerythropoietin": 42640, + "mathpzc": 42641, + "xL": 42642, + "ĠSik": 42643, + "ĠBayer": 42644, + "Ġoverdose": 42645, + "ĠCOI": 42646, + "ĠLesions": 42647, + "ĠCompetitive": 42648, + "ĠODEs": 42649, + "wrap": 42650, + "achlor": 42651, + "Ġsubordinate": 42652, + "ĠYBa": 42653, + "headed": 42654, + "Ġgrasses": 42655, + "Ġbirational": 42656, + "ĠJeffrey": 42657, + "Ġmolding": 42658, + "Ġlidocaine": 42659, + "ĠFOXO": 42660, + "terminated": 42661, + "ĠâĩIJâĩĴ": 42662, + "ĠMEL": 42663, + "ticulum": 42664, + "Ġré": 42665, + "Ġclaud": 42666, + "Ġjamming": 42667, + "Static": 42668, + "Ġtributary": 42669, + "atet": 42670, + "edonia": 42671, + "ĠCMP": 42672, + "ĠVN": 42673, + "represents": 42674, + "SOURCE": 42675, + "uckland": 42676, + "ĠInterests": 42677, + "ĠNanoscale": 42678, + "oconjug": 42679, + "Ġcatalogues": 42680, + "ĠActinobacteria": 42681, + "Fixed": 42682, + "basal": 42683, + "Ġantiparallel": 42684, + "Ġconfusing": 42685, + "Ġmarkings": 42686, + "Ġdistinctions": 42687, + "ĠHua": 42688, + "ĠWatts": 42689, + "Ġnanofluid": 42690, + "Ġdiffractometer": 42691, + "Later": 42692, + "migration": 42693, + "Ġcoplanar": 42694, + "Ġhypomethyl": 42695, + "PDS": 42696, + "SOs": 42697, + "Correspond": 42698, + "Ġelucidating": 42699, + "IZED": 42700, + "EVs": 42701, + "gart": 42702, + "mTc": 42703, + "ĠTUR": 42704, + "uracies": 42705, + "Ġfollower": 42706, + "Ġhaze": 42707, + "OUTPUT": 42708, + "ĠMyeloid": 42709, + "BUFFER": 42710, + "Camp": 42711, + "anim": 42712, + "ĠTES": 42713, + "ĠCricket": 42714, + "ĠPaired": 42715, + "ĠPAGE": 42716, + "ĠBid": 42717, + "Ġyrs": 42718, + "Ġendow": 42719, + "ircase": 42720, + "ĠSupported": 42721, + "Ġleaflet": 42722, + "ĠPromoter": 42723, + "Ġconvinced": 42724, + "liers": 42725, + "hera": 42726, + "Ġseller": 42727, + "agreement": 42728, + "Ġunary": 42729, + "onstructed": 42730, + "Ġrestrained": 42731, + "ĠPetersen": 42732, + "Analog": 42733, + "Ġexacerbations": 42734, + "Ġperforated": 42735, + "tids": 42736, + "ĠMSH": 42737, + "oui": 42738, + "ĠCori": 42739, + "ĠCruc": 42740, + "Ġfracturing": 42741, + "Ġinfertile": 42742, + "ĠPROBLEM": 42743, + "ĠFriedmann": 42744, + "Ġspectrophotometry": 42745, + "ERGY": 42746, + "otus": 42747, + "proposed": 42748, + "ĠMoisture": 42749, + "ĠNoether": 42750, + "ĠLaunch": 42751, + "ĠLearn": 42752, + "Ġvena": 42753, + "Ġfasci": 42754, + "Ġquiescence": 42755, + "ĠPrand": 42756, + "ĠConvert": 42757, + "Ġtriage": 42758, + "ANE": 42759, + "Ġfeedstock": 42760, + "ĠdBm": 42761, + "Ġneoformans": 42762, + "GSE": 42763, + "ĠAPE": 42764, + "Ġcardiometabolic": 42765, + "Ġmagnetometer": 42766, + "Environment": 42767, + "Ġfulfills": 42768, + "ĠManganese": 42769, + "BMP": 42770, + "ĠRatios": 42771, + "istable": 42772, + "assume": 42773, + "Ġrespected": 42774, + "Ġscars": 42775, + "Ġsupporters": 42776, + "ĠAugmentation": 42777, + "Ġglycosylated": 42778, + "ĠUltrafast": 42779, + "Ġdemethylation": 42780, + "metastatic": 42781, + "cylinder": 42782, + "Ġhang": 42783, + "ĠMAV": 42784, + "disjoint": 42785, + "pharose": 42786, + "ĠLebanon": 42787, + "PIs": 42788, + "labeling": 42789, + "Ġneutralino": 42790, + "ĠSOCS": 42791, + "xcb": 42792, + "ĠTerritory": 42793, + "ĠPolicies": 42794, + "King": 42795, + "Ġallied": 42796, + "Ġsaturates": 42797, + "muscle": 42798, + "odimers": 42799, + "Ġbt": 42800, + "ĠHang": 42801, + "ĠEb": 42802, + "Ġchimer": 42803, + "Ġnotational": 42804, + "Ġcolder": 42805, + "ultz": 42806, + "transverse": 42807, + "HOUT": 42808, + "ĠKarls": 42809, + "torsion": 42810, + "JI": 42811, + "Ġmari": 42812, + "emon": 42813, + "Ġlogarithmically": 42814, + "ĠâIJ¦": 42815, + "ìĿĦ": 42816, + "Ġaeration": 42817, + "Ġsoma": 42818, + "ĠSomal": 42819, + "Ġspoil": 42820, + "diver": 42821, + "Ġbreakpoints": 42822, + "ĠHarmon": 42823, + "Ġpharmacologic": 42824, + "ĠMosquito": 42825, + "ĠModifications": 42826, + "Ġadjo": 42827, + "ĠPapers": 42828, + "generally": 42829, + "ïĺ¹": 42830, + "TARGET": 42831, + "ĠPrix": 42832, + "ocaps": 42833, + "ĠEin": 42834, + "Ġmicrogrid": 42835, + "ĠInterplay": 42836, + "Ġcopying": 42837, + "Alpha": 42838, + "ĠSlope": 42839, + "ĠLipofectamine": 42840, + "highest": 42841, + "DRO": 42842, + "ĠHipp": 42843, + "Ġshaken": 42844, + "Ġunderline": 42845, + "Ġfilmed": 42846, + "maturity": 42847, + "icture": 42848, + "ILS": 42849, + "Span": 42850, + "Ġinverters": 42851, + "QUE": 42852, + "determining": 42853, + "Ġeosinophilic": 42854, + "DY": 42855, + "ĠLID": 42856, + "ĠGig": 42857, + "Ġintraepithelial": 42858, + "NbO": 42859, + "freedom": 42860, + "Ġassured": 42861, + "ĠArche": 42862, + "ĠSubstitution": 42863, + "ĠSrivastava": 42864, + "ĠMozamb": 42865, + "Ġaro": 42866, + "orc": 42867, + "ĠIbrahim": 42868, + "ĠDST": 42869, + "Ġabl": 42870, + "Ġxer": 42871, + "ountable": 42872, + "Ġlossless": 42873, + "Ġconcentrating": 42874, + "Ġstains": 42875, + "ĠSolve": 42876, + "continuity": 42877, + "ĠTorr": 42878, + "Ġpitfalls": 42879, + "bestos": 42880, + "Otherwise": 42881, + "adhyay": 42882, + "bard": 42883, + "ĠCAA": 42884, + "odetic": 42885, + "Ġasthmatic": 42886, + "Ġrationality": 42887, + "ĠYorkshire": 42888, + "neighborhood": 42889, + "Ġheroin": 42890, + "Ġscatterers": 42891, + "ĠHearing": 42892, + "ĠEFT": 42893, + "ĠNurses": 42894, + "ĠGLI": 42895, + "ĠZeta": 42896, + "ĠNeigh": 42897, + "Ġventure": 42898, + "Ġtoxicological": 42899, + "Ġrolls": 42900, + "fv": 42901, + "Ġcrick": 42902, + "ĠdÏī": 42903, + "avia": 42904, + "elder": 42905, + "Ġinvade": 42906, + "extracted": 42907, + "MLP": 42908, + "ĠPAI": 42909, + "ĠMellitus": 42910, + "Ġbrucei": 42911, + "gpio": 42912, + "emotional": 42913, + "ĠDale": 42914, + "ĠEz": 42915, + "Ġtransactivation": 42916, + "Ġquantiles": 42917, + "Ġnucleosynthesis": 42918, + "ĠAmel": 42919, + "Ġchromophore": 42920, + "Ġliterally": 42921, + "bandwidth": 42922, + "atohepatitis": 42923, + "Ġultrafiltration": 42924, + "Martin": 42925, + "Ġangioplasty": 42926, + "insertion": 42927, + "Dan": 42928, + "squeeze": 42929, + "usr": 42930, + "uconazole": 42931, + "ĠFAR": 42932, + "Ġshadows": 42933, + "Ġimitation": 42934, + "ĠKann": 42935, + "hesi": 42936, + "Ġmicellar": 42937, + "vester": 42938, + "ĠPerse": 42939, + "acetamol": 42940, + "GRAPH": 42941, + "ĠAIPS": 42942, + "Ġpromptly": 42943, + "anchor": 42944, + "Ġischaemia": 42945, + "pump": 42946, + "Ġmafic": 42947, + "Ġlazy": 42948, + "ĠCEL": 42949, + "ĠGorenstein": 42950, + "ĠWGS": 42951, + "Ġsignifies": 42952, + "Ġsplines": 42953, + "determination": 42954, + "Ġrelaying": 42955, + "piperazine": 42956, + "Ġsyncytial": 42957, + "ĠAub": 42958, + "ĠDX": 42959, + "Ġorthotopic": 42960, + "ĠLinkage": 42961, + "Ġharmony": 42962, + "ĠKazakh": 42963, + "ĠVladimir": 42964, + "Ġpray": 42965, + "imolar": 42966, + "Ġgrayscale": 42967, + "Ġanalyst": 42968, + "ĠTransl": 42969, + "Ġmeniscus": 42970, + "ĠMedica": 42971, + "osaurus": 42972, + "Ġв": 42973, + "Ġinfiltrated": 42974, + "Ġâĸ³": 42975, + "Ġsaccades": 42976, + "Ġdisentangle": 42977, + "Hart": 42978, + "fined": 42979, + "Ġbicycle": 42980, + "ository": 42981, + "unlikely": 42982, + "erephthal": 42983, + "ĠLia": 42984, + "Ġgroupings": 42985, + "Ġcategorize": 42986, + "Ġbiogeography": 42987, + "ĠAPPROACH": 42988, + "ĠNing": 42989, + "ĠGrap": 42990, + "versa": 42991, + "Ġradiologists": 42992, + "ĠRecording": 42993, + "Ġboiler": 42994, + "adders": 42995, + "Candid": 42996, + "MQ": 42997, + "Ġbw": 42998, + "ĠSector": 42999, + "ĠHIT": 43000, + "ĠESCC": 43001, + "essence": 43002, + "orean": 43003, + "estyles": 43004, + "SUCCESS": 43005, + "nein": 43006, + "ultra": 43007, + "ramp": 43008, + "Thomas": 43009, + "ĠPrepar": 43010, + "ĠInstitut": 43011, + "Ġherbicide": 43012, + "ĠChaotic": 43013, + "Ġsphincter": 43014, + "Ġcompactifications": 43015, + "Clear": 43016, + "Trp": 43017, + "Decoder": 43018, + "Ġsapphire": 43019, + "ĠIdaho": 43020, + "persing": 43021, + "chiral": 43022, + "ĠDischarge": 43023, + "Accordingly": 43024, + "ĠArthritis": 43025, + "ĠJaneiro": 43026, + "nj": 43027, + "ĠKd": 43028, + "Ġoutlets": 43029, + "Ġsusceptibilities": 43030, + "Ġdiverged": 43031, + "Ġroller": 43032, + "sufficient": 43033, + "clustering": 43034, + "ĠTehran": 43035, + "Ġtb": 43036, + "blank": 43037, + "Ġdigitally": 43038, + "Ġnecrotizing": 43039, + "FALSE": 43040, + "Ġwhor": 43041, + "errals": 43042, + "ĠMotivated": 43043, + "enzae": 43044, + "ĠRefinement": 43045, + "Ġticket": 43046, + "Ġprotrusions": 43047, + "ĠDonaldson": 43048, + "ĠBeth": 43049, + "Ġsputtered": 43050, + "Ġautocrine": 43051, + "copene": 43052, + "Ġcollar": 43053, + "Ġuppermost": 43054, + "Ġoxygenated": 43055, + "Intro": 43056, + "âĨIJ": 43057, + "ĠHippo": 43058, + "Ġdune": 43059, + "idines": 43060, + "ĠHä": 43061, + "Ġregi": 43062, + "Ġnois": 43063, + "Ġphotodiode": 43064, + "ĠFeb": 43065, + "mutated": 43066, + "ĠCFL": 43067, + "stepping": 43068, + "Selection": 43069, + "ĠWebster": 43070, + "ĠHERA": 43071, + "indicating": 43072, + "Ġtrainees": 43073, + "Rot": 43074, + "ĠFAK": 43075, + "ĠAsn": 43076, + "Ġfats": 43077, + "foliation": 43078, + "Ġarticulation": 43079, + "Ġcusps": 43080, + "ĠJennifer": 43081, + "Ġintimately": 43082, + "ĠPing": 43083, + "sov": 43084, + "oxious": 43085, + "hydrate": 43086, + "ĠArchives": 43087, + "Gonz": 43088, + "Ġé": 43089, + "Ġchl": 43090, + "ĠOLS": 43091, + "coph": 43092, + "Ġairline": 43093, + "Ġfoetal": 43094, + "ĠRolling": 43095, + "ĠGENERAL": 43096, + "ONAL": 43097, + "agons": 43098, + "ĠDorsal": 43099, + "Ġritual": 43100, + "butyrate": 43101, + "oglut": 43102, + "Ġhexa": 43103, + "ĠSyria": 43104, + "Ġontogeny": 43105, + "ĠFBG": 43106, + "coverage": 43107, + "Ġtachyon": 43108, + "ĠPermanent": 43109, + "lum": 43110, + "Ġsv": 43111, + "Ġoo": 43112, + "energetic": 43113, + "altitude": 43114, + "Inc": 43115, + "ĠNebraska": 43116, + "ĠRESP": 43117, + "Ġdysbiosis": 43118, + "Ġmarketed": 43119, + "oxicillin": 43120, + "ĠBroadcast": 43121, + "racyclo": 43122, + "ĠFifteen": 43123, + "ĠNarayan": 43124, + "Ġlettuce": 43125, + "orea": 43126, + "Ġintercepts": 43127, + "Ġworkstation": 43128, + "ĠPlains": 43129, + "CCL": 43130, + "Ġorientable": 43131, + "ĠBoosting": 43132, + "ĠSOI": 43133, + "ĠChecking": 43134, + "ĠFIFO": 43135, + "Ġinsets": 43136, + "ĠSRT": 43137, + "Ġacrom": 43138, + "owner": 43139, + "MIX": 43140, + "ĠArb": 43141, + "Ġfaeces": 43142, + "ĠCarlson": 43143, + "Ġperivascular": 43144, + "infiltrating": 43145, + "Ìħ": 43146, + "Ġmalle": 43147, + "ocate": 43148, + "ĠBold": 43149, + "unctive": 43150, + "excess": 43151, + "Ġloosen": 43152, + "Ġprioritization": 43153, + "Ġannotate": 43154, + "Ġgrammars": 43155, + "Ġbred": 43156, + "Ġexocytosis": 43157, + "ĠDahl": 43158, + "athyroidism": 43159, + "veli": 43160, + "Ġopted": 43161, + "Ġsmoked": 43162, + "ĠPlates": 43163, + "EMG": 43164, + "ROW": 43165, + "IFIC": 43166, + "OLS": 43167, + "oregulatory": 43168, + "Ġwhiskers": 43169, + "secretase": 43170, + "Ġexaggerated": 43171, + "ĠBib": 43172, + "deformed": 43173, + "Ġzur": 43174, + "ropine": 43175, + "Ġpairings": 43176, + "chromosome": 43177, + "Elements": 43178, + "priority": 43179, + "Ġlyophilized": 43180, + "ĠChaudh": 43181, + "Wilk": 43182, + "ĠCation": 43183, + "otta": 43184, + "Ġnonconvex": 43185, + "Ġdepolymer": 43186, + "MMARY": 43187, + "Controlled": 43188, + "carboxy": 43189, + "Ġaugmenting": 43190, + "Ġappointments": 43191, + "Ġtraversed": 43192, + "ĠFletcher": 43193, + "Ġexpiratory": 43194, + "Ġelephant": 43195, + "ĠBlocks": 43196, + "ĠFluids": 43197, + "walls": 43198, + "increased": 43199, + "propanamide": 43200, + "ĠAkaike": 43201, + "ĠCBM": 43202, + "ĠEcho": 43203, + "admissible": 43204, + "Ġdisassembly": 43205, + "ĠarXiv": 43206, + "icke": 43207, + "LIST": 43208, + "phenotype": 43209, + "ĠProvincial": 43210, + "legend": 43211, + "PAS": 43212, + "rnn": 43213, + "sand": 43214, + "Ġbariatric": 43215, + "ĠPush": 43216, + "ĠApoE": 43217, + "caprolactone": 43218, + "modeling": 43219, + "Ġŵ": 43220, + "Ġsupercapacitors": 43221, + "oron": 43222, + "ĠpK": 43223, + "strophy": 43224, + "ĠSuc": 43225, + "unda": 43226, + "team": 43227, + "Ġitiner": 43228, + "Ġswell": 43229, + "ĠBioactive": 43230, + "ĠIndicators": 43231, + "ĠIFT": 43232, + "ĠDK": 43233, + "Ġcapit": 43234, + "shapes": 43235, + "Ġtrachea": 43236, + "delayed": 43237, + "ĠGuangdong": 43238, + "Lepid": 43239, + "TGA": 43240, + "hk": 43241, + "olon": 43242, + "ogenin": 43243, + "ĠAck": 43244, + "Ġlogically": 43245, + "contributions": 43246, + "ĠCleavage": 43247, + "hurst": 43248, + "bdd": 43249, + "STD": 43250, + "ĠFut": 43251, + "tek": 43252, + "ĠInher": 43253, + "Ġchemis": 43254, + "Ġbreakpoint": 43255, + "estimates": 43256, + "ĠOttoman": 43257, + "ĠNafion": 43258, + "WIDTH": 43259, + "Ġsizable": 43260, + "ĠTsu": 43261, + "embolic": 43262, + "Ġrightmost": 43263, + "ĠCellulose": 43264, + "ictionaries": 43265, + "ĠMycoplasma": 43266, + "ĠBurgers": 43267, + "ĠKeplerian": 43268, + "UCTION": 43269, + "VB": 43270, + "Ġbcc": 43271, + "raid": 43272, + "ENDIX": 43273, + "Ġscoping": 43274, + "ĠPRI": 43275, + "ĠCdSe": 43276, + "ĠGreedy": 43277, + "ĠHammer": 43278, + "ĠBacteroides": 43279, + "informative": 43280, + "Ġresembled": 43281, + "yllium": 43282, + "Twenty": 43283, + "Ġpounds": 43284, + "Ġunpolarized": 43285, + "Ġconfigure": 43286, + "Ġtranscriptionally": 43287, + "Ġmicroscale": 43288, + "ĠPutting": 43289, + "Ġpyrrol": 43290, + "ĠLASSO": 43291, + "filtration": 43292, + "Ġtech": 43293, + "performing": 43294, + "Along": 43295, + "ĠCTLA": 43296, + "Ġauthorization": 43297, + "URAL": 43298, + "Ġleaky": 43299, + "Optical": 43300, + "ĠReveal": 43301, + "ĠHUVECs": 43302, + "Wu": 43303, + "custom": 43304, + "dible": 43305, + "Ġ": 43306, + "CDCl": 43307, + "Ġemphys": 43308, + "Neut": 43309, + "collagen": 43310, + "necessarily": 43311, + "ĠRoots": 43312, + "Pose": 43313, + "Tu": 43314, + "Ġclue": 43315, + "Ġperturbing": 43316, + "ĠHelium": 43317, + "ĠCombustion": 43318, + "nitrogen": 43319, + "amplified": 43320, + "prove": 43321, + "ĠSoils": 43322, + "normalization": 43323, + "ĠCHOP": 43324, + "ĠMcLe": 43325, + "Ġstrikes": 43326, + "Ġcropped": 43327, + "ĠKuo": 43328, + "Ġvagal": 43329, + "Ġdinucleotide": 43330, + "ĠIsaac": 43331, + "ĠLOX": 43332, + "Ġdirectionality": 43333, + "Ġchemoradiotherapy": 43334, + "calculus": 43335, + "ĠMohammed": 43336, + "mapped": 43337, + "Ġreforms": 43338, + "Ġreordering": 43339, + "ĠBm": 43340, + "ĠESCs": 43341, + "ĠNUC": 43342, + "thaw": 43343, + "Ġnanoporous": 43344, + "Ġtrainable": 43345, + "ĠATT": 43346, + "feats": 43347, + "OFDM": 43348, + "ĠSHP": 43349, + "ĠRichter": 43350, + "Ġsprayed": 43351, + "ĠJefferson": 43352, + "FOX": 43353, + "bh": 43354, + "otte": 43355, + "Ġleiomy": 43356, + "ospores": 43357, + "specificity": 43358, + "ĠRefer": 43359, + "ĠHaas": 43360, + "Move": 43361, + "Materials": 43362, + "tec": 43363, + "utility": 43364, + "entional": 43365, + "ĠMPP": 43366, + "chond": 43367, + "Ġseepage": 43368, + "Ġpeach": 43369, + "ĠÎĶt": 43370, + "embryonic": 43371, + "Yan": 43372, + "Ġliposomal": 43373, + "ĠValencia": 43374, + "ĠEndo": 43375, + "ĠPAO": 43376, + "Ġdialect": 43377, + "Ġchondrocyte": 43378, + "ĠMillimeter": 43379, + "ĠRegularity": 43380, + "destroy": 43381, + "ĠCondensation": 43382, + "Bayes": 43383, + "abundance": 43384, + "ĠdU": 43385, + "ĠSSI": 43386, + "ĠHAND": 43387, + "Ġconsulted": 43388, + "Ġsuppliers": 43389, + "Ġdemo": 43390, + "registered": 43391, + "Ġmicrosomal": 43392, + "Ġlambs": 43393, + "responsiveness": 43394, + "Dy": 43395, + "GAS": 43396, + "UME": 43397, + "Ġaero": 43398, + "Ġcalmodulin": 43399, + "Ġcalcined": 43400, + "Ġinsula": 43401, + "ĠMei": 43402, + "ĠREAL": 43403, + "Ġcontractible": 43404, + "ĠEssentially": 43405, + "Ġgaming": 43406, + "Ġspillover": 43407, + "residues": 43408, + "âİ": 43409, + "ĠEMC": 43410, + "ĠSDE": 43411, + "ĠSerine": 43412, + "ecki": 43413, + "ĠPrinceton": 43414, + "ĠBACKGROUND": 43415, + "masks": 43416, + "ĠLom": 43417, + "ffield": 43418, + "efitinib": 43419, + "Ġpatents": 43420, + "ĠBez": 43421, + "loads": 43422, + "Ġgonadal": 43423, + "Ġnitrocellulose": 43424, + "âĻĤ": 43425, + "Ġthrown": 43426, + "Ġrectification": 43427, + "mina": 43428, + "iscid": 43429, + "ĠBiobank": 43430, + "paramagnetic": 43431, + "GSK": 43432, + "ĠDerivative": 43433, + "criterion": 43434, + "ĠMonthly": 43435, + "ë¥": 43436, + "ĠSichuan": 43437, + "Ġimmunologic": 43438, + "Ġheterotic": 43439, + "ĠMcCl": 43440, + "ĠSMART": 43441, + "ĠBatteries": 43442, + "Ġpremiered": 43443, + "Ġcryopreservation": 43444, + "Nu": 43445, + "valho": 43446, + "Ġflotation": 43447, + "topological": 43448, + "ĠNanjing": 43449, + "Ġjuxt": 43450, + "ĠFeder": 43451, + "Ġprofoundly": 43452, + "cad": 43453, + "ienced": 43454, + "chuk": 43455, + "ĠIng": 43456, + "ĠKSHV": 43457, + "aminobenz": 43458, + "ĉĉĉĠĠĠ": 43459, + "Ġmetaph": 43460, + "ĠEpidemic": 43461, + "ĠAssociate": 43462, + "Ġsaccade": 43463, + "Ġdawn": 43464, + "Ġreheating": 43465, + "Ġspell": 43466, + "fractive": 43467, + "ĠToolkit": 43468, + "Ġrecognise": 43469, + "pathogen": 43470, + "Ġophthalmic": 43471, + "Ġqueried": 43472, + "thens": 43473, + "ithine": 43474, + "umably": 43475, + "Ġstrides": 43476, + "haul": 43477, + "Ġpassion": 43478, + "Ġdysfunctions": 43479, + "Byte": 43480, + "Ġcaesarean": 43481, + "prey": 43482, + "ĠHorse": 43483, + "ĠGABAA": 43484, + "Natural": 43485, + "kos": 43486, + "inators": 43487, + "odings": 43488, + "ARRAY": 43489, + "Ġunipotent": 43490, + "Ġelectromy": 43491, + "compart": 43492, + "Liu": 43493, + "encephalic": 43494, + "ĠCOMPAR": 43495, + "Ġsymbionts": 43496, + "ivacaine": 43497, + "OI": 43498, + "PVA": 43499, + "ĠNVIDIA": 43500, + "calibrated": 43501, + "Ġquest": 43502, + "NAD": 43503, + "ĠXyl": 43504, + "Ġpharmacist": 43505, + "directly": 43506, + "Ġquadruple": 43507, + "ethanone": 43508, + "ĠBulgaria": 43509, + "Ġoviposition": 43510, + "runs": 43511, + "Ġnociceptive": 43512, + "Ġasexual": 43513, + "SULT": 43514, + "Ġwouldn": 43515, + "ĠIndustries": 43516, + "abilizing": 43517, + "ĠCompressive": 43518, + "COOH": 43519, + "USH": 43520, + "kiewicz": 43521, + "Ġigneous": 43522, + "Ġdisappoint": 43523, + "ĠCKM": 43524, + "ĠDiagrams": 43525, + "ĠFlam": 43526, + "ĠGould": 43527, + "Ġcoenzyme": 43528, + "Ġparan": 43529, + "Ġ¶": 43530, + "Ġprogrammer": 43531, + "ĠTransforming": 43532, + "Ġmuscarinic": 43533, + "onucleotide": 43534, + "FIELD": 43535, + "ĠFuji": 43536, + "Ġnondec": 43537, + "Ġblanket": 43538, + "Ġpredisposing": 43539, + "ĠTrigger": 43540, + "Ġwelcome": 43541, + "Family": 43542, + "UINT": 43543, + "hfill": 43544, + "tvb": 43545, + "ĠBatt": 43546, + "Ġunmet": 43547, + "ĠApo": 43548, + "otient": 43549, + "Ġfundus": 43550, + "ĠLearned": 43551, + "Ġintrusions": 43552, + "Ġsolubilization": 43553, + "fundamental": 43554, + "ĠSantiago": 43555, + "Ġhpi": 43556, + "throw": 43557, + "ĠInto": 43558, + "timeout": 43559, + "Ġthickened": 43560, + "iasm": 43561, + "Ġgravitino": 43562, + "branched": 43563, + "VIII": 43564, + "Ġoch": 43565, + "Ġgym": 43566, + "ĠKrylov": 43567, + "Ġcorrective": 43568, + "ĠInstitution": 43569, + "Ġcrimes": 43570, + "ĠBacteroidetes": 43571, + "ĠEhr": 43572, + "Ġseated": 43573, + "rolizumab": 43574, + "Ġfactorized": 43575, + "rotational": 43576, + "Ġadministrators": 43577, + "âĭĨ": 43578, + "ineralization": 43579, + "lining": 43580, + "âĹ": 43581, + "urai": 43582, + "ĠFAP": 43583, + "ĠFisheries": 43584, + "ĠESO": 43585, + "temper": 43586, + "Biggr": 43587, + "ĠAlternating": 43588, + "twin": 43589, + "amatsu": 43590, + "Ġintrad": 43591, + "overflow": 43592, + "Ġcomparability": 43593, + "Ġsynoptic": 43594, + "USB": 43595, + "dbg": 43596, + "demonstr": 43597, + "ĠAchieving": 43598, + "Ġtectonics": 43599, + "ĠRandall": 43600, + "ĠPrepared": 43601, + "Ġsublimation": 43602, + "ĠBaj": 43603, + "Ġclutch": 43604, + "Ġsubdomain": 43605, + "Ġflaws": 43606, + "influ": 43607, + "Ġwidening": 43608, + "Ġmelted": 43609, + "Ġadministrator": 43610, + "Ġsubsidiary": 43611, + "ĠPricing": 43612, + "ticus": 43613, + "ogi": 43614, + "ĠAlign": 43615, + "ĠADV": 43616, + "Ġvastly": 43617, + "benchmark": 43618, + "Ġprioritize": 43619, + "Radi": 43620, + "essed": 43621, + "Ġsuprac": 43622, + "accard": 43623, + "Ġbiomimetic": 43624, + "ĠIrradiation": 43625, + "ĠALGOR": 43626, + "Ġpedigree": 43627, + "ĠCMT": 43628, + "odym": 43629, + "ĠVig": 43630, + "ĠBiochemistry": 43631, + "ĠAccum": 43632, + "Indices": 43633, + "hardtii": 43634, + "ĠRalph": 43635, + "Ġruminants": 43636, + "iT": 43637, + "onau": 43638, + "aner": 43639, + "planned": 43640, + "evers": 43641, + "Ġretroviral": 43642, + "Ġquantifier": 43643, + "ĠExtracting": 43644, + "Ġacetylated": 43645, + "Orth": 43646, + "ĠSenator": 43647, + "Ġnanosecond": 43648, + "Ġanticipation": 43649, + "ĠECMO": 43650, + "Ġsemicirc": 43651, + "ĠCryptosporidium": 43652, + "ĠTARGET": 43653, + "Ġapples": 43654, + "efield": 43655, + "Ġreman": 43656, + "Ġserovar": 43657, + "ĠTransactions": 43658, + "transitions": 43659, + "ursions": 43660, + "ĠMelatonin": 43661, + "Ġcholecystectomy": 43662, + "ĠAntiviral": 43663, + "hous": 43664, + "Ġotol": 43665, + "Ġmaj": 43666, + "Ġeclip": 43667, + "arel": 43668, + "ATIONAL": 43669, + "MIM": 43670, + "ĠCImg": 43671, + "ĠEndomet": 43672, + "ĠHayashi": 43673, + "Ġchimpanzees": 43674, + "mbf": 43675, + "ĠIPV": 43676, + "actoring": 43677, + "outside": 43678, + "neapolis": 43679, + "Ġdiscarding": 43680, + "numtype": 43681, + "ĠREST": 43682, + "Ġflagellar": 43683, + "ĠChandrase": 43684, + "hofer": 43685, + "Ġelectrocardiogram": 43686, + "Gb": 43687, + "mock": 43688, + "oeb": 43689, + "ĠSMO": 43690, + "ĠMord": 43691, + "ĠBoz": 43692, + "Ġminors": 43693, + "INLINE": 43694, + "Ġthermogravimetric": 43695, + "ĠMelting": 43696, + "ĠNSW": 43697, + "Sham": 43698, + "lotinib": 43699, + "Ġacquisitions": 43700, + "taz": 43701, + "Ġdefaults": 43702, + "Ġoscillates": 43703, + "ĠCaption": 43704, + "Ġdisruptive": 43705, + "Ġsweeping": 43706, + "ĠToolbox": 43707, + "Ġurethral": 43708, + "HBV": 43709, + "ĠRCS": 43710, + "Ġoxys": 43711, + "immuno": 43712, + "htm": 43713, + "oflavin": 43714, + "HIF": 43715, + "ĠSBA": 43716, + "ĠCPE": 43717, + "Ġwhites": 43718, + "ĠReactor": 43719, + "Ġpurp": 43720, + "Ġelectrocatalytic": 43721, + "Ġnonex": 43722, + "Ġtyphimurium": 43723, + "Ġeurop": 43724, + "concave": 43725, + "macrophage": 43726, + "SER": 43727, + "Ġlapse": 43728, + "Ġanatom": 43729, + "ĠRAC": 43730, + "tax": 43731, + "Ġmins": 43732, + "Ġsensu": 43733, + "ĠHebrew": 43734, + "Ġrealism": 43735, + "ĠMicroglia": 43736, + "Ġserialized": 43737, + "ĠHazard": 43738, + "Ġmetamorphosis": 43739, + "ĠIRA": 43740, + "Ġsmearing": 43741, + "Ġphotolysis": 43742, + "Ġchildbirth": 43743, + "Ġsilenced": 43744, + "rawal": 43745, + "Ġquadrants": 43746, + "butanol": 43747, + "Ġstochastically": 43748, + "ĠChambers": 43749, + "ĠNavarro": 43750, + "Ġprocurement": 43751, + "cite": 43752, + "ĠSle": 43753, + "ĠHadoop": 43754, + "Ġdelaying": 43755, + "Atlantic": 43756, + "Spain": 43757, + "falfa": 43758, + "odialysis": 43759, + "ynia": 43760, + "Ġplateaus": 43761, + "Ġmultimode": 43762, + "RESET": 43763, + "ĠRocky": 43764, + "ĠRodrigues": 43765, + "fMRI": 43766, + "rint": 43767, + "ĠTAL": 43768, + "Ġspecular": 43769, + "construction": 43770, + "ĠAthens": 43771, + "Ġcrosslink": 43772, + "Ġcountably": 43773, + "Ġspreadsheet": 43774, + "cribes": 43775, + "consistently": 43776, + "Ġfloodplain": 43777, + "EINVAL": 43778, + "Maca": 43779, + "Ġei": 43780, + "Ġhitherto": 43781, + "Ġsemif": 43782, + "Ġcontinual": 43783, + "ĠHomology": 43784, + "Ġphotocatalysts": 43785, + "isable": 43786, + "ĠHAT": 43787, + "Ġpolyhedra": 43788, + "ĠMayo": 43789, + "Ġlactating": 43790, + "sampler": 43791, + "Ġappliances": 43792, + "TU": 43793, + "Ġchess": 43794, + "ĠTing": 43795, + "Ġinvitation": 43796, + "Ġdistributing": 43797, + "ashima": 43798, + "Ġultral": 43799, + "trend": 43800, + "Ġrelaxations": 43801, + "ĠHelen": 43802, + "Ġbedding": 43803, + "Ġglandular": 43804, + "Ġincrementally": 43805, + "Ġconceal": 43806, + "claimed": 43807, + "ĠEddy": 43808, + "Ġmos": 43809, + "ĠTube": 43810, + "ĠToda": 43811, + "raj": 43812, + "ĠMü": 43813, + "ĠUll": 43814, + "Ġune": 43815, + "berine": 43816, + "Ġpolicym": 43817, + "Ġscholarly": 43818, + "Ġshoreline": 43819, + "Ġaldosterone": 43820, + "ĠBrucella": 43821, + "THE": 43822, + "REAL": 43823, + "Ġexome": 43824, + "ĠDAB": 43825, + "Ġextras": 43826, + "Ġbanding": 43827, + "ĠSiemens": 43828, + "ĠBoost": 43829, + "ĠSupernovae": 43830, + "ĠTracing": 43831, + "Ġascorbate": 43832, + "Italy": 43833, + "bund": 43834, + "Ġdecrement": 43835, + "Ġneurophysiological": 43836, + "Ġblackbody": 43837, + "ĠMcN": 43838, + "Ġcompetencies": 43839, + "oscape": 43840, + "ĠHonours": 43841, + "Ġmastitis": 43842, + "criteria": 43843, + "Ġbiaxial": 43844, + "Ġthawed": 43845, + "ĠFoll": 43846, + "oreceptor": 43847, + "Ġinvention": 43848, + "ADs": 43849, + "Show": 43850, + "------------------------------------------------": 43851, + "Ġellipsoidal": 43852, + "Ġfocussed": 43853, + "ĠDat": 43854, + "ĠRim": 43855, + "ĠLX": 43856, + "ĠGER": 43857, + "insler": 43858, + "Ġtopoisomerase": 43859, + "Ġhyperlipidemia": 43860, + "Ġmystery": 43861, + "Ġnitrification": 43862, + "Ġoncogenes": 43863, + "ĠFuller": 43864, + "ĠBartlett": 43865, + "Ġamphibians": 43866, + "SST": 43867, + "bly": 43868, + "leads": 43869, + "ecycle": 43870, + "ampl": 43871, + "ĠPOM": 43872, + "ĠDCF": 43873, + "strass": 43874, + "antibody": 43875, + "nonlinear": 43876, + "ĠBroadway": 43877, + "ĠCatalogue": 43878, + "ĠμA": 43879, + "Ġacetaminophen": 43880, + "Ġcrystallites": 43881, + "ĠNanotubes": 43882, + "ĠAcknowledgment": 43883, + "Ġmetamorphism": 43884, + "Ġtwinning": 43885, + "ĠAzerbai": 43886, + "xA": 43887, + "CCC": 43888, + "ĠSolids": 43889, + "preds": 43890, + "ĠMontana": 43891, + "WRITE": 43892, + "Ratio": 43893, + "Ġpunch": 43894, + "Ġriding": 43895, + "Ġacne": 43896, + "ĠUre": 43897, + "Ġcorr": 43898, + "ĠQOL": 43899, + "Ġinsult": 43900, + "Ġdominantly": 43901, + "Ġsubsamples": 43902, + "rews": 43903, + "ĠPreservation": 43904, + "ĠAffine": 43905, + "methanone": 43906, + "Ġhedgehog": 43907, + "JH": 43908, + "Ġlined": 43909, + "Ġsten": 43910, + "ĠDarmstadt": 43911, + "ĠLasso": 43912, + "Ġdeproton": 43913, + "Ġshoes": 43914, + "Ġmotives": 43915, + "Ġmicroscop": 43916, + "ophthora": 43917, + "Ġmacron": 43918, + "Ġencouragement": 43919, + "acrylic": 43920, + "ĠTensorFlow": 43921, + "Wrapper": 43922, + "oise": 43923, + "ayak": 43924, + "Ġrepresses": 43925, + "Ġpruned": 43926, + "ĠClar": 43927, + "ĠâĬ²": 43928, + "ĠUnderlying": 43929, + "Implemented": 43930, + "Ġsweat": 43931, + "Ġmeteorites": 43932, + "Ġtweez": 43933, + "Ġprosocial": 43934, + "Ġabrasion": 43935, + "hail": 43936, + "Ġshorth": 43937, + "ismatch": 43938, + "INTR": 43939, + "ĠTrin": 43940, + "Ġphysicists": 43941, + "ĠPEO": 43942, + "ĠMagneto": 43943, + "ĠJacobson": 43944, + "ĠMMPs": 43945, + "ĠIntravenous": 43946, + "Ġneurotransmission": 43947, + "ĠPneumonia": 43948, + "Lind": 43949, + "yre": 43950, + "Ġmaternity": 43951, + "ĠIris": 43952, + "riatal": 43953, + "ĠâĢļ": 43954, + "medetomidine": 43955, + "Ġtriterpen": 43956, + "ĠManuscript": 43957, + "ĠEndoplasmic": 43958, + "ĠPotter": 43959, + "Ġgerminal": 43960, + "Ġphotosystem": 43961, + "Guided": 43962, + "Ġguitarist": 43963, + "ĠChilean": 43964, + "ĠSalvador": 43965, + "ÉĻ": 43966, + "Ġcelestial": 43967, + "omand": 43968, + "Ġnk": 43969, + "Ġvendors": 43970, + "ĠPINK": 43971, + "ĠInorganic": 43972, + "Ġmoderated": 43973, + "SUS": 43974, + "ĠJoshi": 43975, + "ĠStata": 43976, + "ikes": 43977, + "oye": 43978, + "ĠJohnny": 43979, + "Leica": 43980, + "Ġkaon": 43981, + "ĠEquipment": 43982, + "Kim": 43983, + "gado": 43984, + "tures": 43985, + "Ġelem": 43986, + "ĠAAC": 43987, + "cea": 43988, + "odality": 43989, + "Ġaniline": 43990, + "Ġexothermic": 43991, + "ĠGunn": 43992, + "ĠJU": 43993, + "plicable": 43994, + "scapes": 43995, + "typed": 43996, + "Ġinspiratory": 43997, + "REGIST": 43998, + "ĠBryan": 43999, + "Ġanxious": 44000, + "ĠCarpenter": 44001, + "ĠPharmacokinetics": 44002, + "inferior": 44003, + "Frag": 44004, + "ZY": 44005, + "Ġoesophageal": 44006, + "ĠSuk": 44007, + "ĠPron": 44008, + "ĠCDI": 44009, + "AGC": 44010, + "keywords": 44011, + "susceptible": 44012, + "Germany": 44013, + "MAS": 44014, + "iC": 44015, + "anmar": 44016, + "Ġexiting": 44017, + "ĠHale": 44018, + "Ġrhamn": 44019, + "industrial": 44020, + "Ġraft": 44021, + "embrolizumab": 44022, + "Ġdeploying": 44023, + "Ġsalicylic": 44024, + "Rn": 44025, + "Ġcensor": 44026, + "ĠdX": 44027, + "Ġforum": 44028, + "MSI": 44029, + "blad": 44030, + "Ġsquir": 44031, + "CPP": 44032, + "Ġgrapevine": 44033, + "ĠRAFT": 44034, + "Monte": 44035, + "Ġmicroflora": 44036, + "rcl": 44037, + "Ġdecap": 44038, + "ANC": 44039, + "Ġbroaden": 44040, + "Ġfreed": 44041, + "Ġsouthward": 44042, + "ĠJacques": 44043, + "Ġrequesting": 44044, + "ĠAspect": 44045, + "arajan": 44046, + "Failed": 44047, + "fprintf": 44048, + "pytest": 44049, + "ʹ": 44050, + "ĠCm": 44051, + "until": 44052, + "neiss": 44053, + "Ġmonos": 44054, + "ospinal": 44055, + "olsky": 44056, + "contrib": 44057, + "Container": 44058, + "ĠVolunte": 44059, + "ĠAttributes": 44060, + "ĠTumour": 44061, + "Ġreinhardtii": 44062, + "Ġcentromere": 44063, + "ĠSymph": 44064, + "ĠAo": 44065, + "agens": 44066, + "pleted": 44067, + "ieder": 44068, + "Ġactivist": 44069, + "ĠAlmeida": 44070, + "Ġdisturbing": 44071, + "Ġreflexes": 44072, + "DSS": 44073, + "Ġforwards": 44074, + "ronym": 44075, + "ĠIntegrity": 44076, + "WEEN": 44077, + "Ġôı¼Į": 44078, + "Ġfaithfully": 44079, + "Ġpericardial": 44080, + "Japanese": 44081, + "ĠCENP": 44082, + "Kr": 44083, + "Ġdefending": 44084, + "Ġzon": 44085, + "insensitive": 44086, + "Ġlabs": 44087, + "ĠCaM": 44088, + "ĠEurop": 44089, + "MEA": 44090, + "BLAST": 44091, + "xN": 44092, + "alen": 44093, + "Ġclk": 44094, + "lineage": 44095, + "coating": 44096, + "Ġtailoring": 44097, + "CONTR": 44098, + "Ġadrenergic": 44099, + "interpreted": 44100, + "NIH": 44101, + "amoeba": 44102, + "ĠCyr": 44103, + "Ġtriplicates": 44104, + "defining": 44105, + "ĠLogan": 44106, + "tesy": 44107, + "ĠTwist": 44108, + "ĠGrammar": 44109, + "ĠSustained": 44110, + "Ġanharmonic": 44111, + "Ġalve": 44112, + "Ġruler": 44113, + "Ġquanta": 44114, + "Ġdirects": 44115, + "Ġoffloading": 44116, + "ĠGeophysical": 44117, + "Require": 44118, + "Ġhepatoma": 44119, + "Ġfoo": 44120, + "ĠGeorges": 44121, + "Ġbouts": 44122, + "ĠTAK": 44123, + "Ġantidiabetic": 44124, + "ĠReported": 44125, + "presenting": 44126, + "ĠLayered": 44127, + "RENCE": 44128, + "Ġuveitis": 44129, + "bage": 44130, + "Ġfentanyl": 44131, + "ensemble": 44132, + "ĠOSCC": 44133, + "Ġminers": 44134, + "looking": 44135, + "ĠBeer": 44136, + "precipitation": 44137, + "ĠEnterprise": 44138, + "Ġserotonergic": 44139, + "Ġseesaw": 44140, + "ĠAthletics": 44141, + "Ġhydrolytic": 44142, + "Ġtalent": 44143, + "Ġdiscernible": 44144, + "FIL": 44145, + "lives": 44146, + "ĠSales": 44147, + "ĠSSc": 44148, + "erend": 44149, + "clim": 44150, + "antid": 44151, + "INTS": 44152, + "Ġattenuating": 44153, + "Ġtwists": 44154, + "Ġoxygenase": 44155, + "rini": 44156, + "Macaulay": 44157, + "zm": 44158, + "ĠPOT": 44159, + "ĠMp": 44160, + "ĠHey": 44161, + "ĠOVER": 44162, + "illion": 44163, + "Ġinvaluable": 44164, + "Ġantiplatelet": 44165, + "Ġmutans": 44166, + "Ġgraduates": 44167, + "GRAM": 44168, + "ispheric": 44169, + "Ġincompatibility": 44170, + "Ġcarboxylase": 44171, + "Ġbiocontrol": 44172, + "ĠPhysicochemical": 44173, + "ïĻ": 44174, + "Ġlae": 44175, + "ĠAortic": 44176, + "ĠRacing": 44177, + "ĠECD": 44178, + "ivic": 44179, + "Ġelectromechanical": 44180, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 44181, + "Ġsteer": 44182, + "ĠOutside": 44183, + "Ġadenocarcinomas": 44184, + "ĠKeep": 44185, + "Ġcocon": 44186, + "Ġmoderating": 44187, + "Ġreformulated": 44188, + "Ġfundamentals": 44189, + "ĠTesla": 44190, + "ĠStirling": 44191, + "orated": 44192, + "opid": 44193, + "Ġparox": 44194, + "Ġtrivalent": 44195, + "Ġexchangeable": 44196, + "Ġdebuted": 44197, + "Very": 44198, + "reements": 44199, + "ĠTomm": 44200, + "ĠCyn": 44201, + "ĠCatalysts": 44202, + "quat": 44203, + "ĠFER": 44204, + "ĠRum": 44205, + "Ġscanners": 44206, + "ĠâĨĴâĪŀ": 44207, + "otropical": 44208, + "Ġvenues": 44209, + "estimator": 44210, + "Ġemptying": 44211, + "GPP": 44212, + "VIR": 44213, + "Ġcomplicates": 44214, + "ĠNIS": 44215, + "ĠZhen": 44216, + "ĠBlues": 44217, + "Ġtextbooks": 44218, + "Ġsixty": 44219, + "Ġethers": 44220, + "Ġfinancially": 44221, + "ĠmHealth": 44222, + "ĠTut": 44223, + "Ġlaryng": 44224, + "ĠGs": 44225, + "ĠWatch": 44226, + "Ġsev": 44227, + "Ġital": 44228, + "assed": 44229, + "Ġ÷": 44230, + "ĠConsent": 44231, + "Ġnuts": 44232, + "vitreal": 44233, + "Ġmetaphase": 44234, + "Ġtitania": 44235, + "Ġfoils": 44236, + "Ġgalectin": 44237, + "initialize": 44238, + "Ġadvisor": 44239, + "Ġadministering": 44240, + "Bool": 44241, + "Ġcem": 44242, + "Ġreforming": 44243, + "Ġgn": 44244, + "ysh": 44245, + "Ġattor": 44246, + "SCI": 44247, + "Exc": 44248, + "builder": 44249, + "Ġcerium": 44250, + "Ġregistries": 44251, + "ĠMatsumoto": 44252, + "Ġtempting": 44253, + "isha": 44254, + "Ġreorientation": 44255, + "ĠMold": 44256, + "ĠRAGE": 44257, + "yson": 44258, + "Ġunequiv": 44259, + "Ġrelocation": 44260, + "ĠÃķ": 44261, + "ĠReform": 44262, + "ĠREQU": 44263, + "Ġcommensurate": 44264, + "catalog": 44265, + "ĠTPS": 44266, + "Ġlamb": 44267, + "Ġprefactor": 44268, + "archy": 44269, + "Ġdopants": 44270, + "drv": 44271, + "ĠPARAMET": 44272, + "schedule": 44273, + "ochemically": 44274, + "ĠeHealth": 44275, + "unas": 44276, + "ĠPinus": 44277, + "ĠHSA": 44278, + "Ġinterrelations": 44279, + "Ġdepot": 44280, + "ĠPlatinum": 44281, + "Ġlifelong": 44282, + "Ġpersistently": 44283, + "ĠParadox": 44284, + "ĠConformational": 44285, + "esophag": 44286, + "ĠAAT": 44287, + "plin": 44288, + "ĠFCN": 44289, + "ĠDt": 44290, + "oposide": 44291, + "Ġchal": 44292, + "Ġhalt": 44293, + "ĠDetect": 44294, + "Ġdiscriminated": 44295, + "ĠLagrangians": 44296, + "Appro": 44297, + "Ġȧ": 44298, + "Ġimpulsivity": 44299, + "BAT": 44300, + "Chemical": 44301, + "gather": 44302, + "ĠUNC": 44303, + "intron": 44304, + "ĠSimulator": 44305, + "ĠGla": 44306, + "TTT": 44307, + "ĠVolatile": 44308, + "Ġsubsid": 44309, + "ĠBroadcasting": 44310, + "Ġstreptozotocin": 44311, + "Ġfumar": 44312, + "ĠMPEG": 44313, + "Ġinfluenzae": 44314, + "subjects": 44315, + "Ġappropriateness": 44316, + "Ġarcmin": 44317, + "Ġstranded": 44318, + "oylation": 44319, + "ĠDEX": 44320, + "oviral": 44321, + "ĠQuarter": 44322, + "colytic": 44323, + "Ġfriendship": 44324, + "HES": 44325, + "loxacin": 44326, + "Ġere": 44327, + "ĠTrad": 44328, + "uristics": 44329, + "ĠECT": 44330, + "ĠEGCG": 44331, + "ĠLRP": 44332, + "ĠGAG": 44333, + "ĠInP": 44334, + "Ġcontempor": 44335, + "Ġmicror": 44336, + "ierstrass": 44337, + "ĠElectrosp": 44338, + "needed": 44339, + "atmosphere": 44340, + "nT": 44341, + "Ġbandwidths": 44342, + "Ġdiversified": 44343, + "ĠAppropriate": 44344, + "restore": 44345, + "rocnem": 44346, + "ĠLaguerre": 44347, + "ĠSongs": 44348, + "ĠKaluza": 44349, + "ĠSymmetries": 44350, + "ĠSchmitt": 44351, + "Ġbiomolecular": 44352, + "scalebox": 44353, + "Ġintrahepatic": 44354, + "understanding": 44355, + "ĠABCG": 44356, + "Ġunderestimates": 44357, + "ĠStreaming": 44358, + "Ġfictitious": 44359, + "oplasmosis": 44360, + "resident": 44361, + "ĠBary": 44362, + "ĠComa": 44363, + "scrip": 44364, + "Ġdegran": 44365, + "ĠCaMKII": 44366, + "ĠBalmer": 44367, + "ĠPlasm": 44368, + "Ġchelating": 44369, + "ĠParadigm": 44370, + "Ġopponents": 44371, + "EK": 44372, + "Pin": 44373, + "Ġmsec": 44374, + "adone": 44375, + "acht": 44376, + "CCG": 44377, + "ECO": 44378, + "normalize": 44379, + "ĠDesigns": 44380, + "Ġyellowish": 44381, + "glutamyl": 44382, + "Ġdomestication": 44383, + "Ġmonophyletic": 44384, + "dles": 44385, + "nested": 44386, + "ĠGrace": 44387, + "ĠStudios": 44388, + "ĠDiscussions": 44389, + "ophenoxy": 44390, + "Ġveterin": 44391, + "Ġendosym": 44392, + "uttinger": 44393, + "batches": 44394, + "ĠFiji": 44395, + "ĠRNF": 44396, + "ousa": 44397, + "ĠKY": 44398, + "Ġspectrograph": 44399, + "ERIC": 44400, + "ĠMyanmar": 44401, + "ĠConstraining": 44402, + "Ġecologically": 44403, + "Ġfrost": 44404, + "arboux": 44405, + "ĠFibonacci": 44406, + "Ġcanceled": 44407, + "ĠISSN": 44408, + "Rect": 44409, + "another": 44410, + "ĠMMA": 44411, + "OLO": 44412, + "ĠTruth": 44413, + "Ġorthopaedic": 44414, + "Ġtraversing": 44415, + "ischemic": 44416, + "ĠMozambique": 44417, + "ĠMSR": 44418, + "apace": 44419, + "ĠThread": 44420, + "ologia": 44421, + "Ġcalm": 44422, + "methyltransferase": 44423, + "Ġͪ": 44424, + "Ġdrove": 44425, + "Ġcommanded": 44426, + "Ġfeline": 44427, + "ĠRush": 44428, + "ĠLisa": 44429, + "Ġsuperspace": 44430, + "arcy": 44431, + "ĠRegulated": 44432, + "ĠResting": 44433, + "causing": 44434, + "psychotics": 44435, + "qt": 44436, + "Ġtulare": 44437, + "Ġrelocated": 44438, + "Ġrepell": 44439, + "Ġpredatory": 44440, + "people": 44441, + "traits": 44442, + "Euclidean": 44443, + "FDA": 44444, + "XRT": 44445, + "pC": 44446, + "pand": 44447, + "ĠÆ": 44448, + "reve": 44449, + "Ġbids": 44450, + "Ġcousin": 44451, + "Ġsubdomains": 44452, + "tilb": 44453, + "énez": 44454, + "linearly": 44455, + "oproteins": 44456, + "Ġcodec": 44457, + "Ġcontraception": 44458, + "ĠCdk": 44459, + "Ġrailroad": 44460, + "Bench": 44461, + "rng": 44462, + "ĠDLA": 44463, + "entile": 44464, + "ĠCOCO": 44465, + "ĠMatth": 44466, + "ĠOverl": 44467, + "ĠRoutine": 44468, + "Ġmultifocal": 44469, + "Ġartefact": 44470, + "Ġsculpture": 44471, + "cies": 44472, + "mate": 44473, + "ĠØ": 44474, + "urek": 44475, + "ĠBend": 44476, + "ĠNathan": 44477, + "Ġdew": 44478, + "ymia": 44479, + "azzi": 44480, + "ĠErk": 44481, + "Ġgraduation": 44482, + "Boundary": 44483, + "Gra": 44484, + "Ġbfd": 44485, + "ĠSert": 44486, + "Ġovershoot": 44487, + "ĠSeo": 44488, + "Ġsklearn": 44489, + "Ġconservatively": 44490, + "piracy": 44491, + "Ġlaunching": 44492, + "XD": 44493, + "arbitrary": 44494, + "perone": 44495, + "Ġshops": 44496, + "competitive": 44497, + "ĠPakistani": 44498, + "Ġcompetitor": 44499, + "biotics": 44500, + "raits": 44501, + "ĠNoble": 44502, + "Ġsubregions": 44503, + "ĠJump": 44504, + "roller": 44505, + "tris": 44506, + "Ġmacrol": 44507, + "ós": 44508, + "ĠPenic": 44509, + "Ġmicrosomes": 44510, + "Ġimprecise": 44511, + "Ġdowntown": 44512, + "ĠeQTL": 44513, + "ifest": 44514, + "ĠMFI": 44515, + "Ġrarity": 44516, + "âĢĻâĢĻ": 44517, + "Ġbelts": 44518, + "Ġglycosyl": 44519, + "ĠNicolas": 44520, + "synthesis": 44521, + "Oh": 44522, + "hierarch": 44523, + "pps": 44524, + "anets": 44525, + "roads": 44526, + "ATIC": 44527, + "MIMO": 44528, + "ĠContract": 44529, + "Leib": 44530, + "opyrox": 44531, + "Ġinformational": 44532, + "Synonyms": 44533, + "challenge": 44534, + "ĠProximal": 44535, + "ĠCrawford": 44536, + "Ġisopropyl": 44537, + "Ġsubfamilies": 44538, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 44539, + "Ġannotators": 44540, + "Ġreconcile": 44541, + "Ġparsimony": 44542, + "Ġcaspases": 44543, + "cott": 44544, + "environments": 44545, + "Ġdrm": 44546, + "ĠPIL": 44547, + "ĠMec": 44548, + "ĠInfer": 44549, + "ĠSirt": 44550, + "Shell": 44551, + "agulants": 44552, + "seismic": 44553, + "Ġsuburban": 44554, + "ĠXXX": 44555, + "iodes": 44556, + "Ġbackpropagation": 44557, + "traditional": 44558, + "Ġphotocon": 44559, + "ĠMicrobiology": 44560, + "QT": 44561, + "uridine": 44562, + "Ġchop": 44563, + "ĠThé": 44564, + "Ġprejud": 44565, + "Ġencoders": 44566, + "collected": 44567, + "remark": 44568, + "Ġsunspot": 44569, + "ĠPhenolic": 44570, + "Understanding": 44571, + "Ġrejecting": 44572, + "Ġromantic": 44573, + "Ġcentimeters": 44574, + "Ġhallucinations": 44575, + "Home": 44576, + "casted": 44577, + "Ġcw": 44578, + "rai": 44579, + "ĠDisplacement": 44580, + "PHY": 44581, + "carbam": 44582, + "Ġxenon": 44583, + "Ġnarratives": 44584, + "Ġdollar": 44585, + "Ġdynasty": 44586, + "ì§": 44587, + "Ġinforming": 44588, + "ĠOCD": 44589, + "ák": 44590, + "Ġoverheads": 44591, + "juana": 44592, + "ĠKraus": 44593, + "fx": 44594, + "kaya": 44595, + "Ġnid": 44596, + "ĠGrab": 44597, + "Ġinflores": 44598, + "Arc": 44599, + "============": 44600, + "Ġcondenser": 44601, + "Ġnanocar": 44602, + "ommens": 44603, + "Ġsaturating": 44604, + "rece": 44605, + "elif": 44606, + "ĠALE": 44607, + "ĠBub": 44608, + "ĠLaf": 44609, + "andran": 44610, + "Ġpouch": 44611, + "roline": 44612, + "ACHE": 44613, + "CCD": 44614, + "Ġcoolant": 44615, + "Ġgrasslands": 44616, + "ĠSynchronous": 44617, + "izziness": 44618, + "Ġcetuximab": 44619, + "Ġdichotomous": 44620, + "roch": 44621, + "ĠAuckland": 44622, + "obesity": 44623, + "ikit": 44624, + "Ġoperad": 44625, + "ĠOnset": 44626, + "Ġbeforehand": 44627, + "Ġuncomp": 44628, + "USED": 44629, + "ubbing": 44630, + "ĠSMBH": 44631, + "ĠExpedition": 44632, + "Ġhib": 44633, + "ĠPPR": 44634, + "ĠNED": 44635, + "udio": 44636, + "ĠJal": 44637, + "ĠArp": 44638, + "ĠBee": 44639, + "ĠVarieties": 44640, + "Comm": 44641, + "About": 44642, + "ĠAttachment": 44643, + "ODULE": 44644, + "Calculate": 44645, + "Tan": 44646, + "inism": 44647, + "Ġara": 44648, + "Ġcabin": 44649, + "Ġconnexin": 44650, + "Ġcomets": 44651, + "umptive": 44652, + "Ġdestabilization": 44653, + "ĠHolt": 44654, + "ructose": 44655, + "anishi": 44656, + "plasticity": 44657, + "omycosis": 44658, + "ovician": 44659, + "________________": 44660, + "rar": 44661, + "Ġwore": 44662, + "udine": 44663, + "ĠInvariance": 44664, + "Ġperitonitis": 44665, + "Ġmetrology": 44666, + "Ġcloses": 44667, + "Ġcolorless": 44668, + "Noise": 44669, + "DIO": 44670, + "ĠLifshitz": 44671, + "zul": 44672, + "estive": 44673, + "ĠMPA": 44674, + "ĠBooth": 44675, + "ĠDoll": 44676, + "arene": 44677, + "geness": 44678, + "Ġmolecularly": 44679, + "ĠPerkin": 44680, + "Ġdosimetry": 44681, + "ĠSOFT": 44682, + "ĠPyTorch": 44683, + "Ġquarters": 44684, + "ĠKuhn": 44685, + "Ġsplenocytes": 44686, + "RW": 44687, + "cart": 44688, + "leb": 44689, + "Ġcondom": 44690, + "ĠHoc": 44691, + "Ġextents": 44692, + "Ġslug": 44693, + "ĠSupplementation": 44694, + "diffic": 44695, + "esterly": 44696, + "Yu": 44697, + "antigens": 44698, + "ĠÃĴ": 44699, + "Changes": 44700, + "Ġpropylene": 44701, + "ĠPrison": 44702, + "ĠAlgorithmic": 44703, + "Ġtolerances": 44704, + "Adam": 44705, + "Ġesterase": 44706, + "Ġmilder": 44707, + "ĠConvection": 44708, + "PTR": 44709, + "kpc": 44710, + "Ġexo": 44711, + "ĠFah": 44712, + "ĠYFP": 44713, + "ĠCRM": 44714, + "Ġhepatotoxicity": 44715, + "Ġnicotinamide": 44716, + "Ġpatchy": 44717, + "depends": 44718, + "ĠpB": 44719, + "Ġeel": 44720, + "Ġnv": 44721, + "ĠSes": 44722, + "ĠHZ": 44723, + "Ġimprint": 44724, + "epileptic": 44725, + "fluctuations": 44726, + "Ġformalize": 44727, + "chev": 44728, + "Ġdipping": 44729, + "ĠPyramid": 44730, + "Ġholo": 44731, + "ĠMTs": 44732, + "Ġlaminates": 44733, + "Ġwormhole": 44734, + "LAP": 44735, + "hape": 44736, + "Ġak": 44737, + "Ġreals": 44738, + "Ġbystand": 44739, + "Ġinterleaved": 44740, + "Ġxz": 44741, + "ovy": 44742, + "Ġcoprime": 44743, + "uclides": 44744, + "Ġtrimming": 44745, + "MICAL": 44746, + "pyrrole": 44747, + "Ia": 44748, + "NLS": 44749, + "Quality": 44750, + "takes": 44751, + "zinc": 44752, + "ĠPione": 44753, + "ĠEwing": 44754, + "ĠLCA": 44755, + "ĠÃĶ": 44756, + "ictus": 44757, + "Ġcollim": 44758, + "Ġphylogenetically": 44759, + "ĠKeeping": 44760, + "ĠFaith": 44761, + "bonds": 44762, + "titer": 44763, + "Ġsubcategories": 44764, + "shaded": 44765, + "Ġphotospheric": 44766, + "ĠAppearance": 44767, + "ĠUniversities": 44768, + "Ġglomeruli": 44769, + "ĠPrefrontal": 44770, + "Ġprivilege": 44771, + "iH": 44772, + "uya": 44773, + "ĠLCL": 44774, + "ĠInGaAs": 44775, + "Inspired": 44776, + "atalog": 44777, + "ĠPerceptions": 44778, + "ĠNaHCO": 44779, + "Ġstreamline": 44780, + "trajectory": 44781, + "ĠMicrom": 44782, + "Ġbedside": 44783, + "ĠRomero": 44784, + "Ġgaugino": 44785, + "DEN": 44786, + "Fa": 44787, + "Olymp": 44788, + "eal": 44789, + "uels": 44790, + "icylic": 44791, + "Ġgod": 44792, + "Ġattaining": 44793, + "Ġprotests": 44794, + "Ġnowhere": 44795, + "desorption": 44796, + "ĠHydroxy": 44797, + "ĠErbB": 44798, + "ĠSPAR": 44799, + "Ġhinders": 44800, + "herenkov": 44801, + "KERNEL": 44802, + "Ġsect": 44803, + "ulong": 44804, + "Ġpreprocessed": 44805, + "fractional": 44806, + "oyage": 44807, + "Ġphosphatases": 44808, + "Ġcoastline": 44809, + "Ġhref": 44810, + "ĠSutherland": 44811, + "oxone": 44812, + "Ġhomomorphic": 44813, + "DEM": 44814, + "Ġbovis": 44815, + "ĠCBP": 44816, + "plen": 44817, + "ĠBuc": 44818, + "ĠGior": 44819, + "Ġcompost": 44820, + "ĠOracle": 44821, + "ĠSphere": 44822, + "ĠSchre": 44823, + "derivatives": 44824, + "lytes": 44825, + "ĠYo": 44826, + "Ġcyclones": 44827, + "ĠMaize": 44828, + "Ġunfair": 44829, + "Template": 44830, + "Ġimpregnation": 44831, + "Ġlaparoscopy": 44832, + "Ġhamiltonian": 44833, + "ignore": 44834, + "Ġdisposable": 44835, + "earic": 44836, + "Ġelectoral": 44837, + "ccos": 44838, + "ĠShh": 44839, + "Ġturbo": 44840, + "Ġintrusive": 44841, + "Ġprecedence": 44842, + "annotated": 44843, + "Ġdystonia": 44844, + "Fat": 44845, + "uins": 44846, + "Ġsway": 44847, + "arizing": 44848, + "illen": 44849, + "Ġyi": 44850, + "Ġnormed": 44851, + "ĠÌĤ": 44852, + "ĠExtr": 44853, + "ĠProteome": 44854, + "Document": 44855, + "ĠQUANTUM": 44856, + "titi": 44857, + "ĠCPC": 44858, + "ĠMiles": 44859, + "ĠBoc": 44860, + "ĠRTS": 44861, + "CTX": 44862, + "Ġsafegu": 44863, + "ĠNormally": 44864, + "ĠÃľber": 44865, + "onious": 44866, + "ĠSCE": 44867, + "Ġalfalfa": 44868, + "ĠLut": 44869, + "Ġcout": 44870, + "Ġenlarge": 44871, + "ĠEnable": 44872, + "Ġvirion": 44873, + "ĠShallow": 44874, + "definitely": 44875, + "ĠColin": 44876, + "ĠRetention": 44877, + "Ġmimicry": 44878, + "################################################################": 44879, + "NSCLC": 44880, + "Ġgratitude": 44881, + "Ġtending": 44882, + "ĠIDS": 44883, + "eret": 44884, + "rican": 44885, + "Ġxn": 44886, + "ĠYoo": 44887, + "Ġoptimise": 44888, + "Arrow": 44889, + "ĠTransferase": 44890, + "PKC": 44891, + "ĠGuangzhou": 44892, + "ruc": 44893, + "yrid": 44894, + "isz": 44895, + "ĠFIX": 44896, + "ĠDatabases": 44897, + "astron": 44898, + "Ġplayback": 44899, + "Ġnarrowly": 44900, + "Correlation": 44901, + "ĠAffinity": 44902, + "Ġfunctorial": 44903, + "Ġlectins": 44904, + "Ġruptured": 44905, + "Display": 44906, + "ĠSymptom": 44907, + "Ġequidistant": 44908, + "ĠRiccati": 44909, + "ĠAchievement": 44910, + "grand": 44911, + "onated": 44912, + "ĠdH": 44913, + "ĠFID": 44914, + "ĠDER": 44915, + "ĠCoA": 44916, + "Ġgasification": 44917, + "ĠCONS": 44918, + "Ġaccompanies": 44919, + "Ġimpede": 44920, + "Ġprecede": 44921, + "Ġkitchen": 44922, + "progress": 44923, + "Ġwiring": 44924, + "lerenes": 44925, + "ĠGius": 44926, + "Ġtransp": 44927, + "retrie": 44928, + "ijer": 44929, + "affer": 44930, + "Ġbirthday": 44931, + "ĠHald": 44932, + "Ġmusculus": 44933, + "ĠToken": 44934, + "ĠBowel": 44935, + "Ġskipped": 44936, + "Cha": 44937, + "bv": 44938, + "ĠBlow": 44939, + "Ġpreoperatively": 44940, + "Ġglove": 44941, + "ĠLeven": 44942, + "Ġmesop": 44943, + "ĠAuxiliary": 44944, + "ensuremath": 44945, + "jus": 44946, + "Å©": 44947, + "Ġvoter": 44948, + "ĠHitch": 44949, + "proxy": 44950, + "ĠKut": 44951, + "Ġpoems": 44952, + "ĠAngl": 44953, + "cera": 44954, + "Ġstarred": 44955, + "AGES": 44956, + "Science": 44957, + "Analyses": 44958, + "Ġreferees": 44959, + "Ġabrogated": 44960, + "Ġdesalination": 44961, + "ĠPrandtl": 44962, + "Pit": 44963, + "Ġnatal": 44964, + "ogran": 44965, + "ystitis": 44966, + "Ġdesm": 44967, + "Ġcurious": 44968, + "Ġdemon": 44969, + "uzzi": 44970, + "ochondrial": 44971, + "ĠTreaty": 44972, + "Tracker": 44973, + "rhoeae": 44974, + "LW": 44975, + "furt": 44976, + "Ġomp": 44977, + "isational": 44978, + "Ġmemorial": 44979, + "ĠLatency": 44980, + "ĠHypot": 44981, + "Ġglued": 44982, + "exactly": 44983, + "Ġcontraind": 44984, + "Cancer": 44985, + "Ġffi": 44986, + "ĠNAA": 44987, + "ĠChr": 44988, + "egg": 44989, + "ĠMotiv": 44990, + "Ġlayouts": 44991, + "Ġclimb": 44992, + "Ġappendicitis": 44993, + "CUDA": 44994, + "Ġphotoproduction": 44995, + "ĠSIP": 44996, + "Ġveto": 44997, + "perin": 44998, + "ĠUnity": 44999, + "byear": 45000, + "Ġforwarded": 45001, + "ĠDominant": 45002, + "holz": 45003, + "ĠThoracic": 45004, + "DEFINE": 45005, + "Ġtyrosinase": 45006, + "Bad": 45007, + "INA": 45008, + "fuel": 45009, + "Ġgi": 45010, + "ĠVIS": 45011, + "astolic": 45012, + "Ġoxaliplatin": 45013, + "effector": 45014, + "ĉĉĉĉĠ": 45015, + "еÑĢ": 45016, + "ĠBaby": 45017, + "Ġwashout": 45018, + "pituitary": 45019, + "NGC": 45020, + "Ġdns": 45021, + "ĠPoz": 45022, + "ĠUz": 45023, + "positron": 45024, + "ĠElectrons": 45025, + "Ġhemangi": 45026, + "ĠZnS": 45027, + "ĠTEMP": 45028, + "ĠExperimentally": 45029, + "fluorouracil": 45030, + "Ġlaparotomy": 45031, + "analyzer": 45032, + "ocorticoid": 45033, + "ĠIMPL": 45034, + "ĠDNNs": 45035, + "ĠFresnel": 45036, + "Mont": 45037, + "Ġtapes": 45038, + "ulomb": 45039, + "impedance": 45040, + "ĠHET": 45041, + "atha": 45042, + "modulation": 45043, + "ĠCortic": 45044, + "Ġâľĵ": 45045, + "ĠFairness": 45046, + "ĠStiff": 45047, + "Ġbuttons": 45048, + "css": 45049, + "Ġandroid": 45050, + "elast": 45051, + "ĠTeflon": 45052, + "ĠMBC": 45053, + "ĠJT": 45054, + "Ġmultilayered": 45055, + "ĠRee": 45056, + "uitar": 45057, + "ĠPhilips": 45058, + "ĠSkip": 45059, + "doctoral": 45060, + "iyama": 45061, + "ĠLeadership": 45062, + "ĠCrisis": 45063, + "Ġdesensitization": 45064, + "vous": 45065, + "ĠSPP": 45066, + "ĠPGA": 45067, + "ĠNever": 45068, + "Ġdefeating": 45069, + "Ġfibromyalgia": 45070, + "ĠMRP": 45071, + "ĠABCA": 45072, + "ĠLowe": 45073, + "Ġeroded": 45074, + "Ġaugments": 45075, + "ĠBoris": 45076, + "Ġnephrectomy": 45077, + "ĠSherman": 45078, + "Ġrefrigeration": 45079, + "ĠHernández": 45080, + "Ãĺ": 45081, + "ĠTors": 45082, + "chus": 45083, + "ĠVarg": 45084, + "Ġroset": 45085, + "CLR": 45086, + "DEP": 45087, + "Strong": 45088, + "Ġcinerea": 45089, + "ĠHeinrich": 45090, + "Rout": 45091, + "odus": 45092, + "ĠPhone": 45093, + "ĠPerl": 45094, + "Ġseasonally": 45095, + "holding": 45096, + "Ġencephalomyelitis": 45097, + "Ġfascia": 45098, + "Ġlittermates": 45099, + "ĠWITHOUT": 45100, + "б": 45101, + "Ġalerts": 45102, + "ĠKoll": 45103, + "ĠUrs": 45104, + "elfand": 45105, + "ĠRNAP": 45106, + "Ġinvariably": 45107, + "Ġscintigraphy": 45108, + "ĠSebastian": 45109, + "kinesia": 45110, + "CUR": 45111, + "inants": 45112, + "ĠpET": 45113, + "idial": 45114, + "ĠUPLC": 45115, + "Ġsuis": 45116, + "Ġbasolateral": 45117, + "ĠModulates": 45118, + "orbic": 45119, + "Img": 45120, + "Ġparasitism": 45121, + "Ġlaminate": 45122, + "ogeographic": 45123, + "ĠRibeiro": 45124, + "ĠGlutathione": 45125, + "ĠAberrant": 45126, + "Ġsclero": 45127, + "ĠDLS": 45128, + "ĠRuth": 45129, + "Ġrecast": 45130, + "recated": 45131, + "okie": 45132, + "ĠParks": 45133, + "Ġfoliations": 45134, + "ĠDawson": 45135, + "Ġtannins": 45136, + "ĠAaron": 45137, + "pS": 45138, + "itating": 45139, + "ĠITC": 45140, + "ipients": 45141, + "ohy": 45142, + "CCs": 45143, + "Ġethanolic": 45144, + "corhynchus": 45145, + "Ġorientational": 45146, + "Ġhabituation": 45147, + "Ġconversational": 45148, + "ĠVentricular": 45149, + "Ġintercalated": 45150, + "Ġphosphodiesterase": 45151, + "ĠSeifert": 45152, + "wk": 45153, + "algesia": 45154, + "Ġstegan": 45155, + "ĠLus": 45156, + "ophantine": 45157, + "Ġcorrects": 45158, + "ĠObama": 45159, + "latency": 45160, + "Ġsonar": 45161, + "ORMAL": 45162, + "Ġseaweed": 45163, + "ĠPowers": 45164, + "ĠShapley": 45165, + "Lore": 45166, + "Ġawa": 45167, + "alach": 45168, + "ĠFon": 45169, + "ensate": 45170, + "Ġoptima": 45171, + "INF": 45172, + "Ġpolygenic": 45173, + "Ġmesoderm": 45174, + "Conver": 45175, + "BRID": 45176, + "ĠHelp": 45177, + "ĠRasmussen": 45178, + "Ġprokaryotes": 45179, + "ĠEurasian": 45180, + "ĠPermeability": 45181, + "Ġnau": 45182, + "ĠClem": 45183, + "odilation": 45184, + "ĠDiaz": 45185, + "itious": 45186, + "ĠChad": 45187, + "ORA": 45188, + "ĠSimons": 45189, + "ĠDistances": 45190, + "Ġastrometric": 45191, + "ĠCPUs": 45192, + "Ġthioredoxin": 45193, + "perturbation": 45194, + "Ġdendrimer": 45195, + "algal": 45196, + "Ġceliac": 45197, + "asz": 45198, + "ĠPPE": 45199, + "qua": 45200, + "ĠBoll": 45201, + "chr": 45202, + "Ġpreview": 45203, + "ĠProjections": 45204, + "ĠAsians": 45205, + "ĠInferring": 45206, + "ĠNaive": 45207, + "ĠHiggins": 45208, + "ĠLocated": 45209, + "cardiac": 45210, + "ĠLarson": 45211, + "hazard": 45212, + "ĠScientists": 45213, + "Ġpinn": 45214, + "ENCY": 45215, + "forme": 45216, + "chitects": 45217, + "ofluorescent": 45218, + "ĠPortal": 45219, + "Ġpupae": 45220, + "interesting": 45221, + "įĢ": 45222, + "react": 45223, + "atos": 45224, + "enin": 45225, + "tio": 45226, + "ĠCapp": 45227, + "ĠMau": 45228, + "ĠLSC": 45229, + "ĠVlasov": 45230, + "Ġsubsum": 45231, + "Ġdeserve": 45232, + "ASD": 45233, + "Rece": 45234, + "Ġconsonant": 45235, + "Ġimpregnated": 45236, + "Ġlignocellulosic": 45237, + "Ġsows": 45238, + "lement": 45239, + "ĠTier": 45240, + "ĠMEF": 45241, + "ĠHugh": 45242, + "inck": 45243, + "pyrazole": 45244, + "ULATIONS": 45245, + "ĠALI": 45246, + "ĠDrift": 45247, + "Ġsolubilized": 45248, + "Ġdrafting": 45249, + "icyclic": 45250, + "Ġredesign": 45251, + "Ġdeliberate": 45252, + "Ġtapping": 45253, + "ĠTomas": 45254, + "ĠTunneling": 45255, + "ĠCBR": 45256, + "Ġanodes": 45257, + "ĠLSR": 45258, + "ĠNath": 45259, + "rosive": 45260, + "ĠHeidelberg": 45261, + "Ġcrushing": 45262, + "ĠShore": 45263, + "Ġmalondialdehyde": 45264, + "ĠMRD": 45265, + "ogloss": 45266, + "ncia": 45267, + "Ġgranuloma": 45268, + "Ġplaintext": 45269, + "Ġarteriovenous": 45270, + "Ġrifampicin": 45271, + "Lepidoptera": 45272, + "Oct": 45273, + "Ġlone": 45274, + "ĠAppe": 45275, + "ĠIntermitt": 45276, + "compile": 45277, + "potentials": 45278, + "ĠStandardized": 45279, + "Ġventilatory": 45280, + "Ġhypercholesterolemia": 45281, + "ĠEVALUATION": 45282, + "ked": 45283, + "xC": 45284, + "enos": 45285, + "Ġbauthorbsnm": 45286, + "ĠRost": 45287, + "mathopen": 45288, + "Ġcontested": 45289, + "Ġros": 45290, + "otho": 45291, + "Ġemits": 45292, + "erozo": 45293, + "Ġpropranolol": 45294, + "Ġexacerbate": 45295, + "Integrating": 45296, + "ĠWarsaw": 45297, + "Ñĩ": 45298, + "refractory": 45299, + "ĠMort": 45300, + "phosphonate": 45301, + "GLT": 45302, + "ĠChloride": 45303, + "ĠLUAD": 45304, + "ĠSQUID": 45305, + "ĠOBSERVATIONS": 45306, + "Ħĺ": 45307, + "agles": 45308, + "uger": 45309, + "Ġdiffusing": 45310, + "ylar": 45311, + "Ġantip": 45312, + "renormal": 45313, + "Ġsheared": 45314, + "ĠAndr": 45315, + "ymptotics": 45316, + "ĠIdentified": 45317, + "Ġflexor": 45318, + "Liouville": 45319, + "ĠCytotoxic": 45320, + "Lock": 45321, + "donald": 45322, + "ĠSHA": 45323, + "projected": 45324, + "plicial": 45325, + "Ġbasics": 45326, + "ĠCarvalho": 45327, + "Ġheterocyclic": 45328, + "Ġfluorophore": 45329, + "ĠIntrigu": 45330, + "ĠAnnealing": 45331, + "Gln": 45332, + "Hispanic": 45333, + "Ġsaus": 45334, + "ĠTCS": 45335, + "ĠHAP": 45336, + "Ġytt": 45337, + "Ġconsulting": 45338, + "rects": 45339, + "Ġinfall": 45340, + "LEV": 45341, + "triazole": 45342, + "Ġnarrowed": 45343, + "Ġamphoteric": 45344, + "ĠSorting": 45345, + "ĠMoments": 45346, + "Ġarabin": 45347, + "Ġcoconut": 45348, + "ĠIntriguingly": 45349, + "Ġpushes": 45350, + "Ġmec": 45351, + "ĠNair": 45352, + "Ġcolistin": 45353, + "ĠObtained": 45354, + "dfs": 45355, + "Ġcompetency": 45356, + "WORD": 45357, + "ĠAAS": 45358, + "ĠBNP": 45359, + "ĠHAS": 45360, + "ĠLun": 45361, + "ĠLnc": 45362, + "Ġhydrocephalus": 45363, + "Ġhomological": 45364, + "Ġcarbonic": 45365, + "ĠHiSeq": 45366, + "community": 45367, + "Ġcephalospor": 45368, + "Ġhostile": 45369, + "provide": 45370, + "Ġskyrmion": 45371, + "DAG": 45372, + "Ġcnt": 45373, + "Ġhay": 45374, + "Ġorderings": 45375, + "Ġflock": 45376, + "HEA": 45377, + "ĠNeurom": 45378, + "Ġboosts": 45379, + "ĠCardinal": 45380, + "ĠBachelor": 45381, + "Ġdecent": 45382, + "ĠYak": 45383, + "Ġcalcd": 45384, + "ĠBoer": 45385, + "Ġtranscriptomics": 45386, + "Ġrearranged": 45387, + "ĠPolymorphisms": 45388, + "ĠPrasad": 45389, + "oinositide": 45390, + "bars": 45391, + "Ġãģ": 45392, + "ĠSAA": 45393, + "Ġonion": 45394, + "agel": 45395, + "ĠHp": 45396, + "ogrel": 45397, + "divisions": 45398, + "andan": 45399, + "arias": 45400, + "Ġcolo": 45401, + "ragon": 45402, + "Ġschizophren": 45403, + "âī¡": 45404, + "Ġreplicative": 45405, + "Ġdegenerated": 45406, + "Ġsteepest": 45407, + "Volume": 45408, + "IENT": 45409, + "Public": 45410, + "Ten": 45411, + "enberger": 45412, + "ĠCoun": 45413, + "ĠEpp": 45414, + "izo": 45415, + "Ġcomplexed": 45416, + "Ġferroc": 45417, + "kenstein": 45418, + "ĠJerry": 45419, + "Ġparadoxical": 45420, + "xg": 45421, + "icer": 45422, + "osol": 45423, + "Ġannu": 45424, + "Ġankyl": 45425, + "chung": 45426, + "entious": 45427, + "Ġpreshe": 45428, + "enetic": 45429, + "ĠHealing": 45430, + "ĠParabolic": 45431, + "Ġfigs": 45432, + "ĠKinematic": 45433, + "Ġobligate": 45434, + "ĠLayout": 45435, + "Ġtelemedicine": 45436, + "ĠLennard": 45437, + "pci": 45438, + "arone": 45439, + "ĠZach": 45440, + "Ġprototyping": 45441, + "ĠMetagen": 45442, + "IMAL": 45443, + "conscious": 45444, + "Ġquadrilateral": 45445, + "ĠUncertainties": 45446, + "ĠPrefecture": 45447, + "GBM": 45448, + "rals": 45449, + "alus": 45450, + "Ġhopes": 45451, + "Ġclicks": 45452, + "ĠJD": 45453, + "lectance": 45454, + "Ġpathologists": 45455, + "ussels": 45456, + "tisone": 45457, + "CPT": 45458, + "Ġmiscon": 45459, + "ĠNeurode": 45460, + "Ġmutagenic": 45461, + "ĠMultimedia": 45462, + "Original": 45463, + "ĠDrake": 45464, + "PWM": 45465, + "Ġpiles": 45466, + "stant": 45467, + "ARA": 45468, + "ĠRING": 45469, + "modifying": 45470, + "Ġastrocyt": 45471, + "ĠCyst": 45472, + "Ġlegends": 45473, + "glucuron": 45474, + "Ġincompletely": 45475, + "ĠConfed": 45476, + "ĠDLBCL": 45477, + "ĠPapua": 45478, + "Ġcontrastive": 45479, + "ĠSIMULATION": 45480, + "ĠJuvenile": 45481, + "aggregated": 45482, + "ĠcGMP": 45483, + "ictive": 45484, + "ĠHNF": 45485, + "ĠNPV": 45486, + "ĠKoc": 45487, + "ometallic": 45488, + "mini": 45489, + "ĠQuantit": 45490, + "ĠCornell": 45491, + "Ġdeduction": 45492, + "Ġcoinciding": 45493, + "ĠIrr": 45494, + "Precision": 45495, + "Ġginseng": 45496, + "ões": 45497, + "jer": 45498, + "ĠReader": 45499, + "ĠByr": 45500, + "corrections": 45501, + "devices": 45502, + "Ġambul": 45503, + "Ġpedicle": 45504, + "ĠDependency": 45505, + "ĠStriking": 45506, + "Ġwarehouse": 45507, + "Ġrecirculation": 45508, + "Ġgonorrhoeae": 45509, + "ĠPRES": 45510, + "ĠBhar": 45511, + "Ġflushing": 45512, + "torus": 45513, + "ĠIRB": 45514, + "glycine": 45515, + "Ġmethamphetamine": 45516, + "Ġmirrored": 45517, + "ĠWilliamson": 45518, + "Ġcathodes": 45519, + "hydroxylase": 45520, + "Radio": 45521, + "Ġfurniture": 45522, + "ĠRosenberg": 45523, + "ĠNSAIDs": 45524, + "semiconductor": 45525, + "Ġasynchron": 45526, + "ĠBerm": 45527, + "ĠInten": 45528, + "ibe": 45529, + "Force": 45530, + "pathogenic": 45531, + "smokers": 45532, + "Ġdiphenyl": 45533, + "Ġи": 45534, + "Ġstandalone": 45535, + "Ġlithospheric": 45536, + "Ġtradeoffs": 45537, + "Ġantich": 45538, + "Ġthymidine": 45539, + "ĠMedicinal": 45540, + "Ġentrepreneurial": 45541, + "Ġtrapezoidal": 45542, + "ĠAsynchronous": 45543, + "tifying": 45544, + "ĠCollapse": 45545, + "ĠHEV": 45546, + "ĠFrozen": 45547, + "ĠTeichmüller": 45548, + "rocnemius": 45549, + "Ġfern": 45550, + "Ġws": 45551, + "omol": 45552, + "Ġenclosing": 45553, + "rapid": 45554, + "Ġlogged": 45555, + "varvec": 45556, + "Ġamplifying": 45557, + "differences": 45558, + "otonin": 45559, + "ĠPromoting": 45560, + "ĠFritz": 45561, + "Ġattainable": 45562, + "Ġaltim": 45563, + "ĠOGD": 45564, + "Ġthermometer": 45565, + "Solver": 45566, + "ĠBirk": 45567, + "LENBQU": 45568, + "ĠGateway": 45569, + "Ġengraftment": 45570, + "FIF": 45571, + "HSD": 45572, + "Ġrestructuring": 45573, + "ĠTensile": 45574, + "ĠCele": 45575, + "ylus": 45576, + "Ġfeather": 45577, + "Ġdrifting": 45578, + "ĠPreclinical": 45579, + "yrrole": 45580, + "Ġcommem": 45581, + "Ġfixations": 45582, + "Petsc": 45583, + "ĠIschemia": 45584, + "aA": 45585, + "asoro": 45586, + "ĠSony": 45587, + "ĠUt": 45588, + "Ġextensor": 45589, + "ĠChau": 45590, + "ĠIsotopic": 45591, + "ILI": 45592, + "CNP": 45593, + "ĠDEF": 45594, + "Ġmountainous": 45595, + "Ġsarcomas": 45596, + "ugoslav": 45597, + "CALL": 45598, + "Sensitive": 45599, + "atro": 45600, + "Ġuncoupling": 45601, + "skew": 45602, + "ĠEmissions": 45603, + "innati": 45604, + "Ġconceptualization": 45605, + "Ġowns": 45606, + "Ġsquadron": 45607, + "ĠStrengths": 45608, + "Coh": 45609, + "UAL": 45610, + "magenta": 45611, + "usb": 45612, + "ĠSPC": 45613, + "cones": 45614, + "ĠSelecting": 45615, + "ĠParish": 45616, + "Ġvalidates": 45617, + "ĠÍĹ": 45618, + "Ġposteriorly": 45619, + "omonad": 45620, + "VOL": 45621, + "jectivity": 45622, + "ĠCLO": 45623, + "ĠVTA": 45624, + "Ġunpleasant": 45625, + "Ġcareers": 45626, + "Ġautomorphic": 45627, + "ĠNanow": 45628, + "Ġasterisks": 45629, + "ĠSchulz": 45630, + "publication": 45631, + "Ġbiv": 45632, + "Ġrug": 45633, + "recognition": 45634, + "Ġreferrals": 45635, + "Ġneurones": 45636, + "ĠCaffe": 45637, + "Connor": 45638, + "ĠSheffield": 45639, + "unitinib": 45640, + "ĠAntagon": 45641, + "Ġpneumatic": 45642, + "Ġcleaner": 45643, + "ĠBAO": 45644, + "ĠScilabString": 45645, + "neighbour": 45646, + "Euler": 45647, + "ĠTuple": 45648, + "oty": 45649, + "dian": 45650, + "Ġyoga": 45651, + "Ġevanes": 45652, + "Ġstarved": 45653, + "Ġfluctuate": 45654, + "ĠBiomarker": 45655, + "Ġimpulses": 45656, + "Ġossification": 45657, + "Ġdemyelination": 45658, + "ĠSAD": 45659, + "essing": 45660, + "Ġreddish": 45661, + "Ġsynth": 45662, + "Ġcurvilinear": 45663, + "ĠDenis": 45664, + "Ġphonetic": 45665, + "Ġhammer": 45666, + "Ġepidermidis": 45667, + "Ġplagioclase": 45668, + "Ġĉ": 45669, + "Ġwolf": 45670, + "osced": 45671, + "Ġphotothermal": 45672, + "Ġchewing": 45673, + "Maximum": 45674, + "Ġmismatched": 45675, + "ĠFcγ": 45676, + "Ġumbrella": 45677, + "ĠSiberian": 45678, + "arra": 45679, + "ipped": 45680, + "ympathetic": 45681, + "acceleration": 45682, + "Ġeigenmodes": 45683, + "ĠEquivalently": 45684, + "ĠPRISMA": 45685, + "conservative": 45686, + "ñez": 45687, + "Ġvolcanoes": 45688, + "Ġtelemetry": 45689, + "mile": 45690, + "ĠBoch": 45691, + "oprim": 45692, + "Ġincipient": 45693, + "Ġunderstandable": 45694, + "atricyclo": 45695, + "ĠLogical": 45696, + "ĠQueue": 45697, + "Ġcryostat": 45698, + "definecolor": 45699, + "ĠSae": 45700, + "Ġarct": 45701, + "Ġsoul": 45702, + "ĠHistopathological": 45703, + "ĠNeurot": 45704, + "Ġmethanolic": 45705, + "Px": 45706, + "ĠTitle": 45707, + "otomic": 45708, + "ĠEld": 45709, + "ĠEMA": 45710, + "Ġdebrid": 45711, + "timulatory": 45712, + "ĠZan": 45713, + "Ġnormot": 45714, + "Ġfluidity": 45715, + "Ġfluidized": 45716, + "previously": 45717, + "Ġcracked": 45718, + "ĠExplaining": 45719, + "ĠONE": 45720, + "ĠFlora": 45721, + "ĠHybridization": 45722, + "Ġreticul": 45723, + "FK": 45724, + "notic": 45725, + "ĠnA": 45726, + "ĠPab": 45727, + "ticum": 45728, + "andy": 45729, + "ugia": 45730, + "ilet": 45731, + "MING": 45732, + "Ġrests": 45733, + "ompact": 45734, + "Ġtrackers": 45735, + "phosphatase": 45736, + "ĠTransfection": 45737, + "ĠHospitals": 45738, + "acrine": 45739, + "ĠDell": 45740, + "ĠVAE": 45741, + "ĠThroughput": 45742, + "hevsky": 45743, + "ĠSommer": 45744, + "PSA": 45745, + "ìļ": 45746, + "Ġbush": 45747, + "Ġlunch": 45748, + "ĠSwe": 45749, + "ĠInstruction": 45750, + "akami": 45751, + "Ġdisinfect": 45752, + "Ġcorps": 45753, + "ĉĉĠĠ": 45754, + "Ġprompts": 45755, + "MSH": 45756, + "ĠAgrawal": 45757, + "Ġlysosome": 45758, + "integrin": 45759, + "ĠỸ": 45760, + "Ġnondecreasing": 45761, + "ĠRequest": 45762, + "ĠREP": 45763, + "occus": 45764, + "Ġlagrangian": 45765, + "oregulation": 45766, + "ол": 45767, + "ĠBoson": 45768, + "Iso": 45769, + "atellites": 45770, + "resectable": 45771, + "riv": 45772, + "Ġdeaminase": 45773, + "Ġcoheren": 45774, + "Ġdecoy": 45775, + "ĠExtinction": 45776, + "acetone": 45777, + "Ġgovernmental": 45778, + "Ġcumulants": 45779, + "Ġviscosities": 45780, + "Register": 45781, + "documented": 45782, + "Ġimmortalized": 45783, + "DPP": 45784, + "Gel": 45785, + "bron": 45786, + "kow": 45787, + "ĠProportion": 45788, + "ĠChase": 45789, + "ĠClad": 45790, + "Ġadapts": 45791, + "ĠCAV": 45792, + "Ġż": 45793, + "Ġpelleted": 45794, + "Ġpenguin": 45795, + "ĠZhejiang": 45796, + "feasible": 45797, + "DIV": 45798, + "iya": 45799, + "Ġthrowing": 45800, + "resia": 45801, + "ĠNr": 45802, + "ESP": 45803, + "CDF": 45804, + "suppressed": 45805, + "Ġtetrachlor": 45806, + "Ġaerospace": 45807, + "Until": 45808, + "Ġpayoffs": 45809, + "Ġtownship": 45810, + "Ġesterification": 45811, + "ĠAchilles": 45812, + "Ġracem": 45813, + "opyranoside": 45814, + "ĠCSM": 45815, + "assis": 45816, + "Ġsupercell": 45817, + "ĠRegime": 45818, + "IRA": 45819, + "Ġsubsequences": 45820, + "ĠPenet": 45821, + "ĠAnalytics": 45822, + "ĠLVEF": 45823, + "Ġbiphenyl": 45824, + "Gradient": 45825, + "osylation": 45826, + "ĠWRF": 45827, + "ofs": 45828, + "conductors": 45829, + "Ġbacked": 45830, + "pidal": 45831, + "ĠNFAT": 45832, + "ĠRemember": 45833, + "Ġtelomeric": 45834, + "Ġtaurine": 45835, + "increases": 45836, + "Ġunintended": 45837, + "ĠNervous": 45838, + "Ras": 45839, + "ylyl": 45840, + "Ġaestiv": 45841, + "ĠSick": 45842, + "ĠTheta": 45843, + "Ġcliques": 45844, + "Ġsofter": 45845, + "ĠQRS": 45846, + "lliptic": 45847, + "ĠImmunotherapy": 45848, + "QUF": 45849, + "onomously": 45850, + "ĠFLU": 45851, + "ĠIncorporation": 45852, + "ĠFormicidae": 45853, + "JR": 45854, + "whole": 45855, + "Ġcasing": 45856, + "Ġnob": 45857, + "ĠDou": 45858, + "Ġintronic": 45859, + "Ġentrapment": 45860, + "orbits": 45861, + "Ġsalam": 45862, + "ĠCRS": 45863, + "ĠSwan": 45864, + "ĠEdgar": 45865, + "Ġconcomitantly": 45866, + "atetracyclo": 45867, + "ĠAHR": 45868, + "ticks": 45869, + "ĠBing": 45870, + "ĠRift": 45871, + "Ġplugging": 45872, + "ĠscRNA": 45873, + "Ġoutreach": 45874, + "inskii": 45875, + "Ġcustomary": 45876, + "Ġmd": 45877, + "ĠOzone": 45878, + "ussing": 45879, + "others": 45880, + "Ġentirety": 45881, + "Arth": 45882, + "Acet": 45883, + "ĠFleet": 45884, + "ĠBehavioural": 45885, + "ĠQSOs": 45886, + "arina": 45887, + "Ġprodrug": 45888, + "ĠBros": 45889, + "ĠWorth": 45890, + "Ġyz": 45891, + "contig": 45892, + "ĠAmorphous": 45893, + "ĠErlang": 45894, + "Ġhonour": 45895, + "ĠâIJ¥": 45896, + "Ġinfiltrates": 45897, + "ĠIvanov": 45898, + "ĠMunicipality": 45899, + "ĠDialogue": 45900, + "tone": 45901, + "Ġpytest": 45902, + "iculus": 45903, + "ĠGoth": 45904, + "ĠXC": 45905, + "ĠSUMMARY": 45906, + "Ġshrinks": 45907, + "Ġinverses": 45908, + "iomas": 45909, + "robi": 45910, + "ĠTPR": 45911, + "ĠANA": 45912, + "istries": 45913, + "Ġregiment": 45914, + "indo": 45915, + "ĠReproduction": 45916, + "loqu": 45917, + "inflation": 45918, + "ETX": 45919, + "Ġïĺ»": 45920, + "ĠAPPENDIX": 45921, + "Ġworsened": 45922, + "Ġpsoriatic": 45923, + "Ġmidwives": 45924, + "Ġtouched": 45925, + "Ëĩ": 45926, + "ĠPatric": 45927, + "ĠDON": 45928, + "ĠLIM": 45929, + "akos": 45930, + "ĠVie": 45931, + "ĠAntit": 45932, + "Ġflake": 45933, + "ĠSchle": 45934, + "ĠCoronal": 45935, + "Ġsalary": 45936, + "slight": 45937, + "ĠCAF": 45938, + "Ġsummarise": 45939, + "Ġflavus": 45940, + "ĠBalanced": 45941, + "ĠPHOT": 45942, + "Ġmillet": 45943, + "Ġurgency": 45944, + "ĠGleason": 45945, + "ĠMie": 45946, + "ĠDp": 45947, + "ĠGarg": 45948, + "Ġleprosy": 45949, + "Ġunoccupied": 45950, + "ĠStret": 45951, + "ilept": 45952, + "ĠChor": 45953, + "ibrate": 45954, + "ĠÍļ": 45955, + "ĠPHB": 45956, + "Ġmonoter": 45957, + "ĠJavaScript": 45958, + "btn": 45959, + "ĠPulsar": 45960, + "ĠKirchhoff": 45961, + "Ġoverseas": 45962, + "Ġdephosphorylation": 45963, + "ortin": 45964, + "ĠPolyakov": 45965, + "Ġinsightful": 45966, + "ĠPurified": 45967, + "Ġanchorage": 45968, + "ĠGlycoprotein": 45969, + "studies": 45970, + "Ġchronology": 45971, + "roxine": 45972, + "ĠNeptune": 45973, + "Ban": 45974, + "Ġlion": 45975, + "PSD": 45976, + "ĠBarr": 45977, + "Ġdonkey": 45978, + "Ġlikelihoods": 45979, + "atchewan": 45980, + "otet": 45981, + "ospha": 45982, + "ticism": 45983, + "Ġry": 45984, + "asthen": 45985, + "rhotic": 45986, + "ĠSubgroup": 45987, + "yev": 45988, + "ĠPatri": 45989, + "provides": 45990, + "SGD": 45991, + "berell": 45992, + "vw": 45993, + "ĠAACR": 45994, + "Ġsmears": 45995, + "ODS": 45996, + "supplemented": 45997, + "ĠEngagement": 45998, + "oglobulins": 45999, + "Ġirregularly": 46000, + "ĠSzeg": 46001, + "ĠWolff": 46002, + "Ġenantiomers": 46003, + "Ġobeying": 46004, + "Ġdestroying": 46005, + "omially": 46006, + "ĠAti": 46007, + "ĠGAT": 46008, + "ĠInvariants": 46009, + "ĠScoring": 46010, + "Ġhalides": 46011, + "Ġtransformants": 46012, + "Ġforested": 46013, + "Ġgallic": 46014, + "ĠBetti": 46015, + "threaded": 46016, + "ĠBudget": 46017, + "junctive": 46018, + "ĠInnovative": 46019, + "Ġpositrons": 46020, + "Brazil": 46021, + "eira": 46022, + "Ġlavas": 46023, + "ĠLt": 46024, + "photo": 46025, + "Ġspam": 46026, + "Ġih": 46027, + "ustering": 46028, + "Ġbioluminescence": 46029, + "ĠShapes": 46030, + "ULTI": 46031, + "triangles": 46032, + "ĠSMN": 46033, + "enhancing": 46034, + "ĠReduces": 46035, + "ĠTHEOREM": 46036, + "Dop": 46037, + "ĠdL": 46038, + "emptive": 46039, + "Ġreminder": 46040, + "Ġgonads": 46041, + "Ġxylan": 46042, + "cultures": 46043, + "tles": 46044, + "Ġtd": 46045, + "Ġerected": 46046, + "terone": 46047, + "ĠPDC": 46048, + "Ġincongruent": 46049, + "Ġmembranous": 46050, + "pac": 46051, + "yless": 46052, + "Ġsubalgebras": 46053, + "ĠChir": 46054, + "ĠZIP": 46055, + "autious": 46056, + "Ġlightly": 46057, + "ĠPhotometric": 46058, + "Transfer": 46059, + "Ġketo": 46060, + "Ġexercised": 46061, + "dispersive": 46062, + "ĠBETWEEN": 46063, + "rou": 46064, + "Ġgarbage": 46065, + "ĠMaf": 46066, + "ĠDoming": 46067, + "ĠSubspace": 46068, + "ĠMarÃŃa": 46069, + "Ġtetrahedra": 46070, + "ĠBarker": 46071, + "Side": 46072, + "bishop": 46073, + "iD": 46074, + "reversible": 46075, + "orman": 46076, + "orescein": 46077, + "ĠContrib": 46078, + "Ġderivatization": 46079, + "romeres": 46080, + "ĠALD": 46081, + "EEK": 46082, + "ĠTreating": 46083, + "combination": 46084, + "ïĺ»": 46085, + "restriction": 46086, + "supseteq": 46087, + "ĠRAPD": 46088, + "Ġamendment": 46089, + "zynski": 46090, + "Ġcaves": 46091, + "ilot": 46092, + "Ġabundantly": 46093, + "на": 46094, + "Ġinjectable": 46095, + "ĠReinforced": 46096, + "ĠWidth": 46097, + "ĠHaemophilus": 46098, + "ilane": 46099, + "props": 46100, + "Ġintervertebral": 46101, + "Ġscroll": 46102, + "Ġamput": 46103, + "ĠUnusual": 46104, + "Ġstatically": 46105, + "Ġsynergies": 46106, + "Ġdims": 46107, + "plasmic": 46108, + "Ġneutralized": 46109, + "Selected": 46110, + "Ġinherits": 46111, + "ĠAutomation": 46112, + "Ġprotoplanetary": 46113, + "Statement": 46114, + "ĠAPOBEC": 46115, + "Ġcertificates": 46116, + "ĠCitrus": 46117, + "quadruplex": 46118, + "Nord": 46119, + "Ġfran": 46120, + "ĠCarcin": 46121, + "utan": 46122, + "ĠPump": 46123, + "ĠBav": 46124, + "ĠGras": 46125, + "tingales": 46126, + "Ġcausally": 46127, + "Ġradon": 46128, + "Compare": 46129, + "Ġclamping": 46130, + "irreducible": 46131, + "IHC": 46132, + "ĠÙ": 46133, + "Ġcyp": 46134, + "ĠTPP": 46135, + "ĠSuff": 46136, + "undra": 46137, + "ĠVilla": 46138, + "Ġrelieved": 46139, + "ĠJCM": 46140, + "Ġtreaty": 46141, + "IGEN": 46142, + "ĠDevonian": 46143, + "Ġerythropo": 46144, + "RAP": 46145, + "Ġaversive": 46146, + "entate": 46147, + "odactyl": 46148, + "ĠParal": 46149, + "Ġmilled": 46150, + "Ġbioinformatic": 46151, + "okinetic": 46152, + "ĠSTRING": 46153, + "ĠPedersen": 46154, + "database": 46155, + "inorganic": 46156, + "Ġdeput": 46157, + "Ġneb": 46158, + "iped": 46159, + "Ġdiffused": 46160, + "othione": 46161, + "Ġnonstationary": 46162, + "Ġundertaking": 46163, + "ĠEnabling": 46164, + "Ġdenatured": 46165, + "Ġloader": 46166, + "ĠLyon": 46167, + "iparametric": 46168, + "Ġmeristem": 46169, + "ĠAngiogenesis": 46170, + "ĠPulsed": 46171, + "Ġexcer": 46172, + "ĠDf": 46173, + "arches": 46174, + "Ġcollide": 46175, + "ĠRelational": 46176, + "ĠNFκB": 46177, + "Metadata": 46178, + "ĠAddressing": 46179, + "Ġpercussion": 46180, + "ĠFlorence": 46181, + "Ġnymphs": 46182, + "Cn": 46183, + "storm": 46184, + "ĠGraz": 46185, + "composite": 46186, + "ĠAdmiral": 46187, + "ĠScotia": 46188, + "Ġbremsstrahlung": 46189, + "apsack": 46190, + "Ġminimizers": 46191, + "Ġmanageable": 46192, + "Ġcarboxylate": 46193, + "Ġintermediary": 46194, + "ĠBranching": 46195, + "scheduler": 46196, + "inoculated": 46197, + "ĠExtremely": 46198, + "Ġantennae": 46199, + "ĠTill": 46200, + "RESH": 46201, + "Ġopacities": 46202, + "Ġchemopre": 46203, + "Ġadenylate": 46204, + "Ġcircumstance": 46205, + "ĠHashimoto": 46206, + "ÄĽ": 46207, + "ceae": 46208, + "ĠFm": 46209, + "ĠBX": 46210, + "Ġmeantime": 46211, + "accurate": 46212, + "collinear": 46213, + "ACTIC": 46214, + "ĠSlovenia": 46215, + "Fed": 46216, + "Kh": 46217, + "Tm": 46218, + "fork": 46219, + "inology": 46220, + "lef": 46221, + "ĠDCS": 46222, + "Ġheritable": 46223, + "Ġannouncement": 46224, + "Ġbusinessman": 46225, + "Ġbortezomib": 46226, + "Ġtourist": 46227, + "ĠEtymology": 46228, + "Ġdoctrine": 46229, + "BIN": 46230, + "suffix": 46231, + "aras": 46232, + "ĠSau": 46233, + "unboldmath": 46234, + "ĠMEP": 46235, + "inker": 46236, + "Ġoptimism": 46237, + "ĠLeuc": 46238, + "efulness": 46239, + "crust": 46240, + "ĠKeys": 46241, + "ĠâϦ": 46242, + "ĠBrandt": 46243, + "âĮ¬": 46244, + "ĠSeventy": 46245, + "Ġnursery": 46246, + "Ġdeputy": 46247, + "ì": 46248, + "onis": 46249, + "amus": 46250, + "ĠCig": 46251, + "Ġexergy": 46252, + "ĠFrequent": 46253, + "Ġabor": 46254, + "ĠJazz": 46255, + "Ġstatue": 46256, + "ĠScenarios": 46257, + "Ġcytological": 46258, + "figures": 46259, + "MCI": 46260, + "dirname": 46261, + "Ġcytokinesis": 46262, + "delivery": 46263, + "ĠBowen": 46264, + "Ġflanked": 46265, + "Ġregenerating": 46266, + "ĠFerrari": 46267, + "kiss": 46268, + "ĠAval": 46269, + "ĠCIT": 46270, + "ĠMum": 46271, + "ĠLSB": 46272, + "ogging": 46273, + "Ġunited": 46274, + "Ġtritium": 46275, + "ontamination": 46276, + "coef": 46277, + "Ġpropell": 46278, + "triple": 46279, + "Ġimmense": 46280, + "Ġcomplained": 46281, + "Ġdielectrics": 46282, + "ĠCardiomy": 46283, + "Ġflooded": 46284, + "ĠCovariance": 46285, + "Attendance": 46286, + "TMP": 46287, + "Ġsob": 46288, + "ĠSonic": 46289, + "ĠFTS": 46290, + "ĠRSD": 46291, + "essors": 46292, + "ĠWon": 46293, + "iffs": 46294, + "Ġflowchart": 46295, + "ĠElemental": 46296, + "Ġìŀ": 46297, + "Ġfoliage": 46298, + "differentiated": 46299, + "ĠGlobular": 46300, + "Ġperceptron": 46301, + "candidate": 46302, + "Social": 46303, + "Witt": 46304, + "dyn": 46305, + "paces": 46306, + "ĠmGlu": 46307, + "Ġbanned": 46308, + "olinite": 46309, + "ĠFriends": 46310, + "ĠLibraries": 46311, + "unces": 46312, + "ĠReach": 46313, + "ĠSkills": 46314, + "Ġrecipes": 46315, + "Ġcannula": 46316, + "ĠOrthodox": 46317, + "ĠCarbohydrate": 46318, + "Ġaromatase": 46319, + "Åijs": 46320, + "Ġemanating": 46321, + "elected": 46322, + "Ġtense": 46323, + "ĠFLC": 46324, + "ĠLET": 46325, + "herjee": 46326, + "Ġsubband": 46327, + "ophone": 46328, + "ĠActual": 46329, + "msgs": 46330, + "EMD": 46331, + "ISON": 46332, + "leyball": 46333, + "ĠNiu": 46334, + "Ġberries": 46335, + "diagnostic": 46336, + "NER": 46337, + "ĠdΩ": 46338, + "percentage": 46339, + "ĠHerman": 46340, + "ĠGSD": 46341, + "Ġsubproblem": 46342, + "overall": 46343, + "ophor": 46344, + "Ġdelocalized": 46345, + "account": 46346, + "ĠGeographical": 46347, + "distances": 46348, + "Ġàµ": 46349, + "Ġneurotoxic": 46350, + "opodia": 46351, + "ĠDicer": 46352, + "ĠðxÃŀ": 46353, + "Ġdunes": 46354, + "Ġwhit": 46355, + "ĠImmediate": 46356, + "Ġ̸": 46357, + "Ġadhesives": 46358, + "ĠNSs": 46359, + "Ġguessing": 46360, + "ĠColumbus": 46361, + "ĠUrugu": 46362, + "behaviour": 46363, + "ĠSerbian": 46364, + "benzodioxol": 46365, + "implementation": 46366, + "osensitive": 46367, + "ĠFill": 46368, + "phage": 46369, + "recovery": 46370, + "ESR": 46371, + "Ġanalysts": 46372, + "Ġdissatisfaction": 46373, + "banded": 46374, + "ĠDepressive": 46375, + "ĠRTs": 46376, + "Refs": 46377, + "millimeter": 46378, + "ĠOlsen": 46379, + "ampton": 46380, + "ĠACA": 46381, + "ĠAvian": 46382, + "ĠFowler": 46383, + "ubini": 46384, + "estamps": 46385, + "ĠProtest": 46386, + "Connection": 46387, + "Ġmerchant": 46388, + "ĠENC": 46389, + "ĠRyu": 46390, + "ĠLymphoma": 46391, + "ĠLarry": 46392, + "Ġjaponicum": 46393, + "ĠSymbols": 46394, + "Lib": 46395, + "VG": 46396, + "ĠTav": 46397, + "ĠAssim": 46398, + "ĠLeung": 46399, + "dependency": 46400, + "largest": 46401, + "ĠDOE": 46402, + "Ġaligns": 46403, + "oflurane": 46404, + "ĠAdjusted": 46405, + "Ġpeculiarities": 46406, + "decrease": 46407, + "ĠPlacement": 46408, + "vig": 46409, + "zak": 46410, + "Ġpenta": 46411, + "Ġfres": 46412, + "Ġacros": 46413, + "Ġsolvability": 46414, + "ansions": 46415, + "ALA": 46416, + "Ġmalfunction": 46417, + "ĠGiovanni": 46418, + "AOR": 46419, + "Had": 46420, + "Ġporn": 46421, + "undice": 46422, + "ĠUi": 46423, + "Ġexpelled": 46424, + "ĠAnk": 46425, + "Ġdiscounting": 46426, + "ĠRegulating": 46427, + "astery": 46428, + "phenylethyl": 46429, + "Ġcastration": 46430, + "Ġerythromycin": 46431, + "Ġbifunctional": 46432, + "��": 46433, + "ĠAlgeria": 46434, + "mess": 46435, + "Ġwis": 46436, + "ĠTay": 46437, + "assumed": 46438, + "Ġescalation": 46439, + "Ġhydroper": 46440, + "Ġcallosum": 46441, + "Ġatomization": 46442, + "ĠSAW": 46443, + "Ġacetylcholinesterase": 46444, + "Ġsucceeds": 46445, + "Ġphysiotherapy": 46446, + "tro": 46447, + "Ġmason": 46448, + "ĠTMB": 46449, + "Ġphant": 46450, + "Ġadjusts": 46451, + "antha": 46452, + "ĠEisenstein": 46453, + "Ġshorthand": 46454, + "GABA": 46455, + "Ġprover": 46456, + "Ġpatrol": 46457, + "ĠModal": 46458, + "ollaries": 46459, + "ĠInterfacial": 46460, + "ĠCIA": 46461, + "attn": 46462, + "ĠCryptococcus": 46463, + "athecal": 46464, + "ĠFreshwater": 46465, + "Ġspectrogram": 46466, + "opidogrel": 46467, + "morphism": 46468, + "Ġrelapsing": 46469, + "Ġgeneralizable": 46470, + "ĠShale": 46471, + "ĠTransplant": 46472, + "contraction": 46473, + "URI": 46474, + "ĠPetrov": 46475, + "ĠSliding": 46476, + "Ġanteriorly": 46477, + "Ġquasilinear": 46478, + "Ġripples": 46479, + "ZP": 46480, + "bacterial": 46481, + "spr": 46482, + "animal": 46483, + "Ġreporters": 46484, + "ĠBSS": 46485, + "ĠDia": 46486, + "ĠRSC": 46487, + "ounding": 46488, + "ITHM": 46489, + "logical": 46490, + "Ġpolycarbonate": 46491, + "Animal": 46492, + "umbai": 46493, + "Ġarchived": 46494, + "ĠDurham": 46495, + "âĸĪ": 46496, + "ĠVermont": 46497, + "Ġpw": 46498, + "essen": 46499, + "Ġconstexpr": 46500, + "ĠPruss": 46501, + "Ġsharpness": 46502, + "divide": 46503, + "primitive": 46504, + "Ġacrylate": 46505, + "MYC": 46506, + "ĠMonday": 46507, + "ĠSrinivas": 46508, + "Born": 46509, + "attice": 46510, + "omorpha": 46511, + "ĠMERS": 46512, + "ĠFactory": 46513, + "ĠWN": 46514, + "rectile": 46515, + "Ġheats": 46516, + "UNK": 46517, + "Ġsynchronize": 46518, + "ĠAttenuation": 46519, + "Children": 46520, + "Pat": 46521, + "pregnant": 46522, + "Ġwished": 46523, + "Ġthawing": 46524, + "ĠBey": 46525, + "ĠDÃŃaz": 46526, + "Ġleather": 46527, + "ĠUnic": 46528, + "Ġspecialised": 46529, + "Ġcatalytically": 46530, + "PLGA": 46531, + "hydroxyethyl": 46532, + "Ġmagmas": 46533, + "Ġpronoun": 46534, + "Ġeutrophication": 46535, + "ĠWeekly": 46536, + "MHD": 46537, + "malloc": 46538, + "ecologic": 46539, + "ilo": 46540, + "ĠFrequencies": 46541, + "Ġorchestra": 46542, + "Ġmetabolomic": 46543, + "ĠBlockade": 46544, + "Ġasserted": 46545, + "ĠLewy": 46546, + "Ġalleviating": 46547, + "Ġocclusions": 46548, + "Ġchoroid": 46549, + "technical": 46550, + "Ġenvisioned": 46551, + "ĠHousing": 46552, + "Pn": 46553, + "ĠTECH": 46554, + "ĠSSH": 46555, + "ĠValle": 46556, + "ylmethyl": 46557, + "Ġphloem": 46558, + "ĠProjects": 46559, + "button": 46560, + "Ġaccelerometers": 46561, + "umni": 46562, + "ĠHandling": 46563, + "Ġvaso": 46564, + "permeable": 46565, + "Ġcords": 46566, + "ĠCf": 46567, + "ĠDz": 46568, + "Ġeditions": 46569, + "Ġhumerus": 46570, + "doors": 46571, + "Ġdorsolateral": 46572, + "Ġaptamers": 46573, + "Ġcommodities": 46574, + "osperms": 46575, + "Ġprednisone": 46576, + "IQ": 46577, + "Metal": 46578, + "tus": 46579, + "Ġisotopy": 46580, + "ĠTheater": 46581, + "iffi": 46582, + "Ġyarn": 46583, + "deletion": 46584, + "ĠQPO": 46585, + "Ġmultiobjective": 46586, + "Ġurchin": 46587, + "Ġpulsations": 46588, + "ĠSRP": 46589, + "ðtÃŀ": 46590, + "glucoside": 46591, + "Ġdepartures": 46592, + "PyObject": 46593, + "ĠBandwidth": 46594, + "ĠAcceptance": 46595, + "reys": 46596, + "ĠION": 46597, + "Ġcompuls": 46598, + "ĠJW": 46599, + "Ġparthen": 46600, + "Close": 46601, + "ĠBaTiO": 46602, + "ñoz": 46603, + "aggregate": 46604, + "Initially": 46605, + "qh": 46606, + "ĠCancers": 46607, + "opin": 46608, + "never": 46609, + "isman": 46610, + "Ġconstancy": 46611, + "Ġtrucks": 46612, + "Ġvisualisation": 46613, + "ĠIllness": 46614, + "Ġsulphide": 46615, + "ĠMetabolites": 46616, + "Ġoxysporum": 46617, + "HPP": 46618, + "Ġnoradrenaline": 46619, + "Ġcommutativity": 46620, + "Quad": 46621, + "NiO": 46622, + "ĠGetting": 46623, + "Ġbait": 46624, + "Ġë°": 46625, + "Ġmentally": 46626, + "Ġauroral": 46627, + "ĠDrawing": 46628, + "Sin": 46629, + "receiver": 46630, + "atov": 46631, + "isotope": 46632, + "Ġisothi": 46633, + "ĠSenes": 46634, + "ĠACO": 46635, + "ĠGCT": 46636, + "ysmal": 46637, + "ĠVog": 46638, + "Ġdistractors": 46639, + "Ġconnectedness": 46640, + "Ġaccumbens": 46641, + "äck": 46642, + "hydrated": 46643, + "Ġpharmacodynamic": 46644, + "Ġmineralogy": 46645, + "Ġarthropods": 46646, + "Ġmycotoxins": 46647, + "Ġbattles": 46648, + "ĠSara": 46649, + "ĠEIS": 46650, + "ĠWinn": 46651, + "Ġlimbic": 46652, + "WORK": 46653, + "Ž": 46654, + "Ġeaten": 46655, + "ĠTod": 46656, + "apillary": 46657, + "oxyp": 46658, + "ĠNewly": 46659, + "Ġcamel": 46660, + "arrison": 46661, + "ECTOR": 46662, + "Ġhopefully": 46663, + "ĠHurwitz": 46664, + "Ġibuprofen": 46665, + "ĠFIRST": 46666, + "Ġbistable": 46667, + "Ġdismissed": 46668, + "gat": 46669, + "inogen": 46670, + "ĠPON": 46671, + "phas": 46672, + "ĠKorn": 46673, + "Ġpolyaniline": 46674, + "ĠMicroscope": 46675, + "Ġmucous": 46676, + "Ġcollisionless": 46677, + "hydrogenase": 46678, + "Build": 46679, + "pairing": 46680, + "ĠWIMP": 46681, + "builtin": 46682, + "ĠSeparate": 46683, + "ĠCunningham": 46684, + "ĠNecessary": 46685, + "Ġbry": 46686, + "ecrosis": 46687, + "ĠLSS": 46688, + "Ġsyphilis": 46689, + "ĠVid": 46690, + "Ġcarrot": 46691, + "ĠResistant": 46692, + "registration": 46693, + "Ġmyopathy": 46694, + "Ġangry": 46695, + "MDR": 46696, + "Ġhypothesised": 46697, + "ĠVolterra": 46698, + "elevation": 46699, + "Ġmycobacteria": 46700, + "Ġcaudate": 46701, + "iidae": 46702, + "ĠÇ": 46703, + "ĠDich": 46704, + "ĠReth": 46705, + "ellus": 46706, + "chamber": 46707, + "shine": 46708, + "ochore": 46709, + "ĠColumns": 46710, + "COUNT": 46711, + "Ġïĥ²": 46712, + "ĠPrimordial": 46713, + "Ġnegotiations": 46714, + "stedt": 46715, + "RII": 46716, + "UES": 46717, + "tiques": 46718, + "ĠPfe": 46719, + "Ġplast": 46720, + "pron": 46721, + "ĠZw": 46722, + "inkler": 46723, + "Ġmetabolome": 46724, + "EGA": 46725, + "ĠSpectrophot": 46726, + "Ġubiquity": 46727, + "ĠElectrodes": 46728, + "Ġchondro": 46729, + "DomainIs": 46730, + "ĠResidues": 46731, + "ĠdnsDomainIs": 46732, + "DIC": 46733, + "pth": 46734, + "Ġaest": 46735, + "Ġcient": 46736, + "Ġpessim": 46737, + "Ġreinst": 46738, + "ĠSans": 46739, + "endazole": 46740, + "ĠUrine": 46741, + "Ġsubacute": 46742, + "iximab": 46743, + "Ġprofitable": 46744, + "Ġmaximise": 46745, + "ĠDelaware": 46746, + "Ġclinicopathologic": 46747, + "ThermoFisher": 46748, + "FAR": 46749, + "RAS": 46750, + "witch": 46751, + "inactivated": 46752, + "enesis": 46753, + "unless": 46754, + "ĠPanc": 46755, + "ĠMTS": 46756, + "ĠBast": 46757, + "Ġchilling": 46758, + "Ġincumbent": 46759, + "Ġjelly": 46760, + "Ġdistributive": 46761, + "Ġcyto": 46762, + "schen": 46763, + "Ġinducers": 46764, + "ĠNonequilibrium": 46765, + "ĠRobotics": 46766, + "ĠArgentine": 46767, + "Ġmeridian": 46768, + "Ġhunger": 46769, + "Adaptive": 46770, + "Ġgor": 46771, + "ilepsy": 46772, + "Ġnonvanishing": 46773, + "Ġpeti": 46774, + "ĠMetformin": 46775, + "Ġbiomaterial": 46776, + "Ġantennal": 46777, + "ĠAffective": 46778, + "ĠAquatic": 46779, + "enediamine": 46780, + "ĠSiberia": 46781, + "ĠPenicillium": 46782, + "Functions": 46783, + "Ġlec": 46784, + "Ġfeld": 46785, + "ĠSpart": 46786, + "ĠCement": 46787, + "addi": 46788, + "sek": 46789, + "ĠNp": 46790, + "olesky": 46791, + "ĠMacroscopic": 46792, + "ères": 46793, + "Ġcaveat": 46794, + "Ġcourtship": 46795, + "mice": 46796, + "Ġfence": 46797, + "Ġmined": 46798, + "ulink": 46799, + "IDA": 46800, + "Ġtruncate": 46801, + "ĠCatalan": 46802, + "Ġtranst": 46803, + "Ġamendments": 46804, + "uncertainty": 46805, + "Ġoropharyngeal": 46806, + "ĠAid": 46807, + "oulder": 46808, + "ĠIncident": 46809, + "ĠáIJ": 46810, + "angiogenesis": 46811, + "ĠBEH": 46812, + "Ġicosa": 46813, + "ĠFOXP": 46814, + "fragment": 46815, + "Ġscintillator": 46816, + "JO": 46817, + "Law": 46818, + "ĠpL": 46819, + "Ġetoposide": 46820, + "Ġpolyaden": 46821, + "Ġhabitual": 46822, + "Ġtaxi": 46823, + "Ġcumulant": 46824, + "Ġhindrance": 46825, + "trigger": 46826, + "ratios": 46827, + "ilio": 46828, + "ĠPIR": 46829, + "ĠTheod": 46830, + "ĠMorton": 46831, + "ĠHaf": 46832, + "ĠOch": 46833, + "ĠExo": 46834, + "Ġurtic": 46835, + "ĠCFRP": 46836, + "Screen": 46837, + "Slice": 46838, + "Ġmushrooms": 46839, + "Ġevanescent": 46840, + "Sx": 46841, + "ËIJ": 46842, + "ìŀ": 46843, + "Ġsigm": 46844, + "icl": 46845, + "Ġguests": 46846, + "ĠGIST": 46847, + "Ġdeformities": 46848, + "polyacrylamide": 46849, + "Significant": 46850, + "Ġimpressions": 46851, + "jmath": 46852, + "emoral": 46853, + "ĠBn": 46854, + "ĠHDR": 46855, + "ĠKeck": 46856, + "Ġvaline": 46857, + "spi": 46858, + "iterate": 46859, + "Ġsync": 46860, + "otiana": 46861, + "Interval": 46862, + "ĠBrauer": 46863, + "Ġsticky": 46864, + "ĠNeuroscience": 46865, + "Baxter": 46866, + "Ġcasts": 46867, + "allocation": 46868, + "neal": 46869, + "Ġbiop": 46870, + "Ġrestorations": 46871, + "Images": 46872, + "mitic": 46873, + "ĠElevation": 46874, + "Ġabstinence": 46875, + "ĠLesser": 46876, + "ĠRainfall": 46877, + "PAM": 46878, + "Wol": 46879, + "usch": 46880, + "Ġpromisc": 46881, + "naïve": 46882, + "Ġdeduc": 46883, + "accharide": 46884, + "Ġnominally": 46885, + "ĠExploratory": 46886, + "Ġreconciliation": 46887, + "linalg": 46888, + "TCR": 46889, + "Ġsore": 46890, + "ĠNab": 46891, + "Ġoutgroup": 46892, + "Ġmonophosphate": 46893, + "insu": 46894, + "ĠAddis": 46895, + "SPR": 46896, + "pointing": 46897, + "HERE": 46898, + "ĠTechnological": 46899, + "Ġcochlea": 46900, + "Ġspheroidal": 46901, + "ĠBaldwin": 46902, + "Feed": 46903, + "Ġfusing": 46904, + "Ġasper": 46905, + "Ġexosomal": 46906, + "ĠLinguistic": 46907, + "SCA": 46908, + "ĠEmpty": 46909, + "Ġvacant": 46910, + "glycol": 46911, + "immunoprecipitation": 46912, + "ĠITER": 46913, + "SnO": 46914, + "patterns": 46915, + "continental": 46916, + "ĠAccelerating": 46917, + "ĠAveraging": 46918, + "Ġchemoattractant": 46919, + "hb": 46920, + "sulph": 46921, + "ĠBx": 46922, + "Ġcomplicating": 46923, + "ĠWare": 46924, + "Ġsoaking": 46925, + "Ġupregulate": 46926, + "---------": 46927, + "Ġsemester": 46928, + "ĠBrod": 46929, + "Ġcascading": 46930, + "ĠCastell": 46931, + "Ġẽ": 46932, + "ĠEQUATIONS": 46933, + "Ġparsimonious": 46934, + "Ġsorbent": 46935, + "Ġeug": 46936, + "odin": 46937, + "ĠWig": 46938, + "ĠThir": 46939, + "Ġsolv": 46940, + "Ġcarboplatin": 46941, + "Ġzebra": 46942, + "venient": 46943, + "ĠmedRxiv": 46944, + "Ġautobi": 46945, + "Ġrepeatable": 46946, + "Ġmigrations": 46947, + "Ġд": 46948, + "holonomic": 46949, + "Ġmoderator": 46950, + "Ġchimera": 46951, + "ĠGrassmannian": 46952, + "ĠRonald": 46953, + "ĠVega": 46954, + "astes": 46955, + "Ġquotes": 46956, + "Ġmonic": 46957, + "Ġprecoding": 46958, + "ĠAssisted": 46959, + "ĠNetworking": 46960, + "Ġfabricating": 46961, + "Ġbotanical": 46962, + "Ġswarms": 46963, + "Ġmartensitic": 46964, + "elliptic": 46965, + "pherd": 46966, + "baryon": 46967, + "xfe": 46968, + "route": 46969, + "ĠFIL": 46970, + "opies": 46971, + "ĠPCBs": 46972, + "Ġerasure": 46973, + "ĠRemodeling": 46974, + "Ġanaer": 46975, + "Smad": 46976, + "injured": 46977, + "Ġimmunocompetent": 46978, + "dell": 46979, + "failed": 46980, + "Ġsinking": 46981, + "oracic": 46982, + "Ġdred": 46983, + "ĠVDR": 46984, + "Ġconnectors": 46985, + "Ġintratumoral": 46986, + "Ġcommutators": 46987, + "ĠAleks": 46988, + "ĠDicty": 46989, + "Ak": 46990, + "Ġrecalc": 46991, + "Ġisl": 46992, + "otrim": 46993, + "ncephal": 46994, + "ĠRees": 46995, + "Ġsteatohepatitis": 46996, + "ĠPolarized": 46997, + "SBATCH": 46998, + "ĠCrossing": 46999, + "Accuracy": 47000, + "ĠGiardia": 47001, + "ĠNovo": 47002, + "Ġvigilance": 47003, + "Ġphosphatidylcholine": 47004, + "ĠUEFA": 47005, + "Jim": 47006, + "Ġfasted": 47007, + "ĠTiny": 47008, + "Ġlang": 47009, + "issociation": 47010, + "Auto": 47011, + "ĠNorfolk": 47012, + "ĠArms": 47013, + "ĠSWI": 47014, + "ĠAmbros": 47015, + "transfection": 47016, + "Oryza": 47017, + "harm": 47018, + "ĠDs": 47019, + "Ġintrag": 47020, + "Ġcaller": 47021, + "Ġwritings": 47022, + "ĠElast": 47023, + "ĠMarvel": 47024, + "ĠImmunodeficiency": 47025, + "ĠMillion": 47026, + "Texture": 47027, + "ĠIceCube": 47028, + "snap": 47029, + "Ġenjoys": 47030, + "ĠChapel": 47031, + "ĠEstablishing": 47032, + "Actually": 47033, + "Ġphosphorylates": 47034, + "Ġchinensis": 47035, + "Ġrhabdomy": 47036, + "Ġemphysema": 47037, + "Middle": 47038, + "nant": 47039, + "Ñħ": 47040, + "Ġtart": 47041, + "lowest": 47042, + "hemia": 47043, + "Ġutilising": 47044, + "constit": 47045, + "Ġmagmatism": 47046, + "оÑĢ": 47047, + "ĠHasan": 47048, + "dispersed": 47049, + "Hear": 47050, + "Qt": 47051, + "zations": 47052, + "alon": 47053, + "ĠStau": 47054, + "ĠAmer": 47055, + "osystems": 47056, + "Ġdemarc": 47057, + "ĠNeoproterozoic": 47058, + "ĠMek": 47059, + "ĠDisclosure": 47060, + "Ġhematocrit": 47061, + "ĠCytoscape": 47062, + "Ġramification": 47063, + "Ġcommunicative": 47064, + "Ġbutterflies": 47065, + "Ġantisera": 47066, + "Ġaestivum": 47067, + "Bra": 47068, + "LTP": 47069, + "socket": 47070, + "ĠCherenkov": 47071, + "Ġchlam": 47072, + "angial": 47073, + "ultured": 47074, + "enged": 47075, + "ĠClinton": 47076, + "Ġmyoblasts": 47077, + "ĠCompensation": 47078, + "ymmetrically": 47079, + "Ġemployer": 47080, + "ozol": 47081, + "ĠSAXS": 47082, + "Ġretinas": 47083, + "piperidine": 47084, + "XYZ": 47085, + "ĠRoughly": 47086, + "Prep": 47087, + "Ġbinge": 47088, + "Ġerect": 47089, + "ĠOPER": 47090, + "Ġstressor": 47091, + "Christ": 47092, + "ĠPDZ": 47093, + "Ġsubstan": 47094, + "ĠSnail": 47095, + "Ġlamellae": 47096, + "ĠCycling": 47097, + "shifting": 47098, + "ĠHsieh": 47099, + "verify": 47100, + "Ġpreimage": 47101, + "Ġartillery": 47102, + "Ġepil": 47103, + "ĠApost": 47104, + "Ġhelmet": 47105, + "Ġmachined": 47106, + "ĠMinneapolis": 47107, + "ĠCryp": 47108, + "Ġsituational": 47109, + "passing": 47110, + "quinazolin": 47111, + "ĠCroatian": 47112, + "Ġstaircase": 47113, + "Bonnet": 47114, + "NLP": 47115, + "cium": 47116, + "Ġskeletons": 47117, + "Ġoxim": 47118, + "orib": 47119, + "Ġreticular": 47120, + "ĠSLS": 47121, + "ĠAromatic": 47122, + "ĠKes": 47123, + "Ġphor": 47124, + "Ġinvocation": 47125, + "Ġdozens": 47126, + "aively": 47127, + "Ġdetectability": 47128, + "Ġconcerted": 47129, + "yrins": 47130, + "ĠProcessor": 47131, + "Ġtolerable": 47132, + "attached": 47133, + "Ġannexin": 47134, + "ĠROSAT": 47135, + "ĠAlternate": 47136, + "ĠWavelength": 47137, + "ĠWillis": 47138, + "Ġsemicontinuous": 47139, + "Ġadvocacy": 47140, + "Ġobligation": 47141, + "chanter": 47142, + "ĠInsertion": 47143, + "Ġsymbiont": 47144, + "ZM": 47145, + "Ġtars": 47146, + "rof": 47147, + "Ġrevival": 47148, + "ĠTST": 47149, + "ĠEMP": 47150, + "Ġmex": 47151, + "ullin": 47152, + "ĠAdop": 47153, + "ĠDNAs": 47154, + "Ġemployers": 47155, + "MTs": 47156, + "ĠMartÃŃn": 47157, + "electrodes": 47158, + "ĠMedicaid": 47159, + "Ġtgt": 47160, + "Ġlognormal": 47161, + "ĠFrames": 47162, + "Ġpermissive": 47163, + "ĠArduino": 47164, + "Ġsemilinear": 47165, + "ĠAssign": 47166, + "ĠPrEP": 47167, + "ĠSiamese": 47168, + "benzimidazol": 47169, + "connectivity": 47170, + "ĠPEI": 47171, + "Ġbisulfite": 47172, + "Ġacetyltransferase": 47173, + "Ġswimmer": 47174, + "juven": 47175, + "Ġjejunum": 47176, + "ĠCincinnati": 47177, + "tai": 47178, + "ĠQI": 47179, + "ĠCommut": 47180, + "spacing": 47181, + "Ġaffords": 47182, + "itisation": 47183, + "elasticity": 47184, + "Ġdragon": 47185, + "Ġproteasomal": 47186, + "Ġpant": 47187, + "ĠNitro": 47188, + "Ġspic": 47189, + "Ġnanopl": 47190, + "ĠAllied": 47191, + "Ġthorax": 47192, + "ĠFTO": 47193, + "ĠJurkat": 47194, + "chiatry": 47195, + "young": 47196, + "directions": 47197, + "Ġneocortex": 47198, + "ĠKik": 47199, + "ango": 47200, + "clay": 47201, + "iodo": 47202, + "Ġabovementioned": 47203, + "ĠGuardian": 47204, + "Conjecture": 47205, + "ĠTrend": 47206, + "Ġfertilized": 47207, + "ĠSulfate": 47208, + "ochronology": 47209, + "Ġcraniofacial": 47210, + "ĠSaskatchewan": 47211, + "QQ": 47212, + "hman": 47213, + "Ġzym": 47214, + "logs": 47215, + "Ġïģ®": 47216, + "Ġgraduating": 47217, + "pinene": 47218, + "ĠîĢ": 47219, + "Ġetiological": 47220, + "ĠComprehension": 47221, + "Ġwandering": 47222, + "Ġlan": 47223, + "Ġsyst": 47224, + "returns": 47225, + "MOF": 47226, + "choalveolar": 47227, + "ĠArmen": 47228, + "Ġbimetallic": 47229, + "ĠPollen": 47230, + "Files": 47231, + "Ġssp": 47232, + "ENSI": 47233, + "ĠYus": 47234, + "Ġfinest": 47235, + "AGEN": 47236, + "Ġmicrobiomes": 47237, + "Ġpalind": 47238, + "Ġpetals": 47239, + "ĠRadiotherapy": 47240, + "ophenone": 47241, + "speaker": 47242, + "Ġcopepods": 47243, + "Ġkanamycin": 47244, + "Ġdegranulation": 47245, + "Construct": 47246, + "alter": 47247, + "ĠFgf": 47248, + "ĠNBS": 47249, + "ĠIncomplete": 47250, + "Ġparcel": 47251, + "neau": 47252, + "ĠÃIJ": 47253, + "ĠCHA": 47254, + "Ġduals": 47255, + "Ġsilicates": 47256, + "ĠGlobally": 47257, + "Ġkinesin": 47258, + "fid": 47259, + "ĠCPD": 47260, + "ĠYad": 47261, + "Ġdepress": 47262, + "ODY": 47263, + "ĠHistograms": 47264, + "ĠSummarization": 47265, + "automatic": 47266, + "ĠDomin": 47267, + "otransformation": 47268, + "Ġventricles": 47269, + "Widget": 47270, + "ĠPetersburg": 47271, + "Ġcholangiocarcinoma": 47272, + "Ġnectar": 47273, + "PIC": 47274, + "Scope": 47275, + "Tek": 47276, + "nitz": 47277, + "ĠPHD": 47278, + "Ġspiro": 47279, + "ĠCOG": 47280, + "ĠDioxide": 47281, + "conductivity": 47282, + "ĠGranger": 47283, + "ĠWearable": 47284, + "ĠKenneth": 47285, + "CCR": 47286, + "LINK": 47287, + "ĠÜ": 47288, + "retic": 47289, + "lya": 47290, + "Ġdemocratic": 47291, + "Ġradiograph": 47292, + "ĠRelax": 47293, + "ĠIncubation": 47294, + "ĠDenoising": 47295, + "COLOR": 47296, + "ĠClosure": 47297, + "HMM": 47298, + "urd": 47299, + "rada": 47300, + "ĠRv": 47301, + "ĠLuz": 47302, + "alls": 47303, + "Ġmultispectral": 47304, + "INED": 47305, + "SCN": 47306, + "Ġdyslexia": 47307, + "Ġsettlers": 47308, + "ĠVLSI": 47309, + "Ġavid": 47310, + "Ġlarynx": 47311, + "ĠChess": 47312, + "ĠFAA": 47313, + "Ġdefender": 47314, + "Ġlipolysis": 47315, + "ĠElmer": 47316, + "ĠAffymetrix": 47317, + "Ġrhodamine": 47318, + "Morph": 47319, + "Site": 47320, + "purity": 47321, + "ĠÊ": 47322, + "ĠTank": 47323, + "ĠMiao": 47324, + "Ġrecrystall": 47325, + "Weyl": 47326, + "ĠGuil": 47327, + "Ġmisfolded": 47328, + "suited": 47329, + "ĠApproximations": 47330, + "ĠABCB": 47331, + "donor": 47332, + "GWAS": 47333, + "---------------": 47334, + "Ġputida": 47335, + "Ġimpingement": 47336, + "yaml": 47337, + "Hill": 47338, + "Ġtl": 47339, + "agua": 47340, + "timing": 47341, + "Ġregenerate": 47342, + "Ġmultilingual": 47343, + "rador": 47344, + "classifier": 47345, + "ĠJohansson": 47346, + "Ġsulfides": 47347, + "hammer": 47348, + "Ġwalked": 47349, + "Ġallocating": 47350, + "ĠGustav": 47351, + "Ġimmunoprecipitated": 47352, + "ĠBrisbane": 47353, + "Ġsandwiched": 47354, + "ĠChatterjee": 47355, + "omandibular": 47356, + "Ġosc": 47357, + "Ġassass": 47358, + "Ġmultistage": 47359, + "Ġmultipartite": 47360, + "Ġpigmented": 47361, + "ĠVisualizing": 47362, + "Keys": 47363, + "pipeline": 47364, + "Ġdubbed": 47365, + "Ġcroc": 47366, + "ĠDLC": 47367, + "ĠRAT": 47368, + "ĠNex": 47369, + "plica": 47370, + "tingham": 47371, + "ĠSpider": 47372, + "Ġuncle": 47373, + "auts": 47374, + "ĠHowe": 47375, + "Ġarthropod": 47376, + "ĠPapad": 47377, + "urgy": 47378, + "Ġacclim": 47379, + "Broad": 47380, + "acer": 47381, + "vez": 47382, + "ĠDivers": 47383, + "Ġmodifiable": 47384, + "Ġantipsychotics": 47385, + "Prog": 47386, + "osahexa": 47387, + "ambrian": 47388, + "ĠIonization": 47389, + "ZA": 47390, + "oate": 47391, + "Ġpays": 47392, + "Ġewes": 47393, + "Ġbeaches": 47394, + "Ġevil": 47395, + "ĠCDs": 47396, + "naud": 47397, + "Ġconformity": 47398, + "ĠDMN": 47399, + "Ġcollaborate": 47400, + "Ġdeteriorate": 47401, + "VALID": 47402, + "ĠVegas": 47403, + "Ġultracent": 47404, + "BRA": 47405, + "Rub": 47406, + "YC": 47407, + "fh": 47408, + "åľ": 47409, + "ĠOWL": 47410, + "oseismic": 47411, + "oferrin": 47412, + "ochthon": 47413, + "ĠTNFR": 47414, + "smallsetminus": 47415, + "ĠArgument": 47416, + "Ġgranulocytes": 47417, + "Ġramified": 47418, + "Ġepiphy": 47419, + "fusc": 47420, + "ecdot": 47421, + "Ġhw": 47422, + "ĠNMS": 47423, + "ercus": 47424, + "Ġtether": 47425, + "ĠTrait": 47426, + "AgCl": 47427, + "ĠNearby": 47428, + "Ġhelminth": 47429, + "Ġlaevis": 47430, + "ĠBAR": 47431, + "ĠNancy": 47432, + "ĠGyn": 47433, + "Ġsecreting": 47434, + "Stellar": 47435, + "Ġsilhou": 47436, + "IMT": 47437, + "Ġscaffolding": 47438, + "ĠConverter": 47439, + "hid": 47440, + "Ġnud": 47441, + "estrian": 47442, + "anno": 47443, + "Ġdepiction": 47444, + "oremost": 47445, + "ĠShand": 47446, + "ABCD": 47447, + "ĠPDL": 47448, + "Ġdysphagia": 47449, + "Ġintrat": 47450, + "Ġhemip": 47451, + "Ġadaptable": 47452, + "longmapsto": 47453, + "ssbauer": 47454, + "ĠMcCarthy": 47455, + "ĠAutoimmune": 47456, + "ĠCutaneous": 47457, + "Inserting": 47458, + "Material": 47459, + "ĠAa": 47460, + "ĠGav": 47461, + "Ġmonocular": 47462, + "equil": 47463, + "ĠGeoff": 47464, + "Ġtethered": 47465, + "obilized": 47466, + "ĠShortly": 47467, + "Details": 47468, + "Ġrefugee": 47469, + "Ġabscisic": 47470, + "FBQyx": 47471, + "Ġdemocracy": 47472, + "crafted": 47473, + "difluor": 47474, + "yder": 47475, + "essment": 47476, + "Ġhistopathologic": 47477, + "Ġastrocytic": 47478, + "Ġwithdrew": 47479, + "Ġmoles": 47480, + "athic": 47481, + "mono": 47482, + "manual": 47483, + "Ġfoodborne": 47484, + "ĠRepository": 47485, + "Ġcovert": 47486, + "OTE": 47487, + "Ġtightness": 47488, + "Ġinstantiated": 47489, + "Ġwatermarking": 47490, + "Ġartemisinin": 47491, + "Language": 47492, + "OES": 47493, + "cant": 47494, + "already": 47495, + "unts": 47496, + "itia": 47497, + "ĠKaren": 47498, + "Ġalluvial": 47499, + "stratigraphy": 47500, + "ĠPIV": 47501, + "ĠFaces": 47502, + "ĠBim": 47503, + "applications": 47504, + "tails": 47505, + "Ġeld": 47506, + "IRB": 47507, + "ĠINTE": 47508, + "ĠNotImplemented": 47509, + "Ġmisclassified": 47510, + "Ġfertilizers": 47511, + "ĠElectricity": 47512, + "Ġtributaries": 47513, + "ĠDeutsch": 47514, + "Ġsleeve": 47515, + "fuzzy": 47516, + "ĠMTL": 47517, + "ĠBres": 47518, + "ĠWyn": 47519, + "Ġkyr": 47520, + "neuronal": 47521, + "oxymethyl": 47522, + "disorder": 47523, + "inches": 47524, + "ramidal": 47525, + "Ġpolyimide": 47526, + "ResNet": 47527, + "ĠEdmund": 47528, + "Ġdegeneracies": 47529, + "utherford": 47530, + "Dropout": 47531, + "ijĢ": 47532, + "Ġvoiced": 47533, + "ĠGomes": 47534, + "ivities": 47535, + "conductance": 47536, + "compl": 47537, + "vecs": 47538, + "Ġtuna": 47539, + "ĠKinect": 47540, + "Ġconveyed": 47541, + "Ġsphingosine": 47542, + "bat": 47543, + "ĠPurs": 47544, + "ounded": 47545, + "ĠStam": 47546, + "ĠXIII": 47547, + "ĠComics": 47548, + "MSM": 47549, + "SSL": 47550, + "Ġperfluor": 47551, + "Ġfluorinated": 47552, + "folios": 47553, + "Ġreposition": 47554, + "ĠSerr": 47555, + "ĠCors": 47556, + "ĠLabs": 47557, + "Ġcox": 47558, + "ĠAcquired": 47559, + "Ġreasoned": 47560, + "Genome": 47561, + "ĠPiper": 47562, + "Ġcompactified": 47563, + "Ġherbivore": 47564, + "lofenac": 47565, + "Ġboss": 47566, + "ĠBs": 47567, + "ĠEMR": 47568, + "Ġshoe": 47569, + "Ġcarers": 47570, + "Chrom": 47571, + "SVP": 47572, + "ĠTriangle": 47573, + "Ġhematite": 47574, + "dorf": 47575, + "ĠMovements": 47576, + "ĠVesicles": 47577, + "Olympus": 47578, + "Mol": 47579, + "Ġlend": 47580, + "uras": 47581, + "ĠASE": 47582, + "ĠWKB": 47583, + "proved": 47584, + "ĠKV": 47585, + "ĠUART": 47586, + "logarithmic": 47587, + "ĠADI": 47588, + "ĠDoing": 47589, + "Ġcease": 47590, + "Ġlengthening": 47591, + "Ġpyrophosphate": 47592, + "Fre": 47593, + "ĠCLD": 47594, + "ĠMLS": 47595, + "ĠPlum": 47596, + "Ġpropionate": 47597, + "ĠGuatem": 47598, + "CKD": 47599, + "Ġisos": 47600, + "ĠManning": 47601, + "neuro": 47602, + "OPER": 47603, + "ĠWilhelm": 47604, + "Ġacademia": 47605, + "AChR": 47606, + "ĠInertial": 47607, + "Occ": 47608, + "ujan": 47609, + "onas": 47610, + "Ġinulin": 47611, + "icia": 47612, + "andal": 47613, + "ĠKahn": 47614, + "Ġunmanned": 47615, + "ĠCoarse": 47616, + "Ġguilty": 47617, + "ĠPei": 47618, + "ĠLuca": 47619, + "ĠFibroblast": 47620, + "avian": 47621, + "vx": 47622, + "Ġdizziness": 47623, + "ĠDox": 47624, + "ĠHour": 47625, + "Ġdecoration": 47626, + "Ġverifier": 47627, + "rado": 47628, + "Ġfootprints": 47629, + "Ġdispensable": 47630, + "ĠAnaerobic": 47631, + "IoT": 47632, + "ĠRisks": 47633, + "ĠGLS": 47634, + "Ġchords": 47635, + "oidy": 47636, + "Ġneurolog": 47637, + "ruh": 47638, + "Ġvirtualization": 47639, + "Ġprotonation": 47640, + "ĠConstantin": 47641, + "Ġkeypoints": 47642, + "Buck": 47643, + "Hopf": 47644, + "Much": 47645, + "regime": 47646, + "Ġpromised": 47647, + "aij": 47648, + "ĠDesulf": 47649, + "ĠFormulas": 47650, + "Ġhump": 47651, + "lnc": 47652, + "ĠSuicide": 47653, + "ĠHOMA": 47654, + "oglycer": 47655, + "ĠProteomics": 47656, + "Ġdictate": 47657, + "ĠSpermat": 47658, + "Fun": 47659, + "Ġsag": 47660, + "ĠFam": 47661, + "eppe": 47662, + "ĠJah": 47663, + "Ġarisen": 47664, + "opharmaceutical": 47665, + "SAGE": 47666, + "ĠTHIS": 47667, + "enhance": 47668, + "Ġnapus": 47669, + "roe": 47670, + "ensch": 47671, + "deformation": 47672, + "bones": 47673, + "ĠErnest": 47674, + "irability": 47675, + "decom": 47676, + "Ġcrustaceans": 47677, + "Ġguaranteeing": 47678, + "OVAs": 47679, + "ĠMulticenter": 47680, + "ĠctDNA": 47681, + "Ġforaminifera": 47682, + "Linn": 47683, + "Ġcups": 47684, + "esch": 47685, + "ĠdF": 47686, + "ĠTah": 47687, + "pll": 47688, + "projects": 47689, + "ĠUCI": 47690, + "Ġhumanized": 47691, + "Ġabsl": 47692, + "ĠScho": 47693, + "Ġliterals": 47694, + "ĠSVR": 47695, + "Ġtoxicology": 47696, + "pgf": 47697, + "ĠIPTG": 47698, + "ĠMEASUREM": 47699, + "oing": 47700, + "ĠPasc": 47701, + "ĠBau": 47702, + "ĠWannier": 47703, + "Ġhypre": 47704, + "attributes": 47705, + "Ġpreconditioner": 47706, + "Writing": 47707, + "Ġgypsum": 47708, + "yuan": 47709, + "Ġupregulates": 47710, + "Ġtelec": 47711, + "ĠDiscre": 47712, + "guard": 47713, + "Ġdebates": 47714, + "Ġparasitoid": 47715, + "Lam": 47716, + "tige": 47717, + "Ġisopropanol": 47718, + "ĠIwas": 47719, + "plify": 47720, + "indolin": 47721, + "ĠApollo": 47722, + "Ġlanded": 47723, + "Ġbeamline": 47724, + "Union": 47725, + "Ġreciproc": 47726, + "ĠRossby": 47727, + "principal": 47728, + "Ġdescendant": 47729, + "ĠAnalogously": 47730, + "Ġderegulation": 47731, + "DSM": 47732, + "cta": 47733, + "Ġrebuilt": 47734, + "ĠMund": 47735, + "ĠFEC": 47736, + "ryn": 47737, + "plice": 47738, + "ĠYugoslav": 47739, + "ĠNorthwestern": 47740, + "ĠHomogen": 47741, + "ĠLISA": 47742, + "Ġinvestor": 47743, + "HSA": 47744, + "HPO": 47745, + "Ġdictionaries": 47746, + "ĠCategor": 47747, + "Ġcompacted": 47748, + "tilled": 47749, + "ç»": 47750, + "Ġfines": 47751, + "urans": 47752, + "Ġbetweenness": 47753, + "ĠZig": 47754, + "schema": 47755, + "Ġcommune": 47756, + "ĠQuinn": 47757, + "Ġanaphylaxis": 47758, + "TIES": 47759, + "Ġsnowpack": 47760, + "ĠDOA": 47761, + "agos": 47762, + "ĠOdd": 47763, + "arde": 47764, + "Ġevoke": 47765, + "ĠOcular": 47766, + "Ġfaulting": 47767, + "Ġvolcanism": 47768, + "ĠPaleozoic": 47769, + "Ġmycelium": 47770, + "ĠAdjustment": 47771, + "ICT": 47772, + "Nov": 47773, + "alias": 47774, + "ĠTul": 47775, + "ĠHh": 47776, + "Ġevade": 47777, + "ORs": 47778, + "Ġstrengthens": 47779, + "ĠUSGS": 47780, + "Ġlicensing": 47781, + "ĠClement": 47782, + "ĠPhytophthora": 47783, + "rified": 47784, + "Ġeighteen": 47785, + "Ġtops": 47786, + "ĠCLP": 47787, + "Ġstabilities": 47788, + "ĠPPT": 47789, + "ĠBIN": 47790, + "ĠRak": 47791, + "Ġgenistein": 47792, + "volve": 47793, + "Ġquicker": 47794, + "ĠCaused": 47795, + "benefit": 47796, + "YB": 47797, + "lift": 47798, + "Ġhood": 47799, + "ĠSCs": 47800, + "ofa": 47801, + "ĠMicron": 47802, + "angiotensin": 47803, + "Ġfeathers": 47804, + "Ġantiferromagnet": 47805, + "DECREF": 47806, + "yledons": 47807, + "Ġmyriad": 47808, + "Ġiz": 47809, + "ĠTrough": 47810, + "âĪ«": 47811, + "hemoglobin": 47812, + "ĠEnvelope": 47813, + "ĠClick": 47814, + "soliton": 47815, + "ĠSynchrotron": 47816, + "Ġlagged": 47817, + "MYB": 47818, + "Ġtrophoblast": 47819, + "Ġinterrogation": 47820, + "onvuls": 47821, + "Bac": 47822, + "Ġaperiodic": 47823, + "Ġgpu": 47824, + "Ġpropidium": 47825, + "teps": 47826, + "ĠKarp": 47827, + "ĠVaz": 47828, + "ackage": 47829, + "onson": 47830, + "Instr": 47831, + "filer": 47832, + "rifugation": 47833, + "KOV": 47834, + "fourth": 47835, + "Ġôı¼IJ": 47836, + "hyperbolic": 47837, + "schetz": 47838, + "Discussion": 47839, + "ĠOriented": 47840, + "jad": 47841, + "Ġauctions": 47842, + "usivity": 47843, + "ĠCran": 47844, + "Ġkd": 47845, + "Ġintest": 47846, + "rosarcoma": 47847, + "ugger": 47848, + "ĠILP": 47849, + "ĠSTA": 47850, + "Ġreversals": 47851, + "Ġgrapes": 47852, + "ĠPopulus": 47853, + "ĠKitaev": 47854, + "ĠAVP": 47855, + "Previously": 47856, + "Ġquadratically": 47857, + "ĠLOCAL": 47858, + "Bert": 47859, + "PED": 47860, + "live": 47861, + "à¬": 47862, + "Ġbidding": 47863, + "Ġtoss": 47864, + "ento": 47865, + "Ġthylak": 47866, + "Ġcomprehend": 47867, + "Ġdive": 47868, + "Ġapplicants": 47869, + "ĠÄħ": 47870, + "ĠVolcanic": 47871, + "adaptation": 47872, + "Ġá¹Ģ": 47873, + "ĠJanssen": 47874, + "Ġadjoining": 47875, + "ozolomide": 47876, + "CIS": 47877, + "dC": 47878, + "ducted": 47879, + "ĠAnast": 47880, + "ĠEmployment": 47881, + "ĠEndocrine": 47882, + "siloxane": 47883, + "Session": 47884, + "ĠNarr": 47885, + "ĠâĪĴâĪĨ": 47886, + "deev": 47887, + "othiaz": 47888, + "ringing": 47889, + "pointed": 47890, + "Ġacetylene": 47891, + "Ġglobulin": 47892, + "packing": 47893, + "ĠUses": 47894, + "AES": 47895, + "Hen": 47896, + "ĠSavage": 47897, + "ĠCanc": 47898, + "isto": 47899, + "ĠChromosomal": 47900, + "Ġcemented": 47901, + "Ġpyrox": 47902, + "ĠConstitutive": 47903, + "Ġphthalate": 47904, + "mechanism": 47905, + "Ġcyclosporine": 47906, + "PAP": 47907, + "arted": 47908, + "ĠRDT": 47909, + "Ġplains": 47910, + "Clone": 47911, + "propanol": 47912, + "regularity": 47913, + "Ġcotangent": 47914, + "ĠLeslie": 47915, + "ĠNitrate": 47916, + "ĠKawasaki": 47917, + "ĠPageRank": 47918, + "Ġanhydrase": 47919, + "ĠKrishna": 47920, + "Ġhemicellulose": 47921, + "Ġery": 47922, + "llis": 47923, + "Ġmicrogram": 47924, + "ĠDeligne": 47925, + "Ġenforces": 47926, + "Ġthrombolysis": 47927, + "Parse": 47928, + "orvastatin": 47929, + "Ġmated": 47930, + "ĠCrystalline": 47931, + "Ġautoradi": 47932, + "Ġthermophilic": 47933, + "infectious": 47934, + "Ġultram": 47935, + "ĠMLL": 47936, + "ĠFibers": 47937, + "Ġulceration": 47938, + "omedial": 47939, + "stratigraphic": 47940, + "Ġtouches": 47941, + "rhe": 47942, + "Ġtame": 47943, + "ĠCulic": 47944, + "ARDS": 47945, + "chter": 47946, + "Ġcounterclockwise": 47947, + "Ġcamps": 47948, + "VDC": 47949, + "Ġmethadone": 47950, + "dependently": 47951, + "validate": 47952, + "Ġprecludes": 47953, + "Ġparliamentary": 47954, + "ĠINTEREST": 47955, + "ĠSerg": 47956, + "ĠCBC": 47957, + "erella": 47958, + "ayi": 47959, + "ĠRAB": 47960, + "Ġchym": 47961, + "Ġnanospheres": 47962, + "Ġdiabetics": 47963, + "conservation": 47964, + "Ġpermeate": 47965, + "plotted": 47966, + "Ġnaphthalene": 47967, + "ĠBonn": 47968, + "ĠElectrostatic": 47969, + "Ġinventories": 47970, + "Gaussianity": 47971, + "ĠAdenosine": 47972, + "Delay": 47973, + "ĠBeginning": 47974, + "Ġsided": 47975, + "ĠCushing": 47976, + "ĠHv": 47977, + "Ġcoined": 47978, + "ĠAlm": 47979, + "scanning": 47980, + "fertil": 47981, + "Ġαv": 47982, + "ĠReactivity": 47983, + "Ġproximate": 47984, + "dependencies": 47985, + "Ġdensification": 47986, + "Ġôı¼ij": 47987, + "Ġbacteriocin": 47988, + "weakly": 47989, + "Ġdentistry": 47990, + "ĠOriental": 47991, + "Ġdormant": 47992, + "ĠpC": 47993, + "Ġmum": 47994, + "REs": 47995, + "Ġconval": 47996, + "Ġbiota": 47997, + "Ġmultilinear": 47998, + "ĠPTFE": 47999, + "Ġnarrowband": 48000, + "ĠRotational": 48001, + "Ġhoneybee": 48002, + "ĠChlorophyll": 48003, + "Baseline": 48004, + "Fern": 48005, + "Ġlk": 48006, + "ĠMash": 48007, + "rived": 48008, + "ĠBases": 48009, + "ĠDah": 48010, + "ĠKui": 48011, + "ĠÃĵ": 48012, + "ĠRecycl": 48013, + "AGN": 48014, + "PDE": 48015, + "Ġclimatological": 48016, + "ĠBasically": 48017, + "conserved": 48018, + "absorbing": 48019, + "ĠKoszul": 48020, + "oussines": 48021, + "Ġmdx": 48022, + "ithymia": 48023, + "ĠHinton": 48024, + "Ġkh": 48025, + "Ġadmittance": 48026, + "ĠVy": 48027, + "Ġextrema": 48028, + "Ġcreftype": 48029, + "subst": 48030, + "Ġbleomycin": 48031, + "LINEAR": 48032, + "AQ": 48033, + "iom": 48034, + "Ġnong": 48035, + "opian": 48036, + "sein": 48037, + "udal": 48038, + "Ġearning": 48039, + "Ġstandardize": 48040, + "ĠParticular": 48041, + "Ġwavevector": 48042, + "dxdy": 48043, + "ĠMacDonald": 48044, + "ĠEstuary": 48045, + "validated": 48046, + "ĠHurst": 48047, + "ĠMukherjee": 48048, + "Ġbivalves": 48049, + "Ġjugular": 48050, + "Ub": 48051, + "vill": 48052, + "enough": 48053, + "Ġinforms": 48054, + "anatomical": 48055, + "ulou": 48056, + "resa": 48057, + "ĠPMC": 48058, + "ĠMira": 48059, + "ĠRPL": 48060, + "ĠSDC": 48061, + "Ġhemi": 48062, + "MoS": 48063, + "ĠFloat": 48064, + "Ġocclusal": 48065, + "ĠRainbow": 48066, + "ĠProviding": 48067, + "Ġsupercapacitor": 48068, + "osf": 48069, + "ĠIRT": 48070, + "Ġadm": 48071, + "Ġdecoders": 48072, + "ĠXR": 48073, + "ĠRescue": 48074, + "Ġentom": 48075, + "Ġmortal": 48076, + "Angle": 48077, + "India": 48078, + "ĠMali": 48079, + "Ġinspecting": 48080, + "ĠGALAXY": 48081, + "ĠEriks": 48082, + "YF": 48083, + "rings": 48084, + "Ġsir": 48085, + "Ġgsl": 48086, + "ĠBubble": 48087, + "ĠDCA": 48088, + "ĠWidespread": 48089, + "assignment": 48090, + "Ġgeomorph": 48091, + "ĠPreference": 48092, + "COPD": 48093, + "processors": 48094, + "cutoff": 48095, + "ĠFlower": 48096, + "phenomen": 48097, + "music": 48098, + "ĠSlovakia": 48099, + "Supporting": 48100, + "blow": 48101, + "edit": 48102, + "ĠTrophy": 48103, + "ĠASF": 48104, + "ĠMoses": 48105, + "Ġindels": 48106, + "Ġnonhuman": 48107, + "Ġhandic": 48108, + "Ġrepairing": 48109, + "Ġmicrometer": 48110, + "ĠPhilippe": 48111, + "Ġexudates": 48112, + "ĠâĹĭ": 48113, + "Ġamalgam": 48114, + "Kin": 48115, + "fors": 48116, + "fron": 48117, + "Ġanabolic": 48118, + "ĠEich": 48119, + "NAN": 48120, + "Ġpseudogap": 48121, + "analyzed": 48122, + "Ġtackled": 48123, + "aginous": 48124, + "Ġlubricant": 48125, + "Ġradionuclides": 48126, + "arrestin": 48127, + "oussinesq": 48128, + "Lif": 48129, + "Î¥": 48130, + "received": 48131, + "astive": 48132, + "ĠPBC": 48133, + "Ġamoxicillin": 48134, + "copper": 48135, + "ubling": 48136, + "ophages": 48137, + "ĠSeas": 48138, + "ĠElite": 48139, + "PMMA": 48140, + "Ġcholang": 48141, + "Depending": 48142, + "Ġasbestos": 48143, + "ĠFecal": 48144, + "ĠRath": 48145, + "ĠLey": 48146, + "Ġfactored": 48147, + "bbles": 48148, + "Ġtokenizer": 48149, + "Ġofficinalis": 48150, + "ĠNUCLE": 48151, + "ĠSemicon": 48152, + "ĠBous": 48153, + "ĠRis": 48154, + "Ġloans": 48155, + "ACP": 48156, + "âĻĢ": 48157, + "phosate": 48158, + "Ġcherry": 48159, + "anan": 48160, + "arre": 48161, + "ĠCredit": 48162, + "isexual": 48163, + "ĠActa": 48164, + "ĠLetting": 48165, + "ĠInfarction": 48166, + "ĠAccounting": 48167, + "Ġcounterstained": 48168, + "Ġaerogel": 48169, + "standardized": 48170, + "Ġlyase": 48171, + "segments": 48172, + "Ġbachelor": 48173, + "Ġhue": 48174, + "ĠNETs": 48175, + "Ġunadjusted": 48176, + "Ġmicrohardness": 48177, + "Ġsinglets": 48178, + "ĠSPACE": 48179, + "ĠHydraulic": 48180, + "METHOD": 48181, + "ĠBjör": 48182, + "ĠKU": 48183, + "Ġrepur": 48184, + "Ġradiocarbon": 48185, + "Ġheterogeneities": 48186, + "Ġgastrocnemius": 48187, + "ĠLTD": 48188, + "Ġaccidentally": 48189, + "Processing": 48190, + "Doppler": 48191, + "TBI": 48192, + "Ġlingual": 48193, + "ĠAGS": 48194, + "ĠFrontal": 48195, + "ĠBrack": 48196, + "thema": 48197, + "Ġrepresentable": 48198, + "Ġpressurized": 48199, + "ADR": 48200, + "ĠMicrofluid": 48201, + "Ġê°": 48202, + "Ġreusable": 48203, + "Ġvendor": 48204, + "aller": 48205, + "Ġdiversion": 48206, + "FAST": 48207, + "ĠKirby": 48208, + "ĠStimulus": 48209, + "Ġattachments": 48210, + "ĠBridging": 48211, + "ĠRoberto": 48212, + "Ġqueuing": 48213, + "tling": 48214, + "roots": 48215, + "ĠMx": 48216, + "ĠMarrow": 48217, + "ĠLocus": 48218, + "Ġunimportant": 48219, + "ergarten": 48220, + "ÃŃk": 48221, + "ĠPotent": 48222, + "ĠBrunswick": 48223, + "ĠSCT": 48224, + "ĠMour": 48225, + "emias": 48226, + "ĠNCS": 48227, + "chicine": 48228, + "ĠOryza": 48229, + "Ġwherever": 48230, + "ĠXGB": 48231, + "COX": 48232, + "Ġhydrogenated": 48233, + "Ġhydraz": 48234, + "ĠPersons": 48235, + "Ġframeshift": 48236, + "Ġelectrolytic": 48237, + "ĠSenegal": 48238, + "Ġphagocyt": 48239, + "Ġinstantaneously": 48240, + "ĠGroundwater": 48241, + "Ġimperial": 48242, + "ĠRhode": 48243, + "ÅĦska": 48244, + "ovisual": 48245, + "ontsize": 48246, + "ĠExplanation": 48247, + "Ġempowerment": 48248, + "NTA": 48249, + "Pu": 48250, + "Por": 48251, + "Sched": 48252, + "eats": 48253, + "Ġys": 48254, + "inous": 48255, + "Ġwilt": 48256, + "ĠMov": 48257, + "ecton": 48258, + "ĠGins": 48259, + "introduction": 48260, + "inception": 48261, + "ĠInterpreting": 48262, + "Ġstartup": 48263, + "Ġalbino": 48264, + "Ġtetras": 48265, + "ĠHousehold": 48266, + "ĠELM": 48267, + "Ġsporulation": 48268, + "Ġosmol": 48269, + "Bis": 48270, + "erule": 48271, + "ĠEAR": 48272, + "Ġimbalances": 48273, + "Ġkt": 48274, + "Ġjl": 48275, + "gesterone": 48276, + "erala": 48277, + "ĠPointer": 48278, + "ĠHRQoL": 48279, + "ĠRiet": 48280, + "ĠEscape": 48281, + "purified": 48282, + "Ġinstantiation": 48283, + "matis": 48284, + "iona": 48285, + "Ġnoxious": 48286, + "ĠNog": 48287, + "Ġjam": 48288, + "ĠAntoni": 48289, + "ĠGodd": 48290, + "ĠPersonalized": 48291, + "Ġpermuted": 48292, + "ĠSHE": 48293, + "ĠOblast": 48294, + "ĠForbes": 48295, + "ĠResveratrol": 48296, + "ĠFeSe": 48297, + "Ġelectrodeposition": 48298, + "Ġhomeobox": 48299, + "Ġpyogenes": 48300, + "Ġviolin": 48301, + "Ġisoelectric": 48302, + "ĠPPG": 48303, + "probably": 48304, + "AMPK": 48305, + "ĠWolfe": 48306, + "Ġultrafine": 48307, + "Beyond": 48308, + "onat": 48309, + "edian": 48310, + "ENABLE": 48311, + "ĠHAM": 48312, + "sout": 48313, + "ĠOpinion": 48314, + "rinted": 48315, + "typing": 48316, + "Unknown": 48317, + "Ġbuckets": 48318, + "Ġintuitionistic": 48319, + "algorithms": 48320, + "SSC": 48321, + "bir": 48322, + "ĠPond": 48323, + "advert": 48324, + "ipin": 48325, + "Ġupwind": 48326, + "ĠClaire": 48327, + "ĠMaturation": 48328, + "ĠPrP": 48329, + "OPO": 48330, + "FORMANCE": 48331, + "ĠdM": 48332, + "ĠCities": 48333, + "Ġinterrelated": 48334, + "ĠApparatus": 48335, + "Ġprecious": 48336, + "criptors": 48337, + "Ġpreparedness": 48338, + "ĠARCH": 48339, + "ĠPathogens": 48340, + "HOST": 48341, + "ĠGibbons": 48342, + "Ġirregularity": 48343, + "ĠLipids": 48344, + "Ġcfu": 48345, + "Ġvasodilation": 48346, + "imetre": 48347, + "improved": 48348, + "mq": 48349, + "ĠHens": 48350, + "ĠLoci": 48351, + "uncredited": 48352, + "Ġmultigrid": 48353, + "tigo": 48354, + "Ġaccountability": 48355, + "enchyme": 48356, + "Ġdisadvantaged": 48357, + "Ġbisphenol": 48358, + "Ġtic": 48359, + "Ġforks": 48360, + "ĠWester": 48361, + "ĠVii": 48362, + "ĠJere": 48363, + "simultaneous": 48364, + "ĠGuarant": 48365, + "ĠDoyle": 48366, + "Ġpotentiates": 48367, + "lassified": 48368, + "Ġileal": 48369, + "Ġvasoconstriction": 48370, + "MODULE": 48371, + "Nano": 48372, + "Wood": 48373, + "ĠTAT": 48374, + "urious": 48375, + "unya": 48376, + "Ġinstillation": 48377, + "ĠSimmons": 48378, + "ĠDirectional": 48379, + "Ġmalate": 48380, + "Ġplantation": 48381, + "Ġunsolved": 48382, + "ĠTauri": 48383, + "Ġovine": 48384, + "Ġkeratinocyte": 48385, + "ĠKullback": 48386, + "ĠKazakhstan": 48387, + "Ġhirs": 48388, + "ĠAerobic": 48389, + "ĠHai": 48390, + "ĠRiley": 48391, + "ensible": 48392, + "Ġinterplanetary": 48393, + "Ġtransits": 48394, + "Ġgenerous": 48395, + "Ġcalpain": 48396, + "Ġappended": 48397, + "ĠHydrodynamics": 48398, + "Ġcolonize": 48399, + "Ġheartbeat": 48400, + "Ġmetastas": 48401, + "Ġpyreth": 48402, + "ĠPAK": 48403, + "ĠС": 48404, + "multiplet": 48405, + "ĠBrady": 48406, + "Ġpropria": 48407, + "ĠFrontier": 48408, + "ĠJoyce": 48409, + "ĠPGF": 48410, + "ĠMcl": 48411, + "recurrent": 48412, + "ĠReplacing": 48413, + "inference": 48414, + "ĠWhitt": 48415, + "Ġschooling": 48416, + "ĠHarold": 48417, + "Ġabstractions": 48418, + "âĬķ": 48419, + "memcpy": 48420, + "Ġmicronucle": 48421, + "Ġradionuclide": 48422, + "otyl": 48423, + "ĠMIF": 48424, + "ĠMUS": 48425, + "Ġexfoli": 48426, + "ĠFamilial": 48427, + "Ġclam": 48428, + "ONO": 48429, + "Ġvanilla": 48430, + "Ġpastoris": 48431, + "ĠATL": 48432, + "ĠBursts": 48433, + "Quantitative": 48434, + "Ġeliciting": 48435, + "Ġgranulomatous": 48436, + "Ġbrowsing": 48437, + "tracks": 48438, + "Ġhij": 48439, + "ĠBCP": 48440, + "incomp": 48441, + "azid": 48442, + "ckpt": 48443, + "Ġlinkers": 48444, + "Ġsquid": 48445, + "Ġheadaches": 48446, + "ĠMoral": 48447, + "Ġstabilisation": 48448, + "&&&&": 48449, + "ĠSufficient": 48450, + "ĠArchaea": 48451, + "Ġìł": 48452, + "ĠLuciferase": 48453, + "Camera": 48454, + "expanded": 48455, + "Ġmysterious": 48456, + "HPS": 48457, + "ĠBJ": 48458, + "ĠKNN": 48459, + "Ġsuperhydrophobic": 48460, + "ĠHydrothermal": 48461, + "ĠRusso": 48462, + "ĠArsenic": 48463, + "Ġnormotensive": 48464, + "ultimate": 48465, + "ĠCMIP": 48466, + "examined": 48467, + "Ġmicroporous": 48468, + "Ġforever": 48469, + "ĠSTING": 48470, + "IGS": 48471, + "ĉĉĉĠĠ": 48472, + "Plant": 48473, + "Ġcoherently": 48474, + "charging": 48475, + "Ġinherit": 48476, + "alternative": 48477, + "ĠBaptist": 48478, + "Fm": 48479, + "bipy": 48480, + "Ġoler": 48481, + "ĠSubstit": 48482, + "Ġultrap": 48483, + "freeze": 48484, + "pergill": 48485, + "POSE": 48486, + "Ġadvertisements": 48487, + "ECHAN": 48488, + "Bayesian": 48489, + "Ġcobordism": 48490, + "¸°": 48491, + "ĠAER": 48492, + "ĠAIP": 48493, + "ĠLNA": 48494, + "essentially": 48495, + "reciprocal": 48496, + "ĠAnand": 48497, + "Ġsmeared": 48498, + "onese": 48499, + "ethylamine": 48500, + "ĠERS": 48501, + "Ġjudicial": 48502, + "Ġwoodland": 48503, + "ĠGregor": 48504, + "Ġtabular": 48505, + "avirin": 48506, + "mirror": 48507, + "Ġjaundice": 48508, + "astigotes": 48509, + "ĠLGBT": 48510, + "ĠNaj": 48511, + "Ġsubscheme": 48512, + "Ġmultiuser": 48513, + "Ġdrains": 48514, + "Ġevacuated": 48515, + "phosphoryl": 48516, + "ĠFeldman": 48517, + "ĠTRIzol": 48518, + "ĠBLEU": 48519, + "aromatic": 48520, + "oviÄĩ": 48521, + "pion": 48522, + "repr": 48523, + "roth": 48524, + "ĠFES": 48525, + "ĠLeeds": 48526, + "Ġung": 48527, + "obranch": 48528, + "Ġpatency": 48529, + "ĠScr": 48530, + "ĠSimplex": 48531, + "pecies": 48532, + "Ġbenefici": 48533, + "Ġpolymerases": 48534, + "ĠCygn": 48535, + "octadec": 48536, + "Ġpunctured": 48537, + "Ġjaponicus": 48538, + "ĠFPGAs": 48539, + "frown": 48540, + "Ġeb": 48541, + "utiny": 48542, + "ĠPoy": 48543, + "ĠBrent": 48544, + "ĠBAM": 48545, + "ĠHick": 48546, + "ĠNPS": 48547, + "ĠGDF": 48548, + "ĠVIRT": 48549, + "Ġinterl": 48550, + "ĠscFv": 48551, + "Ġteamm": 48552, + "Ġparticipatory": 48553, + "Ġexistential": 48554, + "Ġosteomyelitis": 48555, + "Ġpneumothorax": 48556, + "stdout": 48557, + "Ġsingletons": 48558, + "hypothesis": 48559, + "stratified": 48560, + "USD": 48561, + "onasal": 48562, + "eris": 48563, + "imits": 48564, + "ĠICs": 48565, + "ĠEncephal": 48566, + "izi": 48567, + "ĠGradients": 48568, + "Ġallop": 48569, + "Ġcorp": 48570, + "constructed": 48571, + "Ġmonument": 48572, + "simulator": 48573, + "ĠFermions": 48574, + "ĠWyoming": 48575, + "Ġprednisolone": 48576, + "Lang": 48577, + "Notes": 48578, + "eer": 48579, + "Ġfighter": 48580, + "entrant": 48581, + "ĠNij": 48582, + "ĠGPD": 48583, + "ĠProl": 48584, + "Ġrealisation": 48585, + "Ġpackings": 48586, + "ĠDiscovering": 48587, + "ĠAnglo": 48588, + "ĠCassini": 48589, + "execute": 48590, + "Ġinhabited": 48591, + "across": 48592, + "ĠCram": 48593, + "ĠNBR": 48594, + "antes": 48595, + "Ġdispersing": 48596, + "achandran": 48597, + "ĠUND": 48598, + "Ġshoulders": 48599, + "Ġcrises": 48600, + "ustrine": 48601, + "Ġpropane": 48602, + "UNE": 48603, + "brush": 48604, + "Ġetiologies": 48605, + "Ġshotgun": 48606, + "showing": 48607, + "ĠPhytochemical": 48608, + "ĠMehta": 48609, + "orrhea": 48610, + "ĠImagery": 48611, + "Tre": 48612, + "wc": 48613, + "Ġeluent": 48614, + "ondin": 48615, + "ĠAttitude": 48616, + "Ġferromagnet": 48617, + "Ġcountermeasures": 48618, + "Ġalkanes": 48619, + "ĠCapillary": 48620, + "latent": 48621, + "Ġsolubil": 48622, + "Viewer": 48623, + "ázquez": 48624, + "ĠPunjab": 48625, + "aas": 48626, + "tang": 48627, + "Ġimports": 48628, + "ĠYounger": 48629, + "roughly": 48630, + "Weinberg": 48631, + "ĠAtkinson": 48632, + "bfa": 48633, + "MPa": 48634, + "steel": 48635, + "PCP": 48636, + "chlorinated": 48637, + "ĠPsychometric": 48638, + "Ġpyroptosis": 48639, + "Ġwatched": 48640, + "ĠPercutaneous": 48641, + "RBD": 48642, + "VARI": 48643, + "atu": 48644, + "ĠWake": 48645, + "Ġcanyon": 48646, + "iparous": 48647, + "Ġscall": 48648, + "completely": 48649, + "interfer": 48650, + "ophyceae": 48651, + "Ġfatalities": 48652, + "czak": 48653, + "ĠPathophysiology": 48654, + "Lem": 48655, + "lach": 48656, + "tuary": 48657, + "Ġalex": 48658, + "Ġsisters": 48659, + "Ġpum": 48660, + "ĠCatch": 48661, + "ĠEber": 48662, + "inex": 48663, + "phthe": 48664, + "Ġboar": 48665, + "ĠSoul": 48666, + "Ġcatfish": 48667, + "Ġcloudy": 48668, + "ĠBuilt": 48669, + "ophylline": 48670, + "ĠRibosome": 48671, + "ĠAnomalies": 48672, + "YD": 48673, + "categorical": 48674, + "wor": 48675, + "openta": 48676, + "ĠLIB": 48677, + "Ġrick": 48678, + "Ġradiations": 48679, + "Ġhypercube": 48680, + "Ġmaltreatment": 48681, + "ĠîĦĦ": 48682, + "dispersity": 48683, + "continent": 48684, + "Digital": 48685, + "ĠCoryneb": 48686, + "Ġrevert": 48687, + "ĠTEA": 48688, + "ĠMLR": 48689, + "ĠFCM": 48690, + "ĠLamp": 48691, + "izabilities": 48692, + "Ġcarved": 48693, + "ĠMonoclonal": 48694, + "Ġpenis": 48695, + "ĠMorales": 48696, + "Enter": 48697, + "esterification": 48698, + "Ġcabbage": 48699, + "RANTIES": 48700, + "Ġdebridement": 48701, + "Lead": 48702, + "cAMP": 48703, + "Ġcesium": 48704, + "ĠCubic": 48705, + "Ġunimodular": 48706, + "ĠExport": 48707, + "Ġanalyser": 48708, + "denotes": 48709, + "Ġradically": 48710, + "ĠHistology": 48711, + "Ġmelanomas": 48712, + "Ġworship": 48713, + "ĠHimalayan": 48714, + "ĠIntegrable": 48715, + "benzenesulfonamide": 48716, + "Ġharbored": 48717, + "Putting": 48718, + "ĠTir": 48719, + "ĠUTI": 48720, + "centers": 48721, + "ĠPluripot": 48722, + "Ġharbors": 48723, + "Ġcarbam": 48724, + "ĠAppalach": 48725, + "ĠJoan": 48726, + "ĠCommissioner": 48727, + "ĠGemini": 48728, + "Near": 48729, + "OPS": 48730, + "QG": 48731, + "pytorch": 48732, + "staining": 48733, + "ĠhCG": 48734, + "Ġgavage": 48735, + "perhaps": 48736, + "ĠGrib": 48737, + "ĠZah": 48738, + "Ġcomparably": 48739, + "ĠBioscience": 48740, + "SPL": 48741, + "Connell": 48742, + "ĠAirway": 48743, + "primed": 48744, + "Ġsubmucosal": 48745, + "Enhanced": 48746, + "Ġwisdom": 48747, + "VN": 48748, + "ĠMumbai": 48749, + "rius": 48750, + "ĠRGD": 48751, + "ĠRNeasy": 48752, + "mai": 48753, + "ĠADL": 48754, + "Ġadoptive": 48755, + "Outlined": 48756, + "ĠWARRANTIES": 48757, + "ĠViolence": 48758, + "Ġcaterp": 48759, + "Fund": 48760, + "dθ": 48761, + "ĠPok": 48762, + "ĠBenson": 48763, + "ĠRIG": 48764, + "ĠVs": 48765, + "Ġinstants": 48766, + "ĠMultidrug": 48767, + "PDMS": 48768, + "CONST": 48769, + "Ġcartridge": 48770, + "ĠLifestyle": 48771, + "ĠCONDITIONS": 48772, + "odysplastic": 48773, + "CONTROL": 48774, + "LHC": 48775, + "tire": 48776, + "ĠStain": 48777, + "Ġyx": 48778, + "Ġjunctional": 48779, + "obo": 48780, + "annah": 48781, + "ĠCPAP": 48782, + "Ġsoundness": 48783, + "ĠUltimate": 48784, + "silicon": 48785, + "Ġparalog": 48786, + "Events": 48787, + "Gas": 48788, + "JE": 48789, + "ĠJorge": 48790, + "Ġoverproduction": 48791, + "Ġmaxilla": 48792, + "ĠReasons": 48793, + "weeks": 48794, + "ĠNearest": 48795, + "Ġheadspace": 48796, + "ĠATC": 48797, + "balancing": 48798, + "Ġjudging": 48799, + "ĠUniversality": 48800, + "Ġsinuses": 48801, + "Ġretroperitoneal": 48802, + "Detection": 48803, + "Ġhydrolysate": 48804, + "Hoch": 48805, + "wrapper": 48806, + "ĠpKa": 48807, + "Ġlasso": 48808, + "ĠAlu": 48809, + "ĠAPR": 48810, + "ĠDors": 48811, + "ĠDarboux": 48812, + "ĠRFS": 48813, + "ĠKhar": 48814, + "ĠThrom": 48815, + "Ġdesignate": 48816, + "arco": 48817, + "Ġthermostat": 48818, + "ĠGlacial": 48819, + "IFF": 48820, + "ĠManifest": 48821, + "Ġinterspersed": 48822, + "hauser": 48823, + "ĠDDX": 48824, + "Ġale": 48825, + "tides": 48826, + "Ġlaccase": 48827, + "ĠHered": 48828, + "ĠRacial": 48829, + "ĠKats": 48830, + "ajo": 48831, + "ĠCoordinated": 48832, + "ĠProbably": 48833, + "Ġtitanate": 48834, + "SLAM": 48835, + "driving": 48836, + "ĠEmergent": 48837, + "ĠDrives": 48838, + "Ġobligations": 48839, + "Ġnebulae": 48840, + "fried": 48841, + "ithin": 48842, + "ĠPGD": 48843, + "occlusion": 48844, + "ĠUH": 48845, + "Ġsubroutine": 48846, + "oidin": 48847, + "Ġannoy": 48848, + "ĠVirasoro": 48849, + "instances": 48850, + "ĠDerby": 48851, + "Ġtriangulations": 48852, + "Ġcutoffs": 48853, + "ĠOrganizational": 48854, + "ĠVenk": 48855, + "ĠEGTA": 48856, + "ĠDeutsche": 48857, + "Ġantineut": 48858, + "ĠVulnerability": 48859, + "iated": 48860, + "Ġavium": 48861, + "Ġhsp": 48862, + "emulsions": 48863, + "adherence": 48864, + "ĠUPS": 48865, + "maph": 48866, + "ĠVAP": 48867, + "relatively": 48868, + "Ġmaxill": 48869, + "ophase": 48870, + "Threshold": 48871, + "ĠSupp": 48872, + "ethoprim": 48873, + "Ġpenetrated": 48874, + "Ġblasting": 48875, + "ĠAdvantages": 48876, + "BUS": 48877, + "olson": 48878, + "recv": 48879, + "Ġcarnitine": 48880, + "tening": 48881, + "Ġprovoked": 48882, + "various": 48883, + "ĠCalab": 48884, + "leneck": 48885, + "ĠParkin": 48886, + "Ġblowup": 48887, + "ĠDWI": 48888, + "synthesized": 48889, + "Ġdisproportionately": 48890, + "Ġcardiorespiratory": 48891, + "ĠXanthomonas": 48892, + "Ġpuncta": 48893, + "bddc": 48894, + "ĠPACS": 48895, + "aseg": 48896, + "Ġincurs": 48897, + "osta": 48898, + "ĠJL": 48899, + "ĠWeierstrass": 48900, + "oleucine": 48901, + "Ġfinals": 48902, + "Ġcausation": 48903, + "ĠDirective": 48904, + "ĠPorto": 48905, + "ĠFlores": 48906, + "arbonyl": 48907, + "----------------------------------------------------------------------------": 48908, + "historic": 48909, + "Kähler": 48910, + "onna": 48911, + "Ġcel": 48912, + "ĠTBA": 48913, + "ĠOphthal": 48914, + "Ġsubthreshold": 48915, + "Ġlips": 48916, + "ĠSubstrates": 48917, + "Ġpeninsula": 48918, + "Ġadsor": 48919, + "Ġdryness": 48920, + "masses": 48921, + "ème": 48922, + "strok": 48923, + "ĠExpanded": 48924, + "Ġgc": 48925, + "ĠGolf": 48926, + "Ġcritique": 48927, + "ĠÍ©": 48928, + "Ġlensed": 48929, + "ĠKingma": 48930, + "ĠGoldman": 48931, + "ĠFacile": 48932, + "Carl": 48933, + "Ġchondrites": 48934, + "ĠCohomology": 48935, + "ĠSocioeconomic": 48936, + "ĠDominican": 48937, + "ĠAzerbaijan": 48938, + "ĠAne": 48939, + "ĠMidd": 48940, + "ĠNed": 48941, + "Ġemulate": 48942, + "ĠShakes": 48943, + "Ġliked": 48944, + "Ġbuildup": 48945, + "Ġexcessively": 48946, + "ĠŶ": 48947, + "ĠAdapted": 48948, + "Ġauthenticated": 48949, + "Ġlocomotive": 48950, + "Ġsubmill": 48951, + "Ġinterpreter": 48952, + "ĠVibrational": 48953, + "Rα": 48954, + "laden": 48955, + "pkl": 48956, + "rw": 48957, + "yet": 48958, + "enzymes": 48959, + "Ġwav": 48960, + "ĠNMT": 48961, + "athion": 48962, + "Ġbiotechnological": 48963, + "arcs": 48964, + "Ġactuated": 48965, + "Ġherring": 48966, + "ECG": 48967, + "OCI": 48968, + "Activated": 48969, + "Ġparaph": 48970, + "Observation": 48971, + "ĠEkman": 48972, + "ancellor": 48973, + "velihood": 48974, + "Gauss": 48975, + "HAL": 48976, + "rdev": 48977, + "tbl": 48978, + "icits": 48979, + "ĠRoux": 48980, + "opram": 48981, + "Ġseropositive": 48982, + "ĠPhysically": 48983, + "ĠEdu": 48984, + "Ġdocumenting": 48985, + "Ġо": 48986, + "ĠSmaller": 48987, + "chery": 48988, + "Ġlanthanide": 48989, + "Today": 48990, + "ÑĨ": 48991, + "Ġotitis": 48992, + "ĠCores": 48993, + "ifolium": 48994, + "ĠZel": 48995, + "Ġtimings": 48996, + "coarse": 48997, + "repair": 48998, + "ĠLDPC": 48999, + "Ġbowl": 49000, + "ĠEpidermal": 49001, + "Ġâľ²": 49002, + "Ġsynonyms": 49003, + "ĠENT": 49004, + "Ġbilliard": 49005, + "Ġejac": 49006, + "ĠBAA": 49007, + "Ġscientif": 49008, + "Ġγγ": 49009, + "Ġcapsular": 49010, + "Ġazithromycin": 49011, + "Ġcredentials": 49012, + "Ġḳ": 49013, + "ĠGlioblastoma": 49014, + "Ġuncoated": 49015, + "Ġhibern": 49016, + "ĠTos": 49017, + "ĠBaro": 49018, + "ĠKass": 49019, + "yland": 49020, + "ĠXM": 49021, + "Ġaggra": 49022, + "Ġneutralize": 49023, + "licted": 49024, + "Ġsoundtrack": 49025, + "ĠKnud": 49026, + "ensorship": 49027, + "empfer": 49028, + "ĠHaldane": 49029, + "ĠRocks": 49030, + "ĠGou": 49031, + "ĠOpi": 49032, + "ibacterium": 49033, + "eptives": 49034, + "usta": 49035, + "pars": 49036, + "ukawa": 49037, + "bein": 49038, + "elius": 49039, + "averaging": 49040, + "ĠMWCNT": 49041, + "Ġshielded": 49042, + "Ġquaternionic": 49043, + "BatchNorm": 49044, + "Ġdella": 49045, + "ĠTp": 49046, + "Ġbyproduct": 49047, + "ĠGow": 49048, + "ĠJO": 49049, + "Ġparameterize": 49050, + "gler": 49051, + "Ġfacult": 49052, + "Ġ͵": 49053, + "Ġnomination": 49054, + "Ġbaths": 49055, + "Ġinstallations": 49056, + "ĠJustin": 49057, + "Ġchampionships": 49058, + "tap": 49059, + "ĠSanc": 49060, + "ĠSusp": 49061, + "Ġsubleading": 49062, + "Ġdefended": 49063, + "Ġbutyl": 49064, + "remote": 49065, + "Ġcarbides": 49066, + "ĠPredicts": 49067, + "ĠPriority": 49068, + "ĠAntibiotics": 49069, + "ĠPUFAs": 49070, + "ĠMICs": 49071, + "ĠMaximization": 49072, + "bare": 49073, + "ĠPCN": 49074, + "Ġinfested": 49075, + "Ġsolenoid": 49076, + "Ġagronomic": 49077, + "ANGE": 49078, + "Rev": 49079, + "ĠNKG": 49080, + "Ġsaponins": 49081, + "Recommend": 49082, + "Ġsharpen": 49083, + "othioyl": 49084, + "suspended": 49085, + "atron": 49086, + "usage": 49087, + "ilter": 49088, + "ĠNER": 49089, + "CRIPT": 49090, + "infections": 49091, + "Ġheterosexual": 49092, + "Ġmesoc": 49093, + "ĠBobby": 49094, + "allocate": 49095, + "ĠPayne": 49096, + "ĠSultan": 49097, + "è¡": 49098, + "racles": 49099, + "ribe": 49100, + "ĠDoub": 49101, + "ĠPAF": 49102, + "communication": 49103, + "Ġnineteenth": 49104, + "Ġpoplar": 49105, + "pgfstrok": 49106, + "pgfstrokecolor": 49107, + "SLE": 49108, + "ecia": 49109, + "Ġdetach": 49110, + "Ġcharity": 49111, + "Ġmonochrom": 49112, + "Ġprescribe": 49113, + "Ġsupermassive": 49114, + "Ġguards": 49115, + "Ġcycloaddition": 49116, + "Cohen": 49117, + "phosphatidyl": 49118, + "created": 49119, + "ĠElectrodynamics": 49120, + "Ġplasmons": 49121, + "Ñģк": 49122, + "ĠDaphnia": 49123, + "easy": 49124, + "Ġaq": 49125, + "Ġfimb": 49126, + "Ġwrest": 49127, + "ĠTend": 49128, + "hipp": 49129, + "Ġorganisational": 49130, + "MAE": 49131, + "OPY": 49132, + "Ġpotentiated": 49133, + "Ġbrute": 49134, + "omassie": 49135, + "aunay": 49136, + "luster": 49137, + "Ġophi": 49138, + "unge": 49139, + "ĠPom": 49140, + "Ġplague": 49141, + "berries": 49142, + "Ġinviscid": 49143, + "ĠQE": 49144, + "incident": 49145, + "ximide": 49146, + "Ġestrogens": 49147, + "ĠTransparent": 49148, + "vereign": 49149, + "ĠPreferred": 49150, + "Ġelastase": 49151, + "Civ": 49152, + "JF": 49153, + "Ku": 49154, + "caster": 49155, + "Ġspends": 49156, + "Ġabstracted": 49157, + "otechnical": 49158, + "Ġbreeders": 49159, + "Ġsyringae": 49160, + "Ġclotting": 49161, + "African": 49162, + "PEC": 49163, + "usep": 49164, + "Ġstark": 49165, + "solete": 49166, + "ofovir": 49167, + "Ġsensations": 49168, + "azawa": 49169, + "Ġbiomechanics": 49170, + "Ġemergencies": 49171, + "Ġspectrometers": 49172, + "Ġhemispheric": 49173, + "Ġdiscriminatory": 49174, + "ĠInspection": 49175, + "ndim": 49176, + "REP": 49177, + "ĠWess": 49178, + "Ġhyperalgesia": 49179, + "IRC": 49180, + "Ġauthorship": 49181, + "CPA": 49182, + "Ġrotationally": 49183, + "ĠPyth": 49184, + "ĠYamaguchi": 49185, + "Fields": 49186, + "Ġenrolment": 49187, + "ĠRethinking": 49188, + "Gate": 49189, + "ìĺ": 49190, + "Ġcements": 49191, + "ĠTTS": 49192, + "ĠFink": 49193, + "adus": 49194, + "ĠLl": 49195, + "Ġimplicate": 49196, + "annihilation": 49197, + "Ġfeeders": 49198, + "ĠPDX": 49199, + "ĠFrançois": 49200, + "Spearman": 49201, + "ĠBenchmarking": 49202, + "Forest": 49203, + "evidence": 49204, + "enoyl": 49205, + "olactone": 49206, + "cephaly": 49207, + "ĠPEA": 49208, + "ĠNSE": 49209, + "Ġnotified": 49210, + "Ġpolyelectrolyte": 49211, + "ĠMalik": 49212, + "anthine": 49213, + "tetrad": 49214, + "Ġflagella": 49215, + "ãĥ¼": 49216, + "orpion": 49217, + "Ġbuyers": 49218, + "Ġoligodendrocyte": 49219, + "ĠNMDAR": 49220, + "ĠHarvesting": 49221, + "Ġkarst": 49222, + "IBD": 49223, + "ĠFolk": 49224, + "Ġsubcarrier": 49225, + "Ġnotices": 49226, + "ĠYous": 49227, + "awak": 49228, + "Ġadversaries": 49229, + "Looking": 49230, + "Ġthymocytes": 49231, + "Ġmeningioma": 49232, + "Ġilluminate": 49233, + "ĠSPDX": 49234, + "Ġimpinging": 49235, + "associative": 49236, + "Ġtiger": 49237, + "leon": 49238, + "Ġstature": 49239, + "ĠHood": 49240, + "ĠRutherford": 49241, + "ĠEIT": 49242, + "Ġinfantile": 49243, + "ĠQubit": 49244, + "Ġpacks": 49245, + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ": 49246, + "azolam": 49247, + "า": 49248, + "ĠTunisia": 49249, + "dilution": 49250, + "Ġsympatric": 49251, + "Ġliquefaction": 49252, + "porphyrin": 49253, + "Gn": 49254, + "Rib": 49255, + "isothermal": 49256, + "apo": 49257, + "Ġregressors": 49258, + "mani": 49259, + "ĠILs": 49260, + "oxidants": 49261, + "Atom": 49262, + "ligo": 49263, + "ĠSRAM": 49264, + "alcone": 49265, + "csr": 49266, + "Ġcautious": 49267, + "Ġhandlers": 49268, + "Ġgastritis": 49269, + "ĠSupervision": 49270, + "Ġevaporative": 49271, + "RUN": 49272, + "ĠICG": 49273, + "ĠPrague": 49274, + "ĠMLC": 49275, + "ĠMoney": 49276, + "ĠRm": 49277, + "ĠECS": 49278, + "velt": 49279, + "ĠVg": 49280, + "Ġbiography": 49281, + "Ġministry": 49282, + "convolution": 49283, + "ogenomics": 49284, + "rounding": 49285, + "ĠPhag": 49286, + "Ġaudiences": 49287, + "ĠHCWs": 49288, + "Ġblastocysts": 49289, + "Ġdiagonals": 49290, + "Ġprecautions": 49291, + "Íĵ": 49292, + "ecewise": 49293, + "ĠToxin": 49294, + "ĠHapp": 49295, + "ĠâĢĭ": 49296, + "Ġpopulate": 49297, + "mmol": 49298, + "ĠPRS": 49299, + "Ġreinforces": 49300, + "ISTIC": 49301, + "ozoites": 49302, + "arrival": 49303, + "Ġpavement": 49304, + "REGISTER": 49305, + "ĠGases": 49306, + "ĠExhib": 49307, + "Ġfactorizations": 49308, + "Ġmyopia": 49309, + "Ġmovable": 49310, + "ĠLIMIT": 49311, + "Ġsoleus": 49312, + "DOUBLE": 49313, + "ĠInputs": 49314, + "footnotes": 49315, + "BITS": 49316, + "ĠCyprus": 49317, + "reports": 49318, + "ĠPAA": 49319, + "istal": 49320, + "Ġgroupoids": 49321, + "orphin": 49322, + "ĠCoordinates": 49323, + "boro": 49324, + "ĠOslo": 49325, + "whenever": 49326, + "Ġplausibility": 49327, + "ĠFoxO": 49328, + "ĠIntrusion": 49329, + "Ġsimplices": 49330, + "ĠFaso": 49331, + "Ġpicosecond": 49332, + "ĠAnsatz": 49333, + "Importantly": 49334, + "ĠHutchinson": 49335, + "ovani": 49336, + "ĠAsymptotics": 49337, + "Ġappra": 49338, + "ĠExogenous": 49339, + "Ġcaptions": 49340, + "ĠAcanth": 49341, + "Ġillicit": 49342, + "ĠBladder": 49343, + "Ġboom": 49344, + "ĠSalinity": 49345, + "Ġmuscul": 49346, + "eptidyl": 49347, + "Ġavalanches": 49348, + "Helper": 49349, + "Ġbivalve": 49350, + "Ġreimbursement": 49351, + "zzo": 49352, + "romatosis": 49353, + "Ġparacetamol": 49354, + "vio": 49355, + "Ġvalpro": 49356, + "clamation": 49357, + "Ġuu": 49358, + "ĠSoC": 49359, + "ĠGiac": 49360, + "Ġlycopene": 49361, + "Flags": 49362, + "Ġsticking": 49363, + "Ġsqueeze": 49364, + "synthetic": 49365, + "osahexaenoic": 49366, + "mobile": 49367, + "vect": 49368, + "ĠBaryon": 49369, + "Ġnef": 49370, + "Ġflatter": 49371, + "SSI": 49372, + "Ġschw": 49373, + "ancreas": 49374, + "Buf": 49375, + "Solid": 49376, + "ĠRIPA": 49377, + "Square": 49378, + "Ġtranscendental": 49379, + "Ġcyn": 49380, + "Ġmf": 49381, + "ĠSew": 49382, + "ĠPIT": 49383, + "ocs": 49384, + "ĠBash": 49385, + "Ġsurprised": 49386, + "Ġautonomously": 49387, + "Ġlocalizing": 49388, + "Ġvisitor": 49389, + "Ġpersisting": 49390, + "Ġlandfill": 49391, + "datetime": 49392, + "Ġfiref": 49393, + "ĠEngineered": 49394, + "ĠSnyder": 49395, + "ochromes": 49396, + "fractionated": 49397, + "GPI": 49398, + "Ġwoven": 49399, + "ĠTMR": 49400, + "Ġforgotten": 49401, + "ĠMult": 49402, + "ĠBipolar": 49403, + "ĠHisp": 49404, + "opeptides": 49405, + "apamil": 49406, + "Ġrouted": 49407, + "Ġagn": 49408, + "Ġdaylight": 49409, + "ĠÍĶ": 49410, + "BBB": 49411, + "ĠMajority": 49412, + "Ġconfounded": 49413, + "ĠCaroline": 49414, + "ĠShimura": 49415, + "ruction": 49416, + "Ġtympan": 49417, + "acio": 49418, + "ĠTFE": 49419, + "ĠTutorial": 49420, + "Ġallyl": 49421, + "ĠFrost": 49422, + "ĠRPS": 49423, + "ĠWah": 49424, + "Ġiy": 49425, + "Ġsubproblems": 49426, + "Ġairfoil": 49427, + "Ġembeds": 49428, + "ĠMorning": 49429, + "Ġminorities": 49430, + "ĠMembership": 49431, + "Ġquadriceps": 49432, + "yly": 49433, + "ĠBodies": 49434, + "ĠRAND": 49435, + "Ġrationally": 49436, + "ĠManifold": 49437, + "phosphine": 49438, + "considering": 49439, + "ezvous": 49440, + "ĠKnowing": 49441, + "Ġtumorigenic": 49442, + "Ġilluminating": 49443, + "ĠFernandes": 49444, + "polynomials": 49445, + "ĠBulgarian": 49446, + "ĠBhattacharya": 49447, + "ospira": 49448, + "Api": 49449, + "henne": 49450, + "Ġmays": 49451, + "ĠArgin": 49452, + "interpol": 49453, + "ĠAndean": 49454, + "ĠPDS": 49455, + "ĠCNP": 49456, + "Ġtransfusions": 49457, + "ĠNanom": 49458, + "Ġsynergism": 49459, + "Ġbentonite": 49460, + "Ġgravitons": 49461, + "aquette": 49462, + "Ġfissure": 49463, + "tandem": 49464, + "wash": 49465, + "ĠEyes": 49466, + "Ġdilepton": 49467, + "Ġrectified": 49468, + "ĠArist": 49469, + "iscible": 49470, + "Ġirq": 49471, + "Ġligaments": 49472, + "security": 49473, + "Ġvascularization": 49474, + "NaCl": 49475, + "ĠStraight": 49476, + "ĠLeptin": 49477, + "ĠAbundances": 49478, + "ĠKEY": 49479, + "ĠMothers": 49480, + "ĠRenewable": 49481, + "Ġmasonry": 49482, + "ëı": 49483, + "raceutical": 49484, + "Ġarity": 49485, + "ĠAlves": 49486, + "ospectral": 49487, + "Ġimmunod": 49488, + "Ġmarble": 49489, + "Ġcoverings": 49490, + "ĠConstants": 49491, + "ĠReversal": 49492, + "Works": 49493, + "ĠNurse": 49494, + "ĠAggregate": 49495, + "acillin": 49496, + "plug": 49497, + "Ġjury": 49498, + "oneogenesis": 49499, + "Ġamoeb": 49500, + "aukee": 49501, + "Ġphosphoric": 49502, + "ĠRemoving": 49503, + "Ġworsen": 49504, + "ĠESRD": 49505, + "ĠHernandez": 49506, + "ĠEugene": 49507, + "viscosity": 49508, + "FID": 49509, + "¦": 49510, + "ĠÝ": 49511, + "ĠStig": 49512, + "ĠSING": 49513, + "ĠIMRT": 49514, + "ĠBq": 49515, + "ĠDME": 49516, + "ĠHOM": 49517, + "physis": 49518, + "obes": 49519, + "Ġsuperfields": 49520, + "Ġargc": 49521, + "Ġmaladaptive": 49522, + "ĠEditing": 49523, + "Ġcondem": 49524, + "ubei": 49525, + "stimulus": 49526, + "Ġabbreviation": 49527, + "Haus": 49528, + "ĠNeeds": 49529, + "Ġadhering": 49530, + "ĠVPA": 49531, + "ofrontal": 49532, + "ĠŪ": 49533, + "ĠVerde": 49534, + "ĠSlav": 49535, + "ĠPropag": 49536, + "Ġcongeners": 49537, + "Ġtilapia": 49538, + "ĠRachel": 49539, + "Less": 49540, + "Ġmasc": 49541, + "entangled": 49542, + "ĠDTI": 49543, + "atik": 49544, + "rolases": 49545, + "ĠYen": 49546, + "armor": 49547, + "ĠDecisions": 49548, + "Ġηp": 49549, + "Intuitively": 49550, + "ĠPharmaceuticals": 49551, + "Ju": 49552, + "uddin": 49553, + "ĠWASP": 49554, + "nton": 49555, + "Ġbiot": 49556, + "ĠZNF": 49557, + "Ġcrush": 49558, + "ĠParity": 49559, + "SIST": 49560, + "EVENT": 49561, + "ĠSquamous": 49562, + "Student": 49563, + "Ġgingivalis": 49564, + "fused": 49565, + "ĠMises": 49566, + "ĠFDTD": 49567, + "oreceptors": 49568, + "Ġdiscretion": 49569, + "ORTC": 49570, + "MSP": 49571, + "Ġexposes": 49572, + "Ġchlorinated": 49573, + "ĠUpregulation": 49574, + "ĠLimb": 49575, + "Ġanticor": 49576, + "Regular": 49577, + "Advanced": 49578, + "Xe": 49579, + "aghan": 49580, + "ĠBLA": 49581, + "Ġcoasts": 49582, + "ĠThirteen": 49583, + "hesin": 49584, + "ĠMethanol": 49585, + "rotus": 49586, + "ĠStephens": 49587, + "Book": 49588, + "ĠHistorically": 49589, + "ĠEmploying": 49590, + "Ġcorrugated": 49591, + "mercaptoethanol": 49592, + "ĠDnmt": 49593, + "ĠQueries": 49594, + "DRB": 49595, + "ĠGRU": 49596, + "FLU": 49597, + "ĠCarboniferous": 49598, + "OBJECT": 49599, + "ĠDiscriminative": 49600, + "ĠBurgess": 49601, + "Ġplanetesimals": 49602, + "ĠAmendment": 49603, + "ĠStrikingly": 49604, + "tric": 49605, + "ecure": 49606, + "Ġtransposable": 49607, + "rolateral": 49608, + "Ġhisti": 49609, + "egaard": 49610, + "Ġskim": 49611, + "ĠSPF": 49612, + "Statistics": 49613, + "Ġintestines": 49614, + "feng": 49615, + "lain": 49616, + "Ġtheat": 49617, + "Ġorogen": 49618, + "Ġpill": 49619, + "odopa": 49620, + "Ġcorrelative": 49621, + "ACO": 49622, + "Ġadjunction": 49623, + "ĠCarey": 49624, + "Ġteleportation": 49625, + "ĠBoundaries": 49626, + "ĠGoodfellow": 49627, + "ĠLinda": 49628, + "ĠPolymeric": 49629, + "Ġexertion": 49630, + "Ġsteeply": 49631, + "Ġprotrusion": 49632, + "Ġhyaluronic": 49633, + "ĠRochester": 49634, + "ENSIONAL": 49635, + "Dar": 49636, + "fet": 49637, + "ĠFSS": 49638, + "hemically": 49639, + "Ġflashes": 49640, + "Ġdeviated": 49641, + "feldt": 49642, + "Ġsticks": 49643, + "Ġoctet": 49644, + "Ġgravitationally": 49645, + "footnotesize": 49646, + "Lex": 49647, + "ovi": 49648, + "Ġwired": 49649, + "ĠSMP": 49650, + "ermans": 49651, + "Ġunbroken": 49652, + "Ġemulation": 49653, + "simulated": 49654, + "Ġminimality": 49655, + "ardiac": 49656, + "Ġshipw": 49657, + "Genetic": 49658, + "ĠHermann": 49659, + "ynchronization": 49660, + "ĠNapole": 49661, + "Ġmonodisperse": 49662, + "Rho": 49663, + "rists": 49664, + "Ġfx": 49665, + "ĠFUV": 49666, + "ĠGelfand": 49667, + "hemispheric": 49668, + "ronidazole": 49669, + "Ġsupersaturation": 49670, + "oudh": 49671, + "olitical": 49672, + "ĠAiry": 49673, + "Ġmanifestly": 49674, + "ĠHMG": 49675, + "Ġadvertisement": 49676, + "ĠBrooklyn": 49677, + "Ġparalleled": 49678, + "answered": 49679, + "ĠNotImplementedError": 49680, + "UPD": 49681, + "oust": 49682, + "ĠTeng": 49683, + "Ġfortified": 49684, + "ĠSort": 49685, + "ENE": 49686, + "ĠFris": 49687, + "ĠHIS": 49688, + "ĠROT": 49689, + "ĠNested": 49690, + "produce": 49691, + "ĠKerala": 49692, + "genomic": 49693, + "ĠIsab": 49694, + "Ġuracil": 49695, + "burger": 49696, + "ĠLogarithmic": 49697, + "Ġsterility": 49698, + "Ġunemployed": 49699, + "Ġoriental": 49700, + "Ko": 49701, + "jima": 49702, + "ĠCTP": 49703, + "ĠLAD": 49704, + "Ġconformers": 49705, + "CGG": 49706, + "Perkin": 49707, + "Ġbridged": 49708, + "ĠDissociation": 49709, + "ĠQiagen": 49710, + "Ġwealthy": 49711, + "Ġanaesthetic": 49712, + "ĠMinimizing": 49713, + "Ġacoustics": 49714, + "bucket": 49715, + "ĠSertoli": 49716, + "rath": 49717, + "saw": 49718, + "Ġgarn": 49719, + "ĠTheoretically": 49720, + "ticul": 49721, + "ĠThinking": 49722, + "iker": 49723, + "ĠChit": 49724, + "Ġtrin": 49725, + "ALITY": 49726, + "ĠFeO": 49727, + "Ġpolymerized": 49728, + "Encoding": 49729, + "Ġanalgesics": 49730, + "ĠLexical": 49731, + "Ġmarijuana": 49732, + "âĸĪâĸĪ": 49733, + "crops": 49734, + "entropic": 49735, + "olocation": 49736, + "ĠPomp": 49737, + "Ġcofactors": 49738, + "boxtimes": 49739, + "ĠArri": 49740, + "Angel": 49741, + "ĠRequirement": 49742, + "Ġmicrolensing": 49743, + "ĠTRANSF": 49744, + "åº": 49745, + "Ġdma": 49746, + "Ġrerio": 49747, + "undancy": 49748, + "antel": 49749, + "Ġradiometric": 49750, + "ĠSean": 49751, + "randn": 49752, + "ĠCRL": 49753, + "halos": 49754, + "ubertal": 49755, + "Ġquinone": 49756, + "TES": 49757, + "ĠdW": 49758, + "ĠCGM": 49759, + "Ġhealed": 49760, + "iane": 49761, + "Ġobtainable": 49762, + "ĠAdrian": 49763, + "Ġlikes": 49764, + "ĠMedication": 49765, + "Ġcognitively": 49766, + "Whether": 49767, + "Bob": 49768, + "did": 49769, + "alcohol": 49770, + "Ġnivolumab": 49771, + "ĠFY": 49772, + "Ġatresia": 49773, + "achs": 49774, + "ĠKip": 49775, + "Ġunigenes": 49776, + "ĠJaccard": 49777, + "ustri": 49778, + "Ġconfine": 49779, + "Ġautofluorescence": 49780, + "Ġpyg": 49781, + "Sea": 49782, + "Settings": 49783, + "Ġtruncatula": 49784, + "Literal": 49785, + "Fab": 49786, + "Mah": 49787, + "Ven": 49788, + "Ġtig": 49789, + "Ġcher": 49790, + "ĠCCI": 49791, + "ĠFunk": 49792, + "ĠBess": 49793, + "ĠNasal": 49794, + "iffer": 49795, + "Ġobsessive": 49796, + "ĠOpening": 49797, + "ochondral": 49798, + "ĠTRPA": 49799, + "ĠRabin": 49800, + "Ġtaper": 49801, + "Ġdeafness": 49802, + "DOS": 49803, + "isites": 49804, + "anite": 49805, + "leost": 49806, + "ĠSTP": 49807, + "ĠBACE": 49808, + "ĠHenn": 49809, + "ĠESM": 49810, + "Ġsuperfield": 49811, + "ĠOrland": 49812, + "ĠAMPs": 49813, + "ĠHemorrh": 49814, + "Ġrescues": 49815, + "Ġtourists": 49816, + "ĠVLBI": 49817, + "Ġneighbourhoods": 49818, + "communicable": 49819, + "gx": 49820, + "ratase": 49821, + "ĠNRT": 49822, + "Ġobstructions": 49823, + "Ġdeforestation": 49824, + "Ġqp": 49825, + "ĠPhan": 49826, + "ĠSTI": 49827, + "imento": 49828, + "ĠIRI": 49829, + "SVs": 49830, + "Ġstriped": 49831, + "Poinc": 49832, + "ĠBedford": 49833, + "ĠFragment": 49834, + "ĠReligion": 49835, + "Ġdrones": 49836, + "imulation": 49837, + "ĠCet": 49838, + "Ġgills": 49839, + "ĠNorton": 49840, + "ibatch": 49841, + "estructive": 49842, + "ĠJav": 49843, + "ĠϽ": 49844, + "Ġmica": 49845, + "AGB": 49846, + "RAW": 49847, + "ĠMyD": 49848, + "ctl": 49849, + "Ġreversibly": 49850, + "Ġsuppressors": 49851, + "ĠFAIL": 49852, + "ĠFukushima": 49853, + "Evidence": 49854, + "pink": 49855, + "asarray": 49856, + "ĠTann": 49857, + "Ġloved": 49858, + "Ġbiologists": 49859, + "Ġendothermic": 49860, + "Ġbroker": 49861, + "ĠPerkins": 49862, + "Ġcategorised": 49863, + "ĠSOME": 49864, + "hydroxyvitamin": 49865, + "rogates": 49866, + "ĠAgeing": 49867, + "Ġtournaments": 49868, + "ĠStromal": 49869, + "Ġdeferred": 49870, + "ĠSREBP": 49871, + "MAD": 49872, + "Say": 49873, + "cgi": 49874, + "phe": 49875, + "olini": 49876, + "ĠDü": 49877, + "Ġdehydro": 49878, + "apeptide": 49879, + "Ġhes": 49880, + "Ġdistally": 49881, + "versions": 49882, + "Ġmedals": 49883, + "Ġflaw": 49884, + "Ġduo": 49885, + "Ġimpairing": 49886, + "toplasts": 49887, + "ĠHFILL": 49888, + "Ġesculent": 49889, + "Classification": 49890, + "ĠGriffith": 49891, + "ĠWellington": 49892, + "Ġattorney": 49893, + "Ast": 49894, + "kA": 49895, + "Ġmilit": 49896, + "Ġnite": 49897, + "ĠCasp": 49898, + "ĠChester": 49899, + "ĠMok": 49900, + "ĠRAR": 49901, + "Ġchr": 49902, + "unctor": 49903, + "Ġabduction": 49904, + "Ġuniv": 49905, + "ovars": 49906, + "ouk": 49907, + "ERICAL": 49908, + "éri": 49909, + "orbance": 49910, + "ĠIdentifies": 49911, + "amento": 49912, + "Ġparenthesis": 49913, + "ĠMEFs": 49914, + "Ġabsorbs": 49915, + "ĠArrayList": 49916, + "Ġcaregiving": 49917, + "ĠFILE": 49918, + "Ġfeldspar": 49919, + "ochthonous": 49920, + "Sort": 49921, + "jal": 49922, + "Ġtantal": 49923, + "arabine": 49924, + "ĠSaid": 49925, + "ĠBCE": 49926, + "ĠNGO": 49927, + "ynure": 49928, + "doteq": 49929, + "ĠLeyd": 49930, + "modality": 49931, + "ĠGeometrical": 49932, + "Almost": 49933, + "Ġhardened": 49934, + "noea": 49935, + "news": 49936, + "Ġcleanup": 49937, + "ĠArmed": 49938, + "ĠSnake": 49939, + "multiply": 49940, + "ĠMillennium": 49941, + "ĠSmoothing": 49942, + "positely": 49943, + "enary": 49944, + "isse": 49945, + "ĠYuc": 49946, + "Ġgeneal": 49947, + "Ġsupers": 49948, + "Ġhandheld": 49949, + "Ġembark": 49950, + "ĠBla": 49951, + "horst": 49952, + "ĠPDGFR": 49953, + "Ġcitr": 49954, + "Ġcalorie": 49955, + "ĠBuddhist": 49956, + "Member": 49957, + "Ġfears": 49958, + "Ġfiscal": 49959, + "ĠAIF": 49960, + "LOAD": 49961, + "peare": 49962, + "Ġbitumen": 49963, + "Particip": 49964, + "ĠIndianapolis": 49965, + "ĠAlbum": 49966, + "Ġscrutiny": 49967, + "acylglycer": 49968, + "ĠSakai": 49969, + "Ġthermodynamical": 49970, + "ZB": 49971, + "Ġhpf": 49972, + "ĠLIP": 49973, + "Ġexpiration": 49974, + "tilt": 49975, + "Ġflax": 49976, + "ĠSelectivity": 49977, + "ĠSchol": 49978, + "anya": 49979, + "orbents": 49980, + "Ġincubations": 49981, + "Ġmarginals": 49982, + "involved": 49983, + "Ġenthalpies": 49984, + "macrophages": 49985, + "constructor": 49986, + "ĠRoland": 49987, + "ĠPm": 49988, + "ĠRY": 49989, + "Ġblobs": 49990, + "Ġannuli": 49991, + "Ġunstimulated": 49992, + "ĠPetroleum": 49993, + "Ġmerges": 49994, + "Ġenveloping": 49995, + "ĠInitialization": 49996, + "Ġsheds": 49997, + "Ġadvisable": 49998, + "ylethanolamine": 49999 + }, + "merges": [ + "Ġ t", + "i n", + "Ġ a", + "h e", + "o n", + "r e", + "a t", + "Ġt he", + "e r", + "Ġ s", + "Ġ o", + "e n", + "a l", + "Ġ c", + "t i", + "o r", + "e d", + "e s", + "i s", + "Ġ p", + "Ġo f", + "n d", + "Ġ in", + "Ġ f", + "Ġ w", + "Ġ Ġ", + "i t", + "a n", + "r o", + "a r", + "Ġ d", + "Ġ m", + "Ġ b", + "Ġa nd", + "i c", + "l e", + "in g", + "i on", + "a s", + "Ġ e", + "Ġ re", + "at ion", + "Ġt o", + "e l", + "en t", + "a c", + "e t", + "e c", + "ti on", + "o m", + "s t", + "Ġ T", + "Ġ n", + "Ġt h", + "o l", + "u l", + "i m", + "R E", + "i g", + "u s", + "RE F", + "Ġ l", + "Ġ h", + "u r", + "Ġ is", + "ĠĠ ĠĠ", + "Ġf or", + "i d", + "a m", + "Ġ S", + "v e", + "i l", + "Ġ A", + "Ġ C", + "Ġ g", + "o t", + "it h", + "l y", + "c e", + "Ġc on", + "o w", + "Ġs t", + "u t", + "o s", + "Ġw ith", + "o d", + "r a", + "Ġ v", + "Ġp ro", + "u m", + "Ġ I", + "i f", + "u c", + "t er", + "u n", + "A R", + "S T", + "re s", + "Ġ on", + "E N", + "e re", + "Ġ P", + "ĠT he", + "Ġ M", + "Ġa s", + "AR T", + "Ġa n", + "EN D", + "ST ART", + "Ġth at", + "q u", + "e m", + "Ġb e", + "Ġe x", + "r i", + "a b", + "it y", + "ti c", + "v er", + "Ġa l", + "p l", + "t s", + "Ġ F", + "Ġ â", + "u re", + "Ġb y", + "at e", + "a g", + "i r", + "o c", + "p er", + "Ġ B", + "a y", + "Ġ D", + "Ġc om", + "Ġ H", + "at ed", + "Ġ R", + "Ġa re", + "ro m", + "Ġ E", + "o p", + "a d", + "s e", + "Ġ L", + "ig h", + "Ġ N", + "m ent", + "he r", + "o g", + "a in", + "ec t", + "u d", + "Ġd e", + "Ġ r", + "Ġa t", + "Ġw as", + "Ġ us", + "Ġre s", + "el l", + "i z", + "in e", + "p h", + "Ġa c", + "es s", + "o re", + "ic al", + "t h", + "u nd", + "r ac", + "Ġw e", + "at h", + "Ġ G", + "Ġf rom", + "at i", + "u p", + "is t", + "an t", + "Ġo r", + "f f", + "Ġcom p", + "Ġw h", + "Ġ W", + "c h", + "er s", + "Ġs p", + "or m", + "Ġc h", + "ation s", + "r an", + "u b", + "t e", + "d i", + "Ġs h", + "g e", + "as e", + "Ġw ere", + "ĠĠĠĠ ĠĠĠĠ", + "Ġ Î", + "a p", + "ĠI n", + "a nd", + "Ġs e", + "v el", + "Ġ im", + "Ġâ Ī", + "en s", + "i es", + "ic h", + "igh t", + "d uc", + "Ġ O", + "Ġ it", + "tion s", + "en d", + "Ġc o", + "Ġth is", + "Ġc an", + "Ġ k", + "â Ģ", + "le c", + "t ed", + "Ġm od", + "m ath", + "Ġcon t", + "Ġn e", + "Ġp ar", + "i b", + "ĠĠ Ġ", + "Ġ le", + "i v", + "u g", + "en ce", + "ig n", + "o us", + "ent s", + "y s", + "a ve", + "re d", + "res s", + "ab le", + "p or", + "al l", + "if f", + "es t", + "Ġa p", + "Ġin c", + "n t", + "ar y", + "i ti", + "Ġwh ich", + "Ġn ot", + "f orm", + "Ġs y", + "Ġa d", + "l ow", + "a k", + "Ġp er", + "Ġ he", + "p ro", + "an ce", + "i al", + "u e", + "Ġ en", + "Ġc l", + "as s", + "i p", + "ran s", + "Ġo b", + "Ġg en", + "ti m", + "Ġd is", + "un c", + "Ġin t", + "e p", + "et w", + "Ġd iff", + "ac h", + "t her", + "im e", + "ag e", + "p le", + "il l", + "y p", + "Ġ K", + "ac t", + "ar i", + "Ġm et", + "or s", + "Ġh ave", + "Ġst ud", + "on g", + "Ġ U", + "Ġp l", + "id e", + "m a", + "he n", + "if ic", + "om e", + "Ġ i", + "ul ar", + "Ġ V", + "al ly", + "Ġsh ow", + "ri b", + "i a", + "en ti", + "Ġas s", + "on d", + "f t", + "Ġa b", + "Ġin ter", + "ĠT h", + "T he", + "st r", + "Ġc ell", + "c al", + "Ġmod el", + "at a", + "as t", + "Ġe ff", + "Ġt rans", + "at es", + "as ed", + "o st", + "v i", + "an g", + "o ur", + "Ġm e", + "ar d", + "Ġdiff ere", + "Ġp re", + "Ġd i", + "ĠâĪ Ĵ", + "ol og", + "u tion", + "o und", + "ac e", + "Ġres ul", + "er m", + "p os", + "he re", + "ti ve", + "or d", + "s o", + "st em", + "y l", + "Ġp h", + "Ġ y", + "am e", + "or k", + "ati ve", + "Ġ qu", + "r ic", + "S U", + "w o", + "Ġ un", + "Ġe v", + "a re", + "# #", + "d e", + "e en", + "ti v", + "Ġg ro", + "or y", + "Ġcon s", + "Ġs ub", + "t a", + "- -", + "Ġst r", + "b er", + "er v", + "etw een", + "en c", + "Ġan al", + "in t", + "Ġh as", + "uc h", + "Ġre g", + "Ġb etween", + "Ġd et", + "Ġal l", + "c ess", + "Ġex p", + "ec tion", + "Ġâ Ģ", + "in d", + "at er", + "Ġs ign", + "p t", + "ug h", + "it e", + "il ity", + "Ġus ing", + "Ġv al", + "Ġ ro", + "re e", + "Ġre l", + "o ut", + "Ġf unc", + "i tion", + "Ġc or", + "Ġal so", + "Ġt wo", + "n e", + "Ġ J", + "Ġsy stem", + "c l", + "uc t", + "Ġs im", + "t ain", + "u st", + "i ed", + "por t", + "Ġre c", + "Ġres p", + "Ġd ata", + "r m", + "res ent", + "ul d", + "x t", + "Ġ j", + "r y", + "ac k", + "Ġ ra", + "p ar", + "Ġfor m", + "Ġs c", + "f rac", + "ĠW e", + "at ing", + "ec h", + "h od", + "Ġf ol", + "in ed", + "ĠS t", + "u al", + "Ġus ed", + "Ġon e", + "Ġd es", + "Ġ Ï", + "Ġv ari", + "Ġd ist", + "Ġn um", + "y m", + "e w", + "re c", + "o b", + "Ġin f", + "Ġa r", + "lec t", + "l l", + "on s", + "ĠTh is", + "os e", + "i le", + "pl ay", + "e ar", + "o x", + "u res", + "on e", + "Ġstud y", + "ys is", + "Ġfol low", + "y le", + "rac t", + "d is", + "Ġp os", + "r ight", + "Ġth an", + "ro s", + "a v", + "F ig", + "Ġt ime", + "iz ation", + "ul ation", + "iz ed", + "Ġs ur", + "ot h", + "Ġo ut", + "Ġc ol", + "at ure", + "i ve", + "Ġs ol", + "Ġ x", + "el d", + "Ġo ther", + "pl ic", + "Ġde f", + "er g", + "Ġgen er", + "el y", + "Ġbe en", + "Ġinc re", + "Ġthe se", + "Ġn o", + "a x", + "st yle", + "ar g", + "i an", + "Ġin d", + "Ġs uch", + "Ġfunc tion", + "t ing", + "Ġe qu", + "a us", + "Ġ und", + "math b", + "tic al", + "Ġh igh", + "ra in", + "Ġa m", + "i eld", + "o un", + "ress ion", + "Ġsp ec", + "Ġo p", + "Ġd ec", + "Ġo ver", + "Ġmet hod", + "Ġs et", + "â Ī", + "Ġ if", + "di tion", + "u es", + "ec ts", + "dis play", + "he m", + "Ġp ati", + "Ġresul ts", + "ol d", + "an c", + "display style", + "Ġe ach", + "Ġm ore", + "l es", + "p r", + "ac ter", + "Ġthe ir", + "Ġac c", + "Ġap pro", + "is s", + "iz e", + "Ġin v", + "as es", + "Ġcell s", + "ir st", + "l u", + "a il", + "Ġme as", + "Ġl ow", + "o v", + "t he", + "i k", + "* *", + "e f", + "Ġb ut", + "he s", + "f ter", + "Ġdiffere nt", + "vel y", + "Ġex t", + "Ġthe re", + "oc i", + "Ġpro b", + "Ġit s", + "r on", + "ment s", + "Ġa g", + "N A", + "Ġp o", + "ic e", + "yp e", + "Ġgro up", + "âĢ ĵ", + "e ver", + "ul t", + "is m", + "ter n", + "ab ility", + "ion s", + "ar k", + "Ġn on", + "t o", + "ĠĠĠĠ ĠĠĠ", + "Ġob s", + "Ġt re", + "al s", + "le ft", + "ĠP ro", + "Ġon ly", + "Ġm an", + "d er", + "Ġp ol", + "ur ing", + "am et", + "ro l", + "I n", + "y n", + "Ġund er", + "ĠC h", + "Ġw here", + "o od", + "Ġ X", + "n ce", + "Ġpar tic", + "ect ed", + "ĠF ig", + "Ġe m", + "Ġf act", + "ĠA n", + "Ġper form", + "Ġs o", + "Ġanal ysis", + "st ract", + "he d", + "Ġm ay", + "at ic", + "Ġre p", + "te in", + "duc ed", + "Ġ up", + "Ġint o", + "Ġnum ber", + "Ġo ur", + "Ġe t", + "e g", + "it le", + "o ver", + "i x", + "at or", + "ul ti", + "Ġinc l", + "o uld", + "ic i", + "b stract", + "Ġcomp le", + "Ġpati ents", + "Ġd o", + "Ġex per", + "v id", + "an ge", + "Ġle vel", + "Ġpro cess", + "math cal", + "p s", + "Ġsign ific", + "Ġs am", + "T itle", + "Ġb l", + "Ġstr uct", + "et a", + "Ġobs erv", + "ra ph", + "g r", + "Ġac tiv", + "Ġf irst", + "vel op", + "g en", + "ib le", + "Ġs m", + "Ġw ill", + "Ġ Q", + "Ġmeas ure", + "p ut", + "Ġl oc", + "Ġm o", + "ver s", + "o f", + "t al", + "ere d", + "ow n", + "Ġm at", + "iti es", + "ti l", + "in al", + "Ġc ar", + "ph a", + "Ġb oth", + "Ġc ur", + "SU B", + "it s", + "re l", + "Ġw hen", + "Ġ z", + "Ġch ar", + "Ġb i", + "c ent", + "Ġthe n", + "is e", + "ow ever", + "Ġm in", + "ĠF or", + "Ġ Y", + "p tion", + "Ġ es", + "m un", + "Ġincl ud", + "is tic", + "c on", + "Ġob tain", + "a red", + "duc tion", + "Ġsignific ant", + "Ġ Z", + "Ġp resent", + "an n", + "Ġ id", + "enc y", + "Ġv er", + "v al", + "y d", + "ro ugh", + "SU P", + "f ore", + "Ġs ome", + "ĠA s", + "Ġs up", + "Ġa fter", + "olog ical", + "enti f", + "Ġc ase", + "Ġs ec", + "el f", + "Ġde p", + "k s", + "Ġc al", + "v ed", + "Ġt em", + "Ġus e", + "ĠC om", + "l am", + "in es", + "ay s", + "Ġg iv", + "Ġcons id", + "Ġe lect", + "ation al", + "ĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠ", + "i qu", + "ti es", + "Ġl ine", + "Ġs u", + "A bstract", + "oun t", + "Ġde velop", + "ĠC on", + "olog y", + "al pha", + "an s", + "pr ime", + "c c", + "og en", + "Ġw ork", + "v en", + "i um", + "ec tive", + "Ġp a", + "t en", + "ĠA l", + "Ġ ï", + "Ġf e", + "âĢ Ļ", + "enti al", + "l ine", + "Ġpar amet", + "Ġpro tein", + "Ġdis c", + "f ace", + "c es", + "Ġw ell", + "ur al", + "en g", + "Ġd uring", + "ro w", + "an ts", + "Ġre m", + "form ation", + "Ġex am", + "Ġm ic", + "âĪ Ĵ", + "le m", + "erg y", + "Ġass oci", + "Ġ Ã", + "ro p", + "Ġf ield", + "t y", + "Ġcl ass", + "Ġ u", + "i e", + "Ġb ec", + "Ġexper im", + "s p", + "Ġp r", + "il ar", + "ti al", + "Ġcon st", + "ĠI t", + "Ġcont rol", + "d a", + "Ġm ulti", + "iti ve", + "ic s", + "ur n", + "Ġind ic", + "Ġf ound", + "te xt", + "Ġne w", + "Ġre f", + "g or", + "ra p", + "Ġdes c", + "Ġs ame", + "Ġfollow ing", + "Ġdist rib", + "Fig ure", + "il d", + "Ġan ti", + "etw ork", + "o ve", + "Ġth rough", + "Ġm ost", + "c er", + "Ġdet erm", + "h a", + "el ta", + "ar ge", + "Ġshow n", + "in ce", + "Ġan y", + "re n", + "d ot", + "r al", + "r ation", + "am ma", + "o id", + "Ġm ed", + "ens ion", + "ar t", + "Ġp red", + "m et", + "mathb b", + "ak e", + "Ġcal c", + "Ġh ig", + "Ġth ree", + "Ġb ased", + "m on", + "ar ch", + "-- --", + "pl es", + "ag es", + "aus e", + "is h", + "ti vely", + "qu i", + "res p", + "Ġchar acter", + "oc k", + "Ġtre at", + "Ġpro per", + "e x", + "Ġsm all", + "Ġt erm", + "b da", + "Ġk n", + "od e", + "ing s", + "Ġexp ression", + "Ġm on", + "em b", + "ut e", + "ech n", + "h ib", + "Ġdi rec", + "in ation", + "ith m", + "ul ated", + "Ġc y", + "Ġp ot", + "Ġor der", + "ot e", + "ical ly", + "Ġval ues", + "or t", + "ur ther", + "ce pt", + "yn am", + "o ugh", + "ech an", + "Ġâ ī", + "o k", + "em ent", + "ĠÎ ¼", + "Ġes tim", + "Ġeff ect", + "Ġp ath", + "Ġcon f", + "Ġap p", + "Ġgiv en", + "Ġ end", + "s et", + "Ġg l", + "Ġthe y", + "n ing", + "Ġt est", + "Ġtem per", + "v es", + "Ġval ue", + "it ed", + "al ity", + "Ġl im", + "Ġsp ect", + "ent ly", + "ti t", + "Ġse qu", + "Ġid entif", + "/ /", + "ig ma", + "Ġen ergy", + "in c", + "n ess", + "ens ity", + "Ġprob lem", + "yd ro", + "ag n", + "an e", + "re nt", + "c om", + "j ect", + "Ġim port", + "ĉ ĉ", + "Ġo per", + "ol ution", + "Ġa ut", + "ec tively", + "ĠH owever", + "h o", + "ent al", + "Ġs ing", + "e y", + "m u", + "ros s", + "ac tion", + "ep end", + "ĠE x", + "vi ous", + "Ġstud ies", + "s c", + "orm al", + "Ġh ad", + "Ġm ain", + "al th", + "gor ithm", + "Ġf l", + "om et", + "Ġ Â", + ". .", + "er r", + "Ġpos s", + "Ġdiffere n", + "Ġobserv ed", + "ra y", + "Ġpred ic", + "Ġgen e", + "Ġst ate", + "W e", + "Ġstruct ure", + "Ġre t", + "resp ond", + "re qu", + "il y", + "ĠâĪ Ī", + "Ġs er", + "Ġb ound", + "Ġrep resent", + "ph i", + "Ġtreat ment", + "h at", + "Ġre qui", + "ap p", + "um an", + "Ġhig her", + "Ġl arge", + "Ġt ra", + "w ard", + "Ġobtain ed", + "Ġco uld", + "ti g", + "ĠU n", + "Ġdesc rib", + "Ġsim ilar", + "por ted", + "in s", + "Ġad dition", + "os is", + "Ġn etwork", + "Ġe le", + "p i", + "ri x", + "Ġr ate", + "g an", + "ug g", + "us s", + "Ġm echan", + "Ġdis e", + "Ġeff ects", + "Ġmodel s", + "or ph", + "ik e", + "Ġsec ond", + "mathb f", + "Ġd ue", + "Ġ q", + "Ġp res", + "Ġt echn", + "el s", + "Ġcor respond", + "Ġassoci ated", + "pos ed", + "Ġm ass", + "ro und", + "vi ew", + "Ġin s", + "ĠâĢ ¢", + "di tions", + "Ġwh ile", + "o le", + "Ġl ong", + "al u", + "Ġc ap", + "Ġsur face", + "Ġcomple x", + "Ġc ent", + "Ġcomp ared", + "Ġf ind", + "arg et", + "at ory", + "f er", + "Ġs ize", + "Ġcont ain", + "us ion", + "u tions", + "Ġd em", + "E S", + "Ġdep end", + "at is", + "s um", + "ff ici", + "Ġb as", + "lam bda", + "i er", + "A T", + "Ġm ax", + "Ġim p", + "Ġev alu", + "Ġtemper ature", + "in k", + "ect or", + "Ġs cal", + "Ġgro w", + "ow er", + "Ġresp ectively", + "le ar", + "s h", + "ic k", + "Ġf il", + "ir c", + "il on", + "r am", + "ĠÎ ±", + "ific ation", + "Ġo cc", + "Ġy ear", + "Ġs ugg", + "Ġra di", + "if ied", + "ha vi", + "Ġwith in", + "Ġs ens", + "Ġin te", + "Ġw ould", + "Ġcon cent", + "Ġmic ro", + "Ġsing le", + "ĠS p", + "o u", + "Ġat t", + "Ġs elf", + "Ġab out", + "eng th", + "Ġe l", + "ĠR e", + "x im", + "Ġcon ditions", + "ud e", + "ĠA t", + "w here", + "m ed", + "Ġne ed", + "ir on", + "Ġp op", + "Ġresul t", + "Ġpo int", + "Ġl o", + "Ġal gorithm", + "Ġactiv ity", + "le q", + "ple ment", + "ĠR es", + "Ġsy m", + "on str", + "at ures", + "Ġim pro", + "f or", + "Ġgener al", + "it er", + "Ġex pl", + "## #", + "Ġd om", + "Ġt ri", + "m in", + "Ġdistrib ution", + "Ġt r", + "ĠThe re", + "os s", + "u ce", + "math rm", + "ul l", + "E R", + "re g", + "Ġp e", + "Ġto tal", + "Ġle ad", + "= =", + "i od", + "Ġass um", + "Ġch ang", + "Ġg ra", + "M I", + "Ġcomp ut", + "Ġcom b", + "Ġin formation", + "Ġdes ign", + "Ġin iti", + "Ġf requ", + "im ension", + "c op", + "Ġproper ties", + "Ġconsid er", + "Ġlevel s", + "en e", + "Ġt ype", + "iv ed", + "ĠH e", + "epend ent", + "Ġap plic", + "Ġinv es", + "Ġpre vious", + "a w", + "Ġsp ace", + "Ġpro vid", + "h yl", + "Ġinves tig", + "Ġappro ach", + "ater ial", + "on se", + "lec ular", + "Ġparamet ers", + "Ġph ase", + "ul ations", + "ub l", + "b eta", + "Ġa v", + "Ġf lu", + "Ġpot ential", + "ĠThe se", + "s igma", + "l o", + "tim es", + "Ġop tim", + "is ion", + "Ġa ff", + "Ġme an", + "Ġbe havi", + "Ġv ol", + "ore m", + "ag ne", + "Ġdec re", + "tion al", + "Ġsol ution", + "Ġh uman", + "g er", + "Ġpa per", + "Ġcomp ar", + "Ġlow er", + "and ard", + "Ġcor rel", + "c ri", + "Ġcur rent", + "Ġd er", + "iss ion", + "ĠFig ure", + "Ġpro duc", + "Ġw ater", + "ĠT o", + "Ġth ose", + "Ġac id", + "Ġcan cer", + "Ġloc al", + "t on", + "Ġf low", + "Ġreg ion", + "Ġhe alth", + "Ġimport ant", + "og raph", + "ab l", + "Ġse lec", + "Ġg re", + "Ġin di", + "ad e", + "r id", + "Ġsh ould", + "b ased", + "Ġab ove", + "l d", + "Ġsystem s", + "ic ation", + "Ġ ed", + "Ġt yp", + "Ġph ys", + "o per", + "Ġcomp on", + "O N", + "Ġsu per", + "g a", + "hem ical", + "is k", + "op h", + "Ġh y", + "Ġanal y", + "in u", + "Ġt arget", + "ĠA d", + "Ġp at", + "g amma", + "Ġsam ples", + "Ġs l", + "Ġpar t", + "old s", + "Ġb el", + "im um", + "ĠI m", + "Ġdise ase", + "I I", + "is ts", + "i ver", + "Ġperform ance", + "ĠĠĠĠĠĠĠĠ ĠĠĠ", + "g le", + "Ġo x", + "nd om", + "ĠĠĠĠ Ġ", + "Ġbec ause", + "ay er", + "Ġr ange", + "Ġco un", + "Ġincre ased", + "oc h", + "on al", + "Ġver y", + "Ġd ynam", + "an ti", + "Ġad d", + "Ġin hib", + "Ġmethod s", + "id ence", + "in ical", + "ere nce", + "iv al", + "u le", + "Ġfact or", + "Ġf in", + "in ts", + "v iron", + "Ġs our", + "ver age", + "e qu", + "Ġe ar", + "Ġshow ed", + "it es", + "Ġperform ed", + "Ġre se", + "ĠE n", + "Ġspec ies", + "A C", + "ĠC l", + "h ip", + "til de", + "i o", + "at ely", + "T h", + "od y", + "Ġincre ase", + "ĠP h", + "âĢ Ŀ", + "Ġshow s", + "ĠA c", + "Ġp ost", + "ord ing", + "enc es", + "o y", + "n er", + "Ġresp onse", + "Ġocc ur", + "r ho", + "Ġper iod", + "ar s", + "Ġre d", + "ĠO n", + "Ġd ensity", + "Ġexam ple", + "g et", + "Ġre al", + "ĠC ount", + "ac y", + "Ġp ower", + "Ġab s", + "it al", + "Ġpr im", + "âĢ IJ", + "Ġdef ined", + "Ġn ormal", + "a j", + "Ġin st", + "Ġal low", + "Ġposs ible", + "Ġv is", + "Ġre ported", + "Ġsign al", + "the ta", + "Ġd en", + "ab les", + "Ġde g", + "Ġindi vid", + "agne tic", + "Ġgroup s", + "a e", + "ar row", + "Ġst at", + "Ġmechan ism", + "os p", + "m er", + "ot her", + "Ġpro t", + "Ġc ases", + "Ġc r", + "Ġt e", + "Ġinte gr", + "et s", + "Ġdevelop ment", + "Ġra ndom", + "Ġinv ol", + "Ġinclud ing", + "Ġ err", + "gr am", + "Ġpartic ular", + "ep s", + "Ġst andard", + "pos ition", + "Ġcont rib", + "se qu", + "Ġman y", + "Ġf urther", + "Ġsignificant ly", + "at ors", + "ur b", + "Ġag ain", + "b ar", + "Ġwith out", + "Ġse ver", + "Ġto p", + "re t", + "l ed", + "Ġmat rix", + "Ġspec ific", + "ate g", + "Ĩ Ĵ", + "Ġdirec t", + "Ġsam ple", + "Ġthe m", + "S A", + "o int", + "Ġro le", + "Ġchang es", + "rac tion", + "Ġs um", + "Ġindivid ual", + "I N", + "Ġim mun", + "c ed", + "o h", + "Ġstr ong", + "Ġe p", + "Ġline ar", + "u ally", + "d elta", + "w ay", + "as ing", + "Ġt im", + "Ġv i", + "is on", + "Ġfunc tions", + "Ġam ong", + "Ġse e", + "ere st", + "Ġgrow th", + "Ġr ati", + "ĠS c", + "ix ed", + "R NA", + "e ed", + "ta u", + "Ġ ent", + "Ġd r", + "o res", + "Ġappro xim", + "f ul", + "Ġre le", + "Ġfact ors", + "Ġdisc uss", + "Ġph ot", + "Ġpro posed", + "er o", + "ome ga", + "Ġf our", + "as tic", + "Ġyear s", + "hes is", + "iqu e", + "Ġm aterial", + "Ġb re", + "Ġpro f", + "ĠA p", + "Ġne g", + "Ġb u", + "Ġass ess", + "ĠâĢ ľ", + "Ġv ir", + "at ter", + "Ġdescrib ed", + "istic s", + "Ġcomp os", + "a z", + "str uc", + "Ġt um", + "par tial", + "a f", + "Ġwh o", + "at al", + "Ġdem onstr", + "anc es", + "y t", + "Ġrem ain", + "Ġl ess", + "Ġpos itive", + "om ic", + "Ġs ince", + "og n", + "Ġcon dition", + ": :", + "Ġdo es", + "ti ce", + "os ph", + "Ġpro v", + "ĠC O", + "Ġr at", + "Ġterm s", + "b ox", + "Ġt ak", + "Ġpat tern", + "al e", + "Ġn an", + "ul es", + "Ġm ut", + "is hed", + "Ġrel ated", + "Ġthe ory", + "b ol", + "c dot", + "viron ment", + "a ir", + "i vers", + "ĠA r", + "Ġï £", + "ress ed", + "Ġâī ¤", + "ĠM et", + "I D", + "ul ts", + "ĠÎ ²", + "Ġd at", + "pos e", + "Ġor ig", + "Ġret urn", + "Ġch ange", + "Ġl arg", + "a u", + "ac es", + "Ġare a", + "Ġgen es", + "A S", + "Ġh ydro", + "Ġcons ist", + "m an", + "Ġrese arch", + "ĠD e", + "Ġor gan", + "as k", + "Ġb ack", + "Ġfollow s", + "un g", + "ro ll", + "Ġequ ation", + "pl ied", + "t r", + "Ġcorrespond ing", + "od es", + "es ted", + "Ġrel ations", + "n al", + "Ġf r", + "Ġlim it", + "m it", + "Ġof f", + "ut ed", + "Ġr isk", + "re ad", + "Ġkn own", + "pl it", + "tiv ity", + "Ġsequ ence", + "Ġconsid ered", + "x i", + "ĠM od", + "v ity", + "Ġn uc", + "c le", + "ic es", + "Ġl ength", + "Ġsever al", + "s ing", + "o ot", + "n ot", + "Ġst ress", + "ĠI f", + "C T", + "ro ph", + "Ġcom mun", + "Ġcl ust", + "ĠL e", + "m e", + "ant um", + "Ġm emb", + "Ġl ab", + "Ġev en", + "Ġinf lu", + "c k", + "Ġà Ĺ", + "Ġl og", + "v ing", + "es ts", + "Ġh is", + "an k", + "ĠI nd", + "ac tions", + "ft y", + "m od", + "Ġre view", + "th ough", + "Ġeff ici", + "Ġm ap", + "in fty", + "Ġbe ing", + "l and", + "Ġcl inical", + "Ġmeasure d", + "er ing", + "ĠT able", + "Ġs he", + "se e", + "Ġs ection", + "Ġav ail", + "om en", + "Ġv ers", + "Ġd el", + "it her", + "er ation", + "Ġh and", + "Ġcont inu", + "Ġcon n", + "h ors", + "ra d", + "Ġf am", + "Ġle ar", + "Ġiniti al", + "y stem", + "Ġg e", + "ĠâĢ ²", + "Ġc irc", + "Ġp ubl", + "ĠI s", + "Ġv ia", + "Ġcom mon", + "if e", + "Ġm ark", + "Ġe ver", + "ar c", + "b ig", + "er tain", + "\\ \\", + "v ar", + "A s", + "ros cop", + "Ġa ge", + "Ġh ow", + "ĠL et", + "str uct", + "Ġa verage", + "v ant", + "ĠS h", + "imension al", + "S C", + "ap e", + "n u", + "Ġl oss", + "as on", + "id es", + "Ġpop ulation", + "Ġdom ain", + "ind ing", + "w e", + "A L", + "Ġacc ur", + "et y", + "Ġc aus", + "D elta", + "rap y", + "Ġpro m", + "tim e", + "Ġint ro", + "Ġmulti ple", + "Ġconst ant", + "pl ing", + "in o", + "aj or", + "i or", + "ab ol", + "de f", + "Ġpo ints", + "ver se", + "n ame", + "ĠS e", + "it or", + "P ro", + "ar m", + "Ġt iss", + "Ġf ib", + "Ġg raph", + "Ġc all", + "atis f", + "Ġcon duc", + "de x", + "ĠN e", + "Ġp ers", + "er n", + "C R", + "ang le", + "Ġfrequ ency", + "A P", + "Ġpresent ed", + "am p", + "Ġbe fore", + "ord s", + "Ġin put", + "Ġâ ĨĴ", + "Ġpartic ip", + "O R", + "Ġch ild", + "Ġc re", + "ffici ent", + "Ġse par", + "ur ation", + "Î ±", + "Ġex ist", + "is ed", + "Ġl ight", + "im al", + "** **", + "ĠD NA", + "he l", + "Ġint erest", + "b f", + "k e", + "Ġcol lec", + "Ġt rain", + "a i", + "ĠP l", + "ĠÎ »", + "ĠC o", + "Ġim age", + "Ġh yp", + "om a", + "Ġwe ight", + "Ġc ross", + "r t", + "Ġdiffere nce", + "Ġfe atures", + "med i", + "t ype", + "Ġp ress", + "I C", + "Ġthe rm", + "Ġst ates", + "u str", + "ti ll", + "Ġh ist", + "Ġrati o", + "ag ing", + "ĠA ll", + "Ġhe l", + "b on", + "Ġbehavi or", + "Ġp ri", + "Ġsy nt", + "end ed", + "ĠIn t", + "t t", + "Ġvari ous", + "rec t", + "Ġpre c", + "Ġtim es", + "M S", + "Ġanaly z", + "Ġc are", + "m at", + "Ġal ong", + "Ġp ur", + "ati vely", + "Ġst ar", + "j ects", + "i i", + "ist ance", + "ĠThe n", + "A N", + "Ġparamet er", + "ul ate", + "Ġever y", + "Ġs atisf", + "Ġdeterm ined", + "in a", + "ran e", + "Ġpa ir", + "o ol", + "T able", + "Ġth us", + "ogen e", + "ĠÏ Ĩ", + "Ġpro gram", + "as c", + "Ġen vironment", + "M P", + "Ġre ad", + "Ġac h", + "Ġpres ence", + "Ġm ice", + "F or", + "Ġpro duction", + "Ġdifferen ces", + "Ġprov ide", + "st e", + "am es", + "ĉ Ġ", + "Ġ ±", + "ro up", + "Ġelect ron", + "Ġhy per", + "b it", + "ĠR ec", + "Ġv ector", + "ub le", + "ran gle", + "Ġw r", + "w ide", + "Ġâ Ĭ", + "rac k", + "ry st", + "Ġin j", + "eg a", + "Ġw he", + "ps ilon", + "Ġagain st", + "Ġdi agn", + "Ġh om", + "Ġach ie", + "n s", + "Ġre ce", + "---- ----", + "Ġavail able", + "in f", + "Ġs uc", + "Ġg u", + "Ġm ajor", + "ĠTh us", + "w are", + "Ġsup port", + "l or", + "Ġexperim ental", + "ĠM o", + "Ġconcent ration", + "tic s", + "Ġn ec", + "Ġp hen", + "s q", + "Ġcl os", + "s ub", + "Ġkn ow", + "Ġform ation", + "Ġd id", + "ous e", + "in ary", + "ic t", + "ĠC D", + "Th is", + "l ess", + "Ġne ar", + "Ġimpro ve", + "ab il", + "Ġre ve", + "Ġexperim ents", + "i ence", + "ul a", + "ore d", + "Ġ unc", + "_ _", + "Ġap plied", + "Ġre duced", + "Ġdet ail", + "st and", + "Ġch o", + "om y", + "Ġcalc ulated", + "Ġen h", + "L ES", + "it ro", + "Ġresp ons", + "Ġ est", + "Ġm i", + "Ġco e", + "ĠThere fore", + "ĠM ore", + "b l", + "anc ed", + "um e", + "Ġb and", + "Ġac t", + "Ġe ither", + "om es", + "ĠG en", + "v are", + "E T", + "re en", + "ĠP ar", + "ĠS im", + "Ġidentif ied", + "Ġinter action", + "Ġm ade", + "Ġsour ce", + "ti s", + "ot s", + "m ega", + "Ġs erv", + "m s", + "al ysis", + "v ent", + "en se", + "g l", + "Ġl ines", + "Ġapp ear", + "ti f", + "Ġf ree", + "om s", + "in ing", + "ere n", + "Ġch ann", + "vare psilon", + "s im", + "Ġco u", + " °", + "Ġerr or", + "Ġqu anti", + "ĠE q", + "b y", + "ĠI I", + "te x", + "ĠS ch", + "sq rt", + "oc us", + "Ġde v", + "qu ad", + "ter s", + "Ġrelations hip", + "ol l", + "Ġg o", + "Ġw ave", + "Ġle ft", + "w ays", + "h i", + "Ġr ight", + "ob al", + "Ġd own", + "u k", + "Ġcol l", + "Ġm agnetic", + "Ġpro g", + "dot s", + "Ġstr ateg", + "b s", + "unc tion", + "Ġen c", + "Ġc lear", + "Ġco st", + "ge b", + "et ter", + "MI LES", + "lam m", + "Ġm ust", + "Ġeff ective", + "Ġex c", + "Ġpl as", + "Ġsugg est", + "i tions", + "Ġle ast", + "y ing", + "ly ing", + "Ġl ik", + "O mega", + "ak ing", + "Ġmax imum", + "Ġrel ative", + "à ©", + "Ġacc ording", + "i ent", + "Ġw ay", + "Ġs em", + "at ural", + "l ike", + "res h", + "ĠM e", + "P s", + "ĠT rans", + "is c", + "Ġp rac", + "Ġr un", + "Ġcon ver", + "Ġs k", + "Ġy ield", + "ge q", + "ab ly", + "Ġanti b", + "iz ing", + "Î ²", + "m ission", + "Ġn ow", + "Ġdet ection", + "el oc", + "Ġg et", + "er t", + "Ġvari ables", + "Ġop en", + "Ġpress ure", + "Ġst rain", + "um ent", + "ĠF urther", + "Ġqu antum", + "Ġim plement", + "Ġear ly", + "Ġfr ame", + "Ġsh ort", + "Ġdr ug", + "Ġrequi red", + "P S", + "Ġm y", + "Ġm uch", + "Ġm em", + "C C", + "Ġqu ality", + "Ġprotein s", + "Ġl ayer", + "Ġqu es", + "Ġre cept", + "Ġhe re", + "Ġpro ced", + "ure d", + "Ġdevelop ed", + "Ġpos ition", + "r um", + "Ġl at", + "Ġincre asing", + "E M", + "Ġmeasure ments", + "Ġb en", + "Ġis ol", + "w h", + "T o", + "Ġval id", + "Ġfunction al", + "em ma", + ".. .", + "or ld", + "ri es", + "Ġprob ability", + "ĠN ew", + "Ġm m", + "O S", + "A D", + "ĠÎ ´", + "Ġscal e", + "ĠF e", + "ĠThe orem", + "ĠQ u", + "Ġcompon ents", + "Ġbl ood", + "ĠÏ ĥ", + "ac c", + "Ġb etter", + "Ġst ep", + "ĠÎ ³", + "Ġf ac", + "ane ous", + "Ġlo ad", + "Ġmet abol", + "Ġev olution", + "s on", + "re am", + "Ġe as", + "ir d", + "d imensional", + "b or", + "Ġm us", + "Ġequ ations", + "ps i", + "ord er", + "ol ar", + "Ġnum er", + "Ġk ey", + "or th", + "Ġsim ple", + "if t", + "cal e", + "Ġin dex", + "ĠâĢ ĵ", + "Ġconcent r", + "g es", + "Ġneg ative", + "Ġv eloc", + "Ġa x", + "ĠE ff", + "Ġfin ite", + "Ġ ill", + "ch ing", + "Ġpati ent", + "eps ilon", + "Ġm en", + "Ġc ri", + "I S", + "C l", + "Ġcon cl", + "ĠÎ ¸", + "ib ility", + "Ġsym met", + "ent er", + "Ġdist ance", + "Ġpol ym", + "igh ts", + "Ġc ult", + "Ġpe ak", + "Ġac ross", + "in ition", + "Ġle t", + "Ġcon struc", + "Ġinclud ed", + "Ġh owever", + "Ġreg ions", + "Ġlear ning", + "Ġev idence", + "in ally", + "Ġne ut", + "it ation", + "Ġwhe ther", + "Ġout put", + "ĠS ection", + "Ġg ood", + "I T", + "u ation", + "Ġtyp es", + "b m", + "c os", + "w ith", + "l im", + "o tic", + "Ġs till", + "Ġd ays", + "Ġstud ied", + "Ġim ages", + "b le", + "Ġar g", + "line ar", + "Ġprocess es", + "Ġw id", + "Ġtrain ing", + "Ġind ependent", + "pl ac", + "Ġres id", + "Ġsuc cess", + "Ġnuc le", + "G F", + "le t", + "pl oy", + "Ġtum or", + "G amma", + "Ġthere fore", + "r ast", + "Ġf ocus", + "as h", + "Ġbel ow", + "ial ly", + "Ġcompar ison", + "Ġad j", + "Ġl ike", + "Ġmo lecular", + "ri ed", + "Ġf it", + "ĠD i", + "l og", + "Ġpl ay", + "w ork", + "ec tions", + "Ġelect ro", + "u it", + "m ore", + "Ġm ight", + "Ġanal ys", + "Ġme ans", + "Ġcorrel ation", + "k n", + "Ġcont roll", + "I V", + "C h", + "p ec", + "ra g", + "Ġm agn", + "Ġphys ical", + "I ON", + "Ġreve al", + "Ġph osph", + "Ġr ates", + "Ġlarg er", + "Ġs tim", + "Ġso ft", + "Ġcomp ound", + "b e", + "ch i", + "ĠN o", + "Ġimp act", + "t or", + "Ġprim ary", + "oc ial", + "Ġapplic ation", + "Ġsol utions", + "d uce", + "Ġcharacter istics", + "Ġele ments", + "Ġvi ew", + "Ġl ater", + "ut ure", + "Ġfam ily", + "ri al", + "Ġtrans cri", + "or ption", + "Ġs w", + "C D", + "E D", + "Ġem b", + "Ġz ero", + "ol s", + "Ġl ife", + "ce p", + "ĠL i", + "th s", + "Ġser ies", + "Ġa round", + "Ġtrans ition", + "ĠC or", + "ĠâĪ Ĥ", + "Ġdat as", + "Ġ her", + "ĠB y", + "A M", + "sp ec", + "ol es", + "ograph y", + "t le", + "ĠC ar", + "al le", + "Ġest abl", + "ag ement", + "Ġsc hem", + "g round", + "Ġf ail", + "Ġexp ected", + "Ġrequi re", + "ar ray", + "Ġexperim ent", + "Ġele ment", + "Ġne u", + "Ġgener ated", + "Ġs ite", + "ĠCon t", + "ĠR NA", + "er al", + "Ġcont ent", + "Ġb acter", + "l er", + "Ġtrans fer", + "ul f", + "right arrow", + "an y", + "ĠS ince", + "in duced", + "Ġre action", + "he ck", + "Ġstruct ures", + "Ġcoun t", + "Ġdeterm ine", + "z ym", + "ĠB l", + "Ġunder stand", + "oc al", + "Ġsy n", + "Ġpol y", + "ur y", + "Ġb est", + "Ġf ixed", + "ren g", + "Ġc hemical", + "Ġtiss ue", + "Ġp ul", + "Ġbound ary", + "is ing", + "Ġb ro", + "atis tical", + "ic ity", + "s k", + "r ing", + "Ġl ast", + "Ġchild ren", + "r im", + "Ġre duction", + "Ġsp in", + "Ġb ody", + "oper ator", + "v ari", + "Ġd iv", + "ym bol", + "Ġm al", + "Ġsp ati", + "a h", + "ĠB i", + "b ack", + "s y", + "Ġse en", + "ĠW ith", + "id s", + "plic ations", + "Ġnec ess", + "Ġs ide", + "Ġb rain", + "Ġf ew", + "Ġapplic ations", + "ut es", + "ac hes", + "Ġac tive", + "var phi", + "ter m", + "Ġm om", + "ivers ity", + "Ġf inal", + "led ge", + "Ġdynam ics", + "av ing", + "er c", + "orph ism", + "on es", + "o ff", + "p m", + "Ġac tion", + "Ġn atural", + "ĠG e", + "Ġy ou", + "le x", + "ĠĠĠĠ ĠĠ", + "s tit", + "Ġg as", + "Ġm ake", + "Ġin duced", + "ĠA fter", + "ĠW h", + "Ġcompon ent", + "Ġinf ection", + "ĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠ", + "Ġconf ir", + "ig en", + "ĠS ystem", + "tic le", + "Ġprovid ed", + "tern al", + "b ers", + "O D", + "ĠIn ter", + "ot t", + "av es", + "ĠSt ud", + "p y", + "Ġres istance", + "ĠS ur", + "at ch", + "Ġd im", + "Ġinter p", + "Ġcy cl", + "on t", + "it ing", + "A G", + "Ġequ ival", + "ot ype", + "Ġprevious ly", + "Ġaddition al", + "out h", + "Ġim pl", + "Ġ ion", + "Ġ ir", + "Ġc op", + "Ġh al", + "Ġactiv ation", + "l angle", + "Ġf ull", + "S S", + "ĠO p", + "id d", + "Ġpro of", + "Ġproblem s", + "Ġtrans form", + "Ġinter actions", + "Ġsup p", + "d es", + "ĠR eg", + "operator name", + "eg in", + "Ġc ryst", + "Ġincre ases", + "ron ic", + "Ġad ap", + "in ant", + "Ġveloc ity", + "ĠAs s", + "iqu es", + "Ġcontinu ous", + "ĠCom p", + "ĠPro per", + "Ġpri or", + "or b", + "Ġno vel", + "Ġbl ock", + "Ġvol ume", + "Ġreg ard", + "omet ry", + "E C", + "Ġresul ting", + "ĠO r", + "Ġcar bon", + "are nt", + "Ġb inding", + "i j", + "Ġac cess", + "Ġwe ak", + "Ġun it", + "Ġ ide", + "\" \"", + "Ġc m", + "Ġcri tical", + "Ġresp ect", + "t rans", + "Ġâī ¥", + "Ġs al", + "e ad", + "Ġsim ulation", + "Ġcap ac", + "iti vity", + "Ġrec ord", + "ra k", + "Ġne ur", + "on ic", + "op le", + "Ġm g", + "Ġst reng", + "er ve", + "Ġre duc", + "Ġp ass", + "ord in", + "ex p", + "j ective", + "ens or", + "Ġpartic les", + "Ġa ir", + "Ġl ink", + "ĠÏ Ħ", + "Ġl ist", + "c in", + "ĠO ur", + "p ri", + "ve re", + "ib r", + "if orm", + "Ġexpl ain", + "Ġf em", + "Ġu til", + "S t", + "over line", + "Ġof ten", + "er y", + "op e", + "ĠU sing", + "b egin", + "Ġdifferen ti", + "per s", + "s elf", + "iz es", + "Ġconcentr ations", + "I R", + "ĠS up", + "Ġbas is", + "Ġinclud e", + "ĠB ond", + "Ġext rac", + "ĠMet hod", + "ĠD ata", + "ĠD ef", + "w n", + "Ġnetwork s", + "ign ed", + "âĢ ¢", + "Ġexp ressed", + "Ġcont rast", + "es is", + "c ol", + "in ter", + "p id", + "Ġd ri", + "Ġdef ine", + "Ġinflu ence", + "Ġselec ted", + "E L", + "Ġcontain ing", + "Ġs il", + "geb ra", + "re at", + "b olds", + "Ġinvestig ated", + "ĠC ol", + "ym met", + "yt es", + "Ġmo lec", + "Ġinvol ved", + "Ġd ay", + "Ġch ain", + "ĠMore over", + "Ġdi ag", + "Ġan g", + "Ġlik ely", + "Ġspect rum", + "Ġder iv", + "bolds ymbol", + "Ġhel p", + "ĠA m", + "Ġtre ated", + "Ġvari able", + "ell ular", + "ĠD es", + "ap s", + "Ġn m", + "ĠÏ ģ", + "ĠW hen", + "Ġhigh ly", + "am in", + "Ġwh at", + "rel ated", + "Ġch rom", + "Ġsur v", + "ĠAn alysis", + "Ġs it", + "f act", + "od ing", + "Ġproduc t", + "Ġev ents", + "r as", + "ĠP er", + "ma x", + "ĠA g", + "con t", + "ic ro", + "Ġad v", + "Ġcall ed", + "Ġdeg ree", + "A B", + "T R", + "Ġse g", + "ĠC an", + "Ġdemonstr ated", + "w ise", + "Ġ ve", + "ĠC a", + "Ġdet ected", + "c o", + "Ġder ived", + "Ġex hib", + "Ġgl obal", + "al ax", + "ul ating", + "A l", + "ang u", + "b o", + "Ġrec om", + "Ġfe ature", + "d ependent", + "Ġro t", + "ven tion", + "Ġrem ov", + "Ġw ind", + "Ġaccur acy", + "s ize", + "Ġsum m", + "Ġmeasure ment", + "Ġfield s", + "ward s", + "Ġl iter", + "atal y", + "ĠSt r", + "Ġre port", + "Ġcent ral", + "Ġs qu", + "Ġthe rapy", + "he st", + "Ġfe ed", + "S MILES", + "ĠA N", + "Ġs ites", + "âĢ ²", + "our s", + "om al", + "Ġl ip", + "Ġanalyz ed", + "Ġ °", + "Ġwe e", + "t em", + "Ġan other", + "il es", + "Ġcomple te", + "Ġne xt", + "ĠO ne", + "b i", + "ri p", + "st ate", + "ĠMod el", + "Ġfind ings", + "ĠP re", + "Ġrec ent", + "asc ular", + "Ġestim ate", + "Ġmechanism s", + "ĠRes ults", + "Ġparticip ants", + "Ġen g", + "m ost", + "omet ric", + "Ġequ al", + "Ġro b", + "Ġpol ar", + "Ġgene tic", + "Ġb o", + "Ġre st", + "ĠÏ Ģ", + "Ġrel ation", + "Ġques tion", + "ep ti", + "Ġdiff ic", + "em s", + "Ġf uture", + "if y", + "Ġmod e", + "Ġmemb rane", + "Ġhe at", + "A ut", + "d ing", + "Ġox id", + "Ġconf ig", + "plic ation", + "ĠM on", + "alle l", + "id ed", + "Ġdirec tion", + "pl ed", + "Ġprovid es", + "Ġindic ate", + "Ġset s", + "Ġtechn ique", + "Ġm ac", + "Ġhyp ot", + "Ġat ten", + "Ġev ent", + "Ġst age", + "Ġn ode", + "Ġref erence", + "Ġup per", + "Ġtechn iques", + "Ġgre ater", + "Ġdirect ly", + "Ġare as", + "Ġdis s", + "h or", + "ĠP ol", + "Ġevalu ation", + "Ġpattern s", + "ĠA bstract", + "Ġvir us", + "ve y", + "P C", + "Ġw omen", + "ri ent", + "Ġplas ma", + "Ġpro duced", + "ĠÎ µ", + "Ġanalys es", + "ĠS ub", + "Ġset ting", + "Ġmom ent", + "Ġtherm al", + "Ġoptim al", + "Ġtak en", + "Ġrec ogn", + "Ġvari ation", + "ĠL emma", + "Ġs us", + "f rak", + "ĠI L", + "Ġproced ure", + "h ood", + "Ġa im", + "ar ies", + "math frak", + "Ġpl ant", + "b rid", + "e lect", + "Ġvis ual", + "ur s", + "c ence", + "Ġf ive", + "Ġspati al", + "Ġrecept or", + "Ġindic ated", + "Ġ ess", + "Ġconsist ent", + "Ġt urn", + "tic es", + "Ġex ists", + "ect ors", + "Ġen zym", + "mer ic", + "Ġno ise", + "Ġgro und", + "Ġestim ated", + "el ine", + "Ġchann el", + "ti tion", + "Ġdiscuss ed", + "om er", + "ot es", + "Ġex act", + "ĠS ec", + "Ġt ake", + "Ġknow ledge", + "Ġpro p", + "Ġinf lamm", + "Ġdo uble", + "I t", + "Ġcon text", + "ĠM ed", + "M A", + "Ġf at", + "am s", + "d ata", + "and s", + "Ġcar di", + "ĠFurther more", + "oc y", + "Ġobserv ations", + "app ing", + "ĠIn f", + "om ial", + "Ġpubl ic", + "Ġem ploy", + "Ġre ason", + "y gen", + "Ġfollow ed", + "Ġam ount", + "Ġc ertain", + "wh ich", + "ot yp", + "ĠC ell", + "Ġch all", + "Ġpartic le", + "am bda", + "Ġ ens", + "Ġpe ople", + "a ult", + "ĠU nd", + "ĠB e", + "um in", + "roscop y", + "M R", + "l ation", + "Ġrep e", + "Ġab le", + "ĠS o", + "ĠâĪ ŀ", + "Ġen ti", + "Ġmo ve", + "Ġt rac", + "C O", + "Ġhe ter", + "Ġsp eed", + "Ġeffici ency", + "Ġop tical", + "Ġcomb ination", + "en ess", + "Ġc hem", + "L E", + "app a", + "Ġdecre ase", + "Î ¼", + "p ed", + "n ote", + "ĠM ulti", + "Ġal tern", + "Ġassum e", + "ĠF orm", + "str ic", + "qu e", + "Ġis s", + "ur rent", + "Ġpr inc", + "Ġt ask", + "op s", + "Ġwhere as", + "C H", + "Ġreveal ed", + "Ġcan not", + "ac tive", + "en z", + "Ġf ore", + "Ġoper ator", + "Ġcol um", + "at in", + "Ġorig inal", + "Ġsmall er", + "Ġmaterial s", + "h ydro", + "Ġcur ve", + "Ġselec tion", + "ak es", + "Ġex pos", + "at s", + "ĠÏ ī", + "Ġp ack", + "Ġst ability", + "Ġover all", + "Ġm orph", + "Ġmet ric", + "Ġo l", + "Ġb ar", + "ĠI N", + "I M", + "c y", + "et hyl", + "S P", + "Ġrespons es", + "anc y", + "Ġl ay", + "spec ific", + "Ġv s", + "ag ed", + "Ġs ocial", + "Ġc ut", + "I P", + "Ġlim ited", + "enc ies", + "Ġprot oc", + "Ġcompos ition", + "ĠThe y", + "Ġnum bers", + "m box", + "Ġdecre ased", + "v ec", + "R O", + "Aut hors", + "Ġth ick", + "Ġco ordin", + "Ġm es", + "Ġaff ect", + "Ġcl ose", + "Ġtrans port", + "C A", + "re te", + "c ome", + "Ġcollec ted", + "ĠF rom", + "Ġcontain s", + "ch it", + "ĠD et", + "Ġflu x", + "over y", + "e u", + "a ff", + "Ġconduc ted", + "Ġcr iter", + "Ġliter ature", + "Ġmem ory", + "Ġsequ ences", + "Ġp an", + "plic it", + "Ġtr ue", + "Ġmed ium", + "Ġd am", + "i re", + "c ell", + "L et", + "ef ul", + "ĠA meric", + "Ġn odes", + "get her", + "Ġto gether", + "T P", + "Ġrat her", + "Ġaut hors", + "Ġs ch", + "Ġprocess ing", + "Ġspect ra", + "Ġevalu ated", + "al k", + "Ġred uce", + "ĠH igh", + "ĠC ons", + "Ġcy cle", + "or n", + "i ers", + "Ġpro por", + "or ies", + "r ate", + "Ġh ost", + "o oth", + "y nt", + "Ġsour ces", + "Ġindividual s", + "Ġacc ount", + "ĠAl though", + "Ġcor rec", + "Ġpl an", + "enti ally", + "Ġdist inc", + "Ġso il", + "Ġse arch", + "Ġman agement", + "Ġvers ion", + "âĢ Ķ", + "Ġf ig", + "ĠN ote", + "Ġhe ad", + "dition al", + "Ġbu ild", + "ĠG l", + "as is", + "g roup", + "Ġdis play", + "ĠUn iversity", + "oot note", + "amet er", + "min ist", + "o pl", + "ym ph", + "L ambda", + "Ġidentif y", + "ĠSt ere", + "Ġï Ģ", + "Ġpro l", + "our ce", + "ic ial", + "Ġsim ulations", + "Ġth resh", + "p oint", + "ear ch", + "ell ing", + "ĠA cc", + "Ġframe work", + "Ġstreng th", + "ĠA b", + "tic les", + "Ġc os", + "F ootnote", + "r u", + "osp ital", + "Ġst able", + "Ġmo tion", + "Ġt ested", + "Ġt ests", + "as ter", + "l dots", + "C L", + "in ite", + "Ġspec ial", + "== ==", + "Ġappro aches", + "p ing", + "Ġcons um", + "S D", + "Ġj ust", + "k appa", + "Ġth ough", + "f aces", + "Ġra pid", + "ens ive", + "Ġnecess ary", + "Ġt ub", + "Ġfor ce", + "Ġbl ack", + "v olution", + "ĠAt om", + "ĠH ere", + "it ude", + "ens ions", + "ff er", + "r ich", + "Ġgiv es", + "Ġsh ape", + "Ġh ard", + "om p", + "Ġrepresent ation", + "l ing", + "ĠD ec", + "Ġnumer ical", + "Ġpl ace", + "Ġlead ing", + "Ġben ef", + "Ġreg ular", + "Ġclust er", + "Ġrel atively", + "Ġper cent", + "Ġaut om", + "Ġsym pt", + "ib ri", + "c hes", + "hen yl", + "c ar", + "Ġill ustr", + "por ts", + "em ic", + "Ġg ive", + "Ġcon ven", + "lec tion", + "ĠĠĠĠĠĠĠĠ ĠĠĠĠ", + "ĠA nd", + "Ġf ood", + "m ic", + "ograph ic", + "Ġc heck", + "Ġab ility", + "iqu id", + "Ġsub str", + "ĠâĪ Ĩ", + "Ġed ge", + "ĠP D", + "Ġclass ification", + "Ġsurv ival", + "ĠC al", + "er ate", + "Ġus eful", + "Ġcar ried", + "Ġint ensity", + "H E", + "oc enter", + "Ġpath way", + "Ġdef inition", + "Ġschem e", + "Ġsub sequ", + "ĠF irst", + "Ġcon sequ", + "ĠD iff", + "Ġinhib it", + "Ġam plit", + "as er", + "ĠN etwork", + "n ormal", + "ĠS T", + "Ġsol id", + "per im", + "com es", + "Ġcy t", + "od ies", + "I F", + "ra di", + "Ġm or", + "Ġc ore", + "B S", + "**** ****", + "Ġsoft ware", + "ĠG u", + "i red", + "id ent", + "Ġdiffic ult", + "us e", + "Ġadd ed", + "le y", + "Ġcaus ed", + "g ence", + "Ġb ase", + "## ##", + "ogen ic", + "f rom", + "Ġstat us", + "Ġassoci ation", + "ĠStere ocenter", + "Ġg alax", + "N O", + "angu age", + "Ġd imension", + "ogen esis", + "Ġem ission", + "Ġde ath", + "ul in", + "Ġag re", + "t urb", + "n abl", + "por al", + "Ġp or", + "Ġcomb ined", + "Ġalgorithm s", + "C s", + "Ġsens itivity", + "Ġallow s", + "Ġcapac ity", + "vers ion", + "Ġre stric", + "rom e", + "Ġexpos ure", + "h y", + "ann ing", + "Ġob ject", + "Ġc ode", + "f l", + "ro duction", + "res ents", + "r up", + "Ġte xt", + "ĠM at", + "Ġlead s", + "Ġres on", + "Ġproduc ts", + "Ġwh ole", + "Ġmat ter", + "P hi", + "op t", + "enc ing", + "ffici ents", + "n a", + "pec ially", + "Ġh aving", + "rop y", + "Ġunc ertain", + "en ari", + "r ical", + "Ġmin im", + "Ġorig in", + "u per", + "ĠN on", + "Ġevalu ate", + "Pro of", + "c ap", + "Ġsignal ing", + "Ġpolym er", + "tic ally", + "it ten", + "an tit", + "Ġus er", + "le vel", + "Ġmeas ures", + "Ġdynam ic", + "Ġmon ths", + "o ti", + "ra nd", + "Ġun til", + "Ġden ote", + "Ġnot e", + "Ġmain tain", + "Ġk in", + "sc ill", + "Ġim aging", + "Ġp ain", + "av y", + "Ġm it", + "ot he", + "Ġreg ul", + "kn own", + "Ġpl ot", + "nabl a", + "Ġf raction", + "w er", + "Ġstrateg y", + "Ġgre at", + "Ġdatas et", + "Ġun ique", + "C M", + "Ġt w", + "h an", + "ĠE u", + "and id", + "Ġback ground", + "Ġbro ad", + "il t", + "Ġimpro ved", + "Ġdiagn osis", + "i ous", + "Ġd ig", + "re m", + "er a", + "Ġex cl", + "Ġmet al", + "Ġs ix", + "Ġmin imum", + "us ions", + "e e", + "Ġcompound s", + "Ġas p", + "Ġe th", + "Ġdet ect", + "f erence", + "ĠÎ ·", + "Ġst atistical", + "ati ves", + "r is", + "Ġthe orem", + "ĠO F", + "w w", + "ar ily", + "ce ption", + "iv ing", + "Ġtest ing", + "Ġdiagn os", + "Ġrep resents", + "S igma", + "on ical", + "Ġequival ent", + "Ġbi om", + "Ġsub st", + "rain ts", + "ĠR ef", + "Ġsc ore", + "Ġd oc", + "Ġimpl ies", + "et er", + "Ġsynt hesis", + "il ibri", + "atter ing", + "C S", + "al se", + "Ġneu ro", + "Ġal though", + "ir us", + "met hyl", + "Ġtranscri ption", + "Ï Ģ", + "ĠMo lecular", + "Ġc ause", + "m ut", + "ĠI d", + "Î »", + "ad d", + "Ġpl ac", + "Ġag g", + "t ure", + "Ġl ack", + "Ġpredic tion", + "ra w", + "A n", + "Ġ ult", + "yn omial", + "Ġimmun e", + "il i", + "Ġpre p", + "Î ³", + "cl ass", + "Ġm ach", + "am ple", + "Ġres olution", + "Ġcou pling", + "se ud", + "Ġindic ates", + "Ġgener ation", + "Ġh ar", + "Ġf und", + "s cale", + "Ġe igen", + "ĠR el", + "ab or", + "ĠC H", + "e xt", + "am m", + "Ġcor rect", + "Ġsc reen", + "Ġstruct ural", + "Ġp H", + "Ġrele vant", + "Ġan gle", + "I G", + "Ġal gebra", + "hel ial", + "Ġw orld", + "Ġcur ves", + "ĠInt roduction", + "Ġth ird", + "Ġintro duced", + "B ig", + "n o", + "aus s", + "sub set", + "Ġtrans mission", + "Ġprof ile", + "ĠÎ ½", + "Ġes pecially", + "Ġatt rib", + "uc tion", + "Ġcoe fficients", + "Ġremain s", + "Ġne igh", + "os en", + "Ġrel i", + "Ġhig hest", + "Ġun iform", + "Ġf ar", + "chit ect", + "| |", + "Ġappro pri", + "ple x", + "ĠM ass", + "ogene ous", + "al es", + "Ġref er", + "Ġneed ed", + "Ġdifferen tial", + "ce ed", + "$ $", + "ynam ic", + "Ġse x", + "Ġspect ral", + "ch ar", + "P E", + "T S", + "Ġapproxim ately", + "val ue", + "Ġhal f", + "end ing", + "Ġgra di", + "Ġcoe fficient", + "ĠPh ys", + "Ġcon cer", + "Ġlab el", + "ir al", + "Ġchar ge", + "Ġox ygen", + "Ġde vi", + "Ġinter nal", + "Ġexp ans", + "lo ad", + "ĠS m", + "ran g", + "C on", + "ĠN a", + "Ġk e", + "Ġdi ab", + "ac hed", + "Ġloc ation", + "Ġvol t", + "ĠD isc", + "-- -", + "oc ytes", + "ore tical", + "Ġg ain", + "Ġmed i", + "ym pt", + "ot ed", + "ĠV al", + "Ġcommun ity", + "plement ary", + "Ġt ree", + "ĠT wo", + "Ġwh ose", + "Ġd one", + "am ine", + "Ġbi ological", + "in ks", + "Ġal most", + "Ġsl ight", + "Ġre pro", + "ģ Ħ", + "Ġthe rap", + "oc ation", + "Ġg ly", + "ĠE qu", + "Ġcol or", + "Ġn am", + "s ection", + "ĠE m", + "read y", + "H z", + "P D", + "f unction", + "ch ange", + "Ġprinc ip", + "Ġbec ome", + "ĠâĢ ĺ", + "Ġco ur", + "Ġloc ated", + "Ġr ang", + "in ity", + "Ġinter val", + "g in", + "Ġinvestig ate", + "f ree", + "Ġv itro", + "Ġsub set", + "Ġm ov", + "Ġpro ve", + "Ġl iver", + "ate gor", + "et es", + "Ġl ymph", + "d om", + "ĠE lect", + "Ġser um", + "Ġsc enari", + "end s", + "ĠF inally", + "Ġfil ter", + "I L", + "Ġab und", + "ment ation", + "im als", + "n um", + "enc ed", + "Ġproper ty", + "mat rix", + "ĠCom par", + "Ġl and", + "ĠCh ar", + "ress ive", + "ul us", + "Ġb one", + "E x", + "Ġradi ation", + "Ġsugg ested", + "ĠCom put", + "Ġthresh old", + "ĠA D", + "Ġh or", + "Ġin duc", + "Ġapproxim ation", + "Ġad minist", + "Ġor d", + "Ġl ung", + "Ġrece ived", + "Ġn orm", + "Ġestim ates", + "Ġl aw", + "Ġout comes", + "ĠP r", + "Ġdep th", + "Ġel se", + "Ġcontrib ution", + "he tic", + "Ġcons erv", + "Ġup on", + "Ġde ep", + "M D", + "Ġm el", + "Ġfil m", + "ilibri um", + "Ġo scill", + "ol ved", + "Ġbre ast", + "C P", + "ĠD ist", + "ric es", + "in ated", + "Ġoptim ization", + "Ġpredic ted", + "s f", + "d im", + "ĠS N", + "Ġav oid", + "Ġne ural", + "Ġw a", + "rop e", + "Ġdistrib utions", + "ox id", + "Ġsm ooth", + "p ath", + "Ġflu id", + "Ġs af", + "Ġcho ice", + "A A", + "Ġmolec ules", + "U S", + "Ġal ways", + "iv o", + "Ġreg ression", + "Ġsuccess ful", + "Ġw all", + "oun g", + "Ġactiv ities", + "Ġdepend ence", + "Ġrequi res", + "Ġpl ane", + "Ġdesign ed", + "P I", + "d own", + "Ġpop ulations", + "c or", + "medi ate", + "Ġd ose", + "Ġb ond", + "C o", + "ĠM an", + "Ġdiag ram", + "g s", + "Ġto ol", + "Ġisol ated", + "Ġvers us", + "ne y", + "Ġem erg", + "ĠA ut", + "a im", + "f ield", + "Ġexam ined", + "Ġs at", + "S M", + "ĠSp ec", + "Ġpar allel", + "is ation", + "Ġdistinc t", + "Ġpredic t", + "Ġf er", + "Ġunderstand ing", + "ĠSim ilar", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "ud es", + "Ġo rient", + "h ic", + "u z", + "Ġmod ified", + "ĠâĪ ¼", + "F F", + "The re", + "Ġtri al", + "x y", + "ger y", + "Ġal ready", + "def ine", + "m ing", + "ĠS D", + "Ġmon itor", + "Ġp sy", + "Ġbec omes", + "ist ry", + "ĠÎ ĵ", + "Ġh um", + "ri er", + "ess ion", + "Ġhist ory", + "à ¶", + "ĠÎ ¾", + "Ġestabl ished", + "Ġachie ved", + "es tern", + "Ï Ĩ", + "ĠH ence", + "Ġassess ment", + "ot or", + "Ġdescrib e", + "och ond", + "yl ation", + "st s", + "sp ace", + "Ġdise ases", + "j ection", + "Ġs low", + "Ġnon linear", + "p ly", + "m l", + "Ġemb ed", + "com p", + "Ġeffici ent", + "Ġoper ation", + "Ġcont act", + "o z", + "Ġinv ari", + "Ġcent er", + "Ġcon c", + "wide tilde", + "Ġbe am", + "Ġclos ed", + "ĠMethod s", + "Ġch ronic", + "al ing", + "Ġse vere", + "Ġform s", + "il it", + "s ide", + "p en", + "Ġb ran", + "o ud", + "tal ity", + "Ġmap s", + "ac ts", + "O L", + "P R", + "Ġ Í", + "s l", + "Ġinst ance", + "ul ly", + "Ġestim ation", + "Ġpl ate", + "Ġdev ice", + "ĠI II", + "s in", + "Ġpl ants", + "it tle", + "Ġpro duce", + "Ġhe nce", + "Ġn ature", + "Ġrele ase", + "ĠM in", + "ric t", + "Ġconn ected", + "ott om", + "ell ar", + "Ġform ed", + "Ġm ob", + "Ġcomput ed", + "Ġ RE", + "Ġpol ynomial", + "Ġl iquid", + "g n", + "Ġass ay", + "Ġman if", + "ĠS i", + "re nce", + "Ġax is", + "V ID", + "Ġsign als", + "Î ¸", + "to k", + "d s", + "Ġrat s", + "Ġt or", + "o lecular", + "c hed", + "Ġdesc ri", + "Ġexp on", + "Ġper turb", + "Ġgl uc", + "Ġcolum n", + "U L", + "Ġmain ly", + "Ġm ul", + "id er", + "ĠC R", + "Ġc ataly", + "Ġl aser", + "tion ed", + "d en", + "Ġsugg ests", + "f ig", + "Ġprop ag", + "or g", + "re p", + "Ġcharacter ized", + "olog ies", + "Ġacc um", + "Ġv ary", + "Ġcontroll ed", + "Ġup d", + "ĠB r", + "Ġenti re", + "Ġ @", + "â ģĦ", + "Ġ Ì", + "Ġdat ab", + "an o", + "am il", + "Ġadj ust", + "y e", + "p ression", + "eren ces", + "Ġess ential", + "ĠH ydro", + "ĠT r", + "Ġappropri ate", + "Ġform ula", + "Ġlat tice", + "Ġac ute", + "Ġus ually", + "it able", + "Ġm ar", + "Ġμ m", + "ĠU SA", + "Ġinc ub", + "oc ks", + "Ġp epti", + "idd le", + "Ġdec om", + "Ġdam age", + "Ġgen ome", + "Ġm ouse", + "c irc", + "Ġlay ers", + "Ġt rack", + "Ġto x", + "Ġre plac", + "Ġad vant", + "iz on", + "Ġrecord ed", + "Ġst art", + "Ġr ank", + "s er", + "ĠG ene", + "auss ian", + "ing u", + "Ġconst raints", + "f low", + "Ġm ig", + "P L", + "Ġinc or", + "ap pro", + "Ġf ast", + "Ġmus cle", + "Ġh ome", + "e q", + "ĠÏ Ī", + "Ġstrong ly", + "ĠEu rope", + "Ġsub jects", + "Ġob jects", + "t est", + "t ered", + "ĠWh ile", + "Ġsymmet ry", + "Ġquanti f", + "` `", + "Ġbre ak", + "ĠEx perim", + "Ġmi xt", + "< <", + "ĠCh ina", + "ĠId entif", + "Ġaff ected", + "Ġsecond ary", + "Ġin equ", + "in cl", + "E G", + "F T", + "Ġfail ure", + "ec tiv", + "Ġk m", + "Ġsam pling", + "Ġexpans ion", + "Ġprac tice", + "u ations", + "ogn itive", + "Ġdi et", + "Ġtemper atures", + "Ġcontrol s", + "Ġch osen", + "Ġgener ally", + "anc er", + "Ġdeg rad", + "ul i", + "s m", + "othe rapy", + "Ġto wards", + "ĠProper ties", + "Ġclust ers", + "Ġdel ay", + "Ġhe p", + "P A", + "ĠStud y", + "antit ative", + "Ġclass ical", + "ĠZ h", + "ĠÎ ©", + "ĠB o", + "Ġse ed", + "ĠStr uct", + "Ġtre nd", + "i ological", + "Ġconfir med", + "Ġdistrib uted", + "b ial", + "Ġn ame", + "C N", + "val ence", + "er ior", + "iv en", + "n ed", + "Ġbehavi our", + "as ks", + "g ra", + "m ark", + "Ġerr ors", + "ĠR ep", + "l ight", + "cri pt", + "I f", + "Ġc andid", + "Ġdepend s", + "ĠN ational", + "Ġh olds", + "Ġprotoc ol", + "ĠUn ited", + "Ġinter face", + "Ġexp ect", + "Ġï ģ", + "ĠH IV", + "Ġro ot", + "Ġsc attering", + "w ords", + "Ġobserv ation", + "ot op", + "Ġoccur s", + "our ces", + "p ite", + "ĠS te", + "Ġor th", + "Ġst ain", + "Ġst eps", + "Ġcomp are", + "Ġbas ic", + "Ġinhib ition", + "Ġsympt oms", + "ĠHe alth", + "Ġpubl ished", + "f old", + "Ġt un", + "Ġv ivo", + "Ġrec onstr", + "Ġm RNA", + "ic y", + "Ġhy brid", + "y r", + "Ġm ixed", + "v is", + "Ch I", + "Ġmed ical", + "Ġf rag", + "Ġan imals", + "Ġimport ance", + "Ġeng ine", + "ĠC T", + "Ġpair s", + "Ġb al", + "ĠE ar", + "her s", + "Ġsy nd", + "Ġar chitect", + "Ġidentif ication", + "Ġstrateg ies", + "Ġreg ulation", + "ĠL a", + "r or", + "Ġflu ores", + "ur ity", + "Ġcon cept", + "Ġatten tion", + "Ġtrans formation", + "uc le", + "ĠRes earch", + "Ġsim pl", + "Ġcult ure", + "ar ing", + "if ically", + "p ir", + "z e", + "P T", + "m osp", + "Ġsw it", + "Ġn or", + "Ġenh ance", + "Ġenvironment al", + "r ary", + "ĠM icro", + "Ġw ide", + "op ath", + "au ge", + "z eta", + "Ġst e", + "ĠE l", + "Ġw ords", + "Ġnuc lear", + "Ġl anguage", + "Ġdetail s", + "op ar", + "ĠR ed", + "w ater", + "Ġc ategor", + "Ġf ile", + "Ġco ver", + "Ġachie ve", + "à ¡", + "um m", + "Ġl ig", + "Ġsur vey", + "Ġext ended", + "l ab", + "ĠIn c", + "Ġdis pers", + "Ġrecom m", + "ĠB ased", + "Ġabs ence", + "Ġconstruc tion", + "Ġpo or", + "Ġvolt age", + "Ġcell ular", + "Ġmor tality", + "Ġshow ing", + "Ġprol if", + "m p", + "Ġneur ons", + "Ġsup ported", + "Ġpre vent", + "el i", + "ox y", + "ic a", + "Ġf ully", + "Ġen ough", + "o times", + "ĠM R", + "Ġb ul", + "Ġphen omen", + "F A", + "Ġdec ision", + "Ġd ual", + "Ġdec ay", + "Ġo wn", + "Ġus es", + "Ġchall eng", + "Ġadd ress", + "O C", + "tiv ation", + "Ġm ill", + "Ġmod es", + "at us", + "ic tion", + "Ġabs orption", + "Ġep it", + "Ġconst ra", + "Ġagre ement", + "ĠA f", + "Ġbi as", + "ud ed", + "Ġpar ts", + "Ġv an", + "Ġcol on", + "Ġex ternal", + "Ġthe oretical", + "as i", + "Ġl es", + "abil ities", + "L A", + "tt ps", + "Ġinst ead", + "Ġmemb ers", + "+ +", + "Ġrec ently", + "Ġprep ared", + "Ġar ticle", + "d ay", + "Ġext ract", + "Ġâ İ", + "Ġpath ways", + "Ï Ħ", + "m id", + "or age", + "Ġcommun ication", + "Ġacc el", + "Ġun its", + "iti s", + "ynt hesis", + "Ġamplit ude", + "ri e", + "ult aneous", + "ĠL ear", + "ec ause", + "d o", + "e ff", + "Ġex plicit", + "Ġcriter ia", + "b re", + "Ġex ec", + "Ġmechan ical", + "er os", + "ĠCon cl", + "ĠE xt", + "Ġclass es", + "Ġlong er", + "Ġcalc ulations", + "eu tic", + "oci ated", + "ar di", + "Ġcour se", + "Ġpar tial", + "Ġsens or", + "Ï ĥ", + "Ġoper ators", + "ĠAmeric an", + "Ġm M", + "Ġv acc", + "oc c", + "ic on", + "Ġout come", + "Ġanal og", + "Ġthick ness", + "Ġre ach", + "Ġassum ed", + "end er", + "Ġm ale", + "S E", + "Ġint ra", + "Ġimplement ation", + "em ia", + "Ġenh anced", + "b ility", + "Ġeas ily", + "um p", + "Ġcar cin", + "os a", + "Ġcorrespond s", + "ne g", + "Ġmagn itude", + "con st", + "Ġl atter", + "Ġrepresent ed", + "Ġs ed", + "Ġparticular ly", + "Ġwr itten", + "par t", + "Ġo il", + "ber g", + "ĠB ar", + "Ġd ys", + "ĠS ome", + "ĠM ar", + "Ġaltern ative", + "ĠG erm", + "Ġgener ate", + "Ġcon struct", + "ian s", + "st ream", + "Ġe c", + "oc hemical", + "ib ration", + "oper ative", + "is ter", + "Ġrob ust", + "t re", + "Ġmodel ing", + "or ing", + "es e", + "d ed", + "ide o", + "Ġhydro gen", + "um ents", + "Ġdemonstr ate", + "Ġcorrel ated", + "Ġsystem atic", + "Ġsur gery", + "Ġindic ating", + "Ġhypot hesis", + "y ear", + "mit ted", + "Ġst ars", + "Ġprof iles", + "Ġcons ists", + "t ri", + "Ġdepend ent", + "ish ing", + "t op", + "Ġhe art", + "at ically", + "Ġinj ury", + "Ġqu ad", + "Ġwee ks", + "ut ing", + "ĠT e", + "Ġid enti", + "Ġgradi ent", + "Ġcalc ulation", + "Ġ ur", + "R T", + "z ation", + "Ġed uc", + "en ing", + "P P", + "z ed", + "us h", + "Ġcharacter istic", + "Ġstrain s", + "et h", + "Ġdi vers", + "âĪ Ī", + "oid s", + "ol ic", + "Ġinterp ret", + "K ey", + "Ġatt ack", + "p ective", + "Ġlab or", + "Ġmet ast", + "N F", + "Ġtiss ues", + "Ġradi us", + "ĠE ach", + "Ġc at", + "Ġd on", + "Ġele v", + "Ġass emb", + "r ons", + "Ġar bit", + "Ġpan el", + "Ġg rid", + "Ġt able", + "roscop ic", + "Ġc le", + "ĠIn tern", + "ob acter", + "Ġassum ption", + "ĠCO VID", + "Ġbound ed", + "Ġother s", + "Ġsch ool", + "Ġh ospital", + "lec ted", + "ĠC u", + "à Ĺ", + "Ġcomple t", + "Ġwid th", + "Ġl inks", + "p o", + "ol low", + "Ġn ut", + "Ġappear s", + "row n", + "a ro", + "Ġus ers", + "Ġcl im", + "Ġslight ly", + "Ġbl ue", + "ra b", + "ĠS er", + "Ġfig ure", + "ĠR ad", + "Ġelect ric", + "m m", + "och astic", + "ri ef", + "Ġcollec tion", + "Ġst em", + "Ġg over", + "Ġb ur", + "Ġtyp ical", + "s up", + "Ġagg reg", + "ra z", + "ĉĉ ĉ", + "Ġst ation", + "Ġar ter", + "i vely", + "itro gen", + "Ġcons tit", + "em pt", + "ĠEff ect", + "Ġdescri ption", + "Ġsc ores", + "Ġmet hyl", + "ĠO b", + "ĠSt ates", + "Ġs plit", + "ĠV ari", + "ĠW ang", + "Ġc ere", + "ĠF ran", + "Ġneed s", + "ĠF our", + "Ġpro ject", + "Ġdev ices", + "Ġintegr al", + "ĠE s", + "ymmet ric", + "Ġm ess", + "Ġpl ays", + "ĠLear ning", + "Ġover l", + "H ere", + "ign ment", + "Ġdel iver", + "ap an", + "C E", + "Ġg auge", + "ĠJ oh", + "-------- --------", + "Ġunder lying", + "Ġth in", + "Ġassess ed", + "Ġdiff usion", + "Ġhe ight", + "ĠS w", + "Ġd ark", + "pr int", + "ran ge", + "ĠC I", + "is es", + "l ier", + "r ant", + "om orphism", + "Ġcomp act", + "ip s", + "ĠN ame", + "Ġtechn ology", + "ag en", + "Ġconfig uration", + "Ġd uration", + "ĠCl ass", + "Ġp ut", + "Ġm aking", + "Ġas ympt", + "a id", + "Ġco h", + "Ġcomplex ity", + "Ġsec tions", + "ĠM D", + "ĠĠĠĠĠĠĠĠ Ġ", + "Ġra d", + "Ġsubstr ate", + "d d", + "Ġan n", + "Ġorgan ic", + "Ġtak ing", + "Ġinclud es", + "Ġk ine", + "a res", + "Ġro w", + "ateg ory", + "Ġmit ochond", + "U T", + "Ġsynd rome", + "ĠPro b", + "re tion", + "Ġfl uct", + "ĠD is", + "Ġtrans l", + "pl as", + "Ġpsy ch", + "Ġsur faces", + "Ġdetail ed", + "amil ton", + "Ġh old", + "ĠâĬ Ĺ", + "ĠC N", + "Ġd il", + "ĠO ver", + "at form", + "Ġver tical", + "Ġcomput ation", + "Ġp ure", + "Ġm akes", + "Ġexist ing", + "Ġexam ples", + "S O", + "ord ers", + "Ġm ix", + "Ġincor por", + "Ġre qu", + "an tic", + "D NA", + "Î ´", + "Ġcl oud", + "ĠT echn", + "Ġï ĥ", + "em ents", + "Ġbas eline", + "ste in", + "Ġbel ong", + "Ġtri als", + "Ġhor izon", + "Ġphosph or", + "Ġan s", + "di x", + "ro id", + "Ġapp ly", + "u ed", + "ern el", + "Ġfem ale", + "ic acy", + "Ġv ectors", + "Ġmat rices", + "at ric", + "ĠM c", + "Ġp y", + "Ġch lor", + "l en", + "Ġclear ly", + "st atic", + "re f", + "ĠS outh", + "Ġmed ia", + "ĠS he", + "ĠB ay", + "Ġag ents", + "B y", + "Ġdifferenti ation", + "ist ant", + "orph ic", + "Ġvari ety", + "Ġserv ice", + "Ġm apping", + "vel ength", + "Ġchann els", + "Ġcomp ute", + "Ġst ream", + "ul s", + "am ide", + "ok ing", + "v it", + "Ġyield s", + "om b", + "ĠG aussian", + "Ġp en", + "un e", + "Ġexper ience", + "b and", + "ĠD o", + "math sf", + "Ġallow ed", + "A r", + "R A", + "Ġbacter ial", + "Ġm iss", + "Ġbacter ia", + "Ġmoment um", + "Ġh ours", + "uc k", + "ĠPro position", + "ber t", + "ot rop", + "Ġvari ance", + "Ġtr ig", + "Ġsh ift", + "Ġequ ilibrium", + "b u", + "IN G", + "Ġwh ite", + "Ġk ind", + "Ġj oint", + "Ġtem poral", + "ĠI V", + "ĠAf ric", + "Ġsub ject", + "ĠP o", + "he ad", + "id el", + "Ġantib ody", + "ĠEff ects", + "Ġsp e", + "Ġsu fficient", + "j ected", + "re es", + "ĠT op", + "Ġmut ations", + "is ions", + "B C", + "Ġin duction", + "Ġinterest ing", + "ell a", + "c an", + "Ġsus p", + "ĠG roup", + "Ġextrac ted", + "istic ally", + "c oh", + "m ap", + "Ġaccur ate", + "Ġto o", + "Ġdim ensions", + "te gr", + "Ġgre en", + "ĠR o", + "Ġw ild", + "Ġlo op", + "Ġmet a", + "Ġsub stit", + "os ome", + "Ġsuggest ing", + "Ġspec im", + "am ental", + "im ent", + "Ġi j", + "Ġcl aim", + "Ġaut hor", + "Ġfil ms", + "Ġcoun ter", + "Ġconven tional", + "r in", + "otyp es", + "Ġp ast", + "S ince", + "medi ated", + "reat ment", + "Ġext ension", + "Ġbi o", + "Ġs ent", + "h al", + "Ġob jective", + "Ġar ray", + "Ġsu itable", + "ĠB ut", + "ĠH uman", + "or gan", + "b ut", + "mod el", + "S I", + "Ġhealth y", + "Ġv ac", + "Ġl ate", + "Ġr ing", + "Ġl ittle", + "M T", + "Ġsqu are", + "Ġge ometry", + "ĠT HE", + "ĠS ing", + "j ug", + "Ġstud ents", + ", ,", + "Ġad ult", + "Ġcharacter ization", + "Ġat mosp", + "Ġmonitor ing", + "an i", + "n et", + "ĠP a", + "opt osis", + "Ġcont in", + "ĠS ol", + "Ġdatab ase", + "im port", + "m ann", + "ĠPro cess", + "ĠC hen", + "Ġg ap", + "Ġenzym e", + "O T", + "Ġsim ultaneous", + "Ġexist ence", + "B P", + "ĠJ apan", + "oun ts", + "Ġt urb", + "Ġsp aces", + "ĠWe ight", + "oph il", + "Ġa st", + "Ġwr ite", + "Ġdiab etes", + "ĠC A", + "Ġneut ral", + "Ġvari ations", + "ax on", + "Ġbe gin", + "und er", + "Ġext raction", + "ĠP ati", + "Ġf ron", + "ef ined", + "Ġacid s", + "Ġserv ices", + "Ġs ense", + "Ġag ent", + "hen s", + "elect ric", + "val ues", + "Ġimprove ment", + "here nt", + "ac tic", + "Ġac et", + "cdot s", + "Ġam ino", + "Ġro om", + "Ġexp ress", + "Ġex cept", + "Ġo ld", + "pl ant", + "cep ti", + "ĠP CR", + "ĠE R", + "ĠB oth", + "ve x", + "Ġad ults", + "Ġp seud", + "Ġal le", + "Ġwork s", + "Ġconsum ption", + "ip her", + "c m", + "c ast", + "Ġnan opar", + "Ï ī", + "Ġe con", + "ynam ics", + "Ġal ter", + "Ġsk in", + "Ġdi ameter", + "G C", + "ĠS ign", + "v ial", + "Ġgluc ose", + "ĠN orth", + "ot ox", + "Ġpro te", + "d x", + "ĠC r", + "Ġf ract", + "Ġins ide", + "Ġst atic", + "w id", + "Ġst orage", + "ĠA L", + "ĠM ark", + "ĠA T", + "Ġsens itive", + "Ġad s", + "Ġed ges", + "an a", + "R e", + "Ġsumm ar", + "ĠAN D", + "Ġremain ing", + "dition ally", + "Ġm id", + "ĠThe ory", + "M C", + "Ġf lex", + "ol y", + "Ġdegrad ation", + "Ġint r", + "ot a", + "ism s", + "Ġam pl", + "ĠA re", + "Ġwork ing", + "Ġdivers ity", + "Ġt ensor", + "Ġb inary", + "\"\" \"", + "v als", + "Ġhe m", + "M L", + "Ġμ g", + "ne q", + "ens ities", + "Ġtak es", + "Ġch arg", + "Ġinter vention", + "Ġal b", + "Ġqu al", + "Ġmen tioned", + "Ġon es", + "ĠAcc ording", + "ill ed", + "O H", + "S up", + "Ġgalax ies", + "ail y", + "Ġr ule", + "Ġc ognitive", + "her n", + "Ġrecogn ition", + "Ġbu ffer", + "Ġm arg", + "ĠN i", + "ĠâĪ ļ", + "Ġcl in", + "Ġintegr ation", + "Ġs in", + "ĠAl so", + "Ġmach ine", + "w r", + "id ity", + "Ġsubsequ ent", + "F e", + "Ġn ames", + "at her", + "ĠC y", + "Ġmetabol ism", + "Ġre actions", + "Ġit er", + "Ġnot ed", + "Ġcaus es", + "ĠH amilton", + "g o", + "Ġra re", + "V A", + "ĠM y", + "v ol", + "as ure", + "Ġsignific ance", + "ĠN one", + "Ġve hic", + "S R", + "Ġvari ability", + "ĠDe velop", + "are n", + "Ġprom ot", + "ard s", + "Ġcomput ational", + "Ġsh all", + "iz ations", + "ĠHydro gen", + "Ġprolif eration", + "Ġcou pled", + "ch ron", + "Ġconver gence", + "Ġg ast", + "Ġcalc ulate", + "ra ft", + "par ation", + "her ic", + "ĠP C", + "pl ate", + "p tions", + "ĠAl gorithm", + "Ġresul ted", + "D E", + "Ġinvestig ation", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠ", + "ol ation", + "Ġt asks", + "Ġle g", + "in ess", + "Ġemploy ed", + "O n", + "Ġexper i", + "Ġtra ject", + "G A", + "Ġpur pose", + "ĠN um", + "Ġcomplet ely", + "th at", + "ĠOp tim", + "Ġform al", + "ec k", + "ĠPro tein", + "Ġgo al", + "Ġthrough out", + "Ġconsider ing", + "Ġref lect", + "tre ated", + "or ation", + "rib ution", + "Ġtherap eutic", + "Ġfind ing", + "U N", + "T hen", + "il ities", + "Ġun known", + "ove red", + "Ġver tex", + "Ġex change", + "Ġdrug s", + "ĠC P", + "Ġin str", + "Ġsymmet ric", + "ĠD ep", + "Ġconstruc ted", + "Ġpre valence", + "Ġdecre ases", + "Ġmi R", + "Ġy et", + "Ġb ox", + "g raph", + "wide hat", + "al ian", + "u fact", + "L R", + "cri ption", + "Ġn p", + "ĠChar acter", + "Ġep id", + "Î ½", + "Ġst ages", + "Ġs ay", + "ĠD uring", + "at ur", + "i entif", + "ab ric", + "à ¼", + "am ent", + "in ations", + "Ġsol ar", + "Ġdisc rete", + "ĠE r", + "ĠGen eral", + "b al", + "ĠC ent", + "u el", + "Ġmixt ure", + "Ġwid ely", + "ĠSec ond", + "Ġres ources", + "ĠAp pro", + "ĠI R", + "Ġstr ing", + "op ro", + "Ġin ner", + "ĠCom plex", + "O P", + "Ġat oms", + "Ġph ases", + "Ġdomain s", + "ad a", + "Ġcount ries", + "ac et", + "oci ation", + "iz er", + "Ġits elf", + "Ġmin imal", + "ĠCont rol", + "tt p", + "Ġb ottom", + "b all", + "ĠM ay", + "de v", + "n ow", + "em ber", + "Ġpercent age", + "ĠO ther", + "om as", + "Ġl ed", + "R es", + "ĠEn g", + "k g", + "Ġfrequ encies", + "k in", + "Ġinc idence", + "Ġan imal", + "Ġad op", + "Ġidenti ty", + "ĠR T", + "Ġy oung", + "ist ent", + "we ight", + "g u", + "Ġse ason", + "Ġexplain ed", + "ĠUnd er", + "io tic", + "w ell", + "Ġmetabol ic", + "g ical", + " ±", + "The orem", + "ad es", + "plic ated", + "Ġcontain ed", + "Ġs ulf", + "Ġco ol", + "Ġpers on", + "Ï ģ", + "Ġp ix", + "ĠS al", + "l ink", + "in i", + "t ual", + "S H", + "g ed", + "k y", + "as ts", + "erc ise", + "ĠH ar", + "Ġrel ax", + "equ iv", + "Ġy our", + "Ġund erg", + "Ġrec overy", + "Ġcom m", + "Ġden otes", + "form ed", + "ari a", + "e tic", + "Ġtum ors", + "ĠH y", + "Ġmark ers", + "Ġplac ed", + "ol ute", + "Ġw aves", + "Ġuncertain ty", + "Ġcontrib ute", + "ĠH ist", + "Ġa ver", + "Ġf av", + "Ġp ow", + "ĠSe e", + "Ġte am", + "Ġscal es", + "ientif ic", + "ier arch", + "Ġear lier", + "Ġsatisf ies", + "Ġcryst al", + "Ġpre gn", + "Ġobs erve", + "Ġon line", + "Ġcontrib utions", + "og ram", + "ĠM a", + "Ġf rac", + "Ġsp read", + "Ġon ce", + "d et", + "Ġresp ond", + "Ġpl atform", + "Ġinflamm atory", + "u tive", + "ĠS umm", + "pl ace", + "Ġ ions", + "Ġwind ow", + "ax is", + "est inal", + "Ġdepend ing", + "Ġsepar ation", + "Ġfor ward", + "ĠT i", + "Ġgl ass", + "Ġac cept", + "Ġfeed back", + "Ġon to", + "M E", + "mer c", + "unc tional", + "Ġap optosis", + "ĠProper ty", + "Ġintegr ated", + "Ġor b", + "Ġdevi ation", + "Ġantib odies", + "Ġremov ed", + "Ġlip id", + "arm ac", + "Ġarbit rary", + "ag ger", + "Ġemb ry", + "Ġg rain", + "Ġd rop", + "Ġstar ting", + "Ġrelationship s", + "ĠÏ ĩ", + "S F", + "Ġsim ply", + "Ġfac ilit", + "Ġz one", + "il s", + "Ps i", + "Ġinequ ality", + "Key words", + "Ġto ler", + "ed ge", + "Ġeas y", + "Ġal pha", + "Ġper f", + "wid th", + "in it", + "Ġimplement ed", + "C F", + "os ity", + "ocy te", + "Ġpropor tion", + "re st", + "ĠS uper", + "Ġpre f", + "Ġw ord", + "e v", + "Ġext ent", + "Ġinj ection", + "all ed", + "ĠAn ti", + "Ġb eta", + "ĠJ an", + "ĠG a", + "ĠZh ang", + "Ġ iron", + "Ġqu antitative", + "ro c", + "Ġf all", + "Ġregard ing", + "Ġf ix", + "Ġdatas ets", + "Ġt end", + "Ġscal ar", + "Ġresid ual", + "Ġrati os", + "ĠÎ ¦", + "k ing", + "Ġinflamm ation", + "Ġsing ular", + "ĠP ark", + "om atic", + "unc tions", + "Ġw ar", + "Í Ĵ", + "hem at", + "Ġf ace", + "ĠH u", + "Ġfund amental", + "Ġwa velength", + "el ing", + "ĠS uch", + "RNA s", + "c t", + "Ġid en", + "ce an", + "ne w", + "T ype", + "ĠForm ula", + "Ġmed ic", + "uss ion", + "Ġdist ingu", + "Ġreson ance", + "AT ION", + "ine ar", + "Ġh yd", + "l n", + "â ĨĴ", + "ĠU p", + "Ġact ual", + "Ġadap t", + "hen e", + "Ġm otor", + "l ist", + "ab it", + "I nd", + "ot al", + "Ġneigh bor", + "ĠP T", + "gen er", + "Ġposs ibility", + "erg ies", + "Ġse ems", + "ĠU S", + "Ġim m", + "Ġtyp ically", + "Ġsim ulated", + "ĠSystem s", + "ectiv eness", + "ry ing", + "Ġkin ase", + "Ġdecom position", + "ater al", + "Ġrot ation", + "pen dix", + "en n", + "at t", + "v ate", + "Ġtarget s", + "Ġsit uation", + "Ġinvol ve", + "Ġcre ated", + "hes ized", + "Ġal one", + "c i", + "Ġm L", + "Ġdiv ided", + "Ġbul k", + "o in", + "H C", + "Ġa rm", + "L O", + "ill s", + "Ġmed ian", + "h am", + "im er", + "f lu", + "Ġfib er", + "ĠS U", + "f ile", + "tiv ated", + "Ġradi o", + "ĠN ames", + "p e", + "Ġo ste", + "Ġel im", + "Ġsus cepti", + "re hens", + "Ġdiscuss ion", + "ĠS ep", + "Ġarchitect ure", + "Ġd est", + "t yp", + "r ame", + "Ġpar tition", + "Ġoccur red", + "Ġs izes", + "cl es", + "Ġsc hed", + "M olecular", + "ĠÎ º", + "Ġinv as", + "c up", + "P CR", + "ĠS MILES", + "ti ally", + "ox ide", + "ĠE d", + "Ġman ufact", + "ĠM aterial", + "Ġfl at", + "Ġmut ation", + "Ġintro duce", + "b ound", + "Ġdis orders", + "reg ulated", + "ĠM or", + "Ġf alse", + "ing er", + "ĠT R", + "Ġext rem", + "w ar", + "Ġsym bol", + "Ġan omal", + "ĠA R", + "Ġiss ues", + "Ġcoordin ates", + "Ġrecept ors", + "Ġprog ression", + "ĠF l", + "ubl ic", + "Ġelectron ic", + "Ġasp ects", + "Ġdoc ument", + "f lo", + "ĠP red", + "Ġgraph s", + "Ġtra ditional", + "D M", + "Ġsaf ety", + "ĠD r", + "ĠS equ", + "Ġcompos ite", + "ĠÎ Ľ", + "Ġrespons ible", + "Ġg ran", + "Ġinter mediate", + "od ium", + "pos ite", + "ph ase", + "d t", + "Ġwee k", + "Ġd os", + "Ġst abil", + "L C", + "ĠK ey", + "Ġver tices", + "Ġcomput er", + "ĠCan onical", + "Ġinvari ant", + "em ark", + "b enz", + "Ġ ice", + "ti le", + "z y", + "ĠO ut", + "Ġmove ment", + "Ġsh if", + "le ep", + "Ġd aily", + "Ġpos itions", + "Ġh im", + "Ġcre ate", + "O ur", + "Ġrese arc", + "Ġprog n", + "duc t", + "Ġscreen ing", + "Ġcho ose", + "pro cess", + "m al", + "Ġlabor atory", + "Ġoper ations", + "Ġto ols", + "olog ic", + "q quad", + "Ġcommon ly", + "Ġv oid", + "Ġocc up", + "ass ociated", + "Ġcorrel ations", + "Ġcarcin oma", + "l in", + "Ġv ideo", + "Ġhe avy", + "Ġlarg est", + "Ġm iddle", + "ĉĉ ĉĉ", + "ĠB as", + "as ons", + "id ing", + "Ġet c", + "ac he", + "ĠE val", + "i ra", + "rom agnetic", + "Ġco vari", + "L I", + "Ġde le", + "Ġst ra", + "am ples", + "od er", + "Ġc ategory", + "ĠIn stit", + "Ġpol icy", + "B ased", + "ib ly", + "Ġdeterm ination", + "Ġresp ir", + "otrop ic", + "Ġol der", + "ĠM al", + "Ġcy tok", + "Ġdeg rees", + "a ut", + "ill ing", + "et ing", + "Ġreduc es", + "Ġide al", + "b inding", + "ĠSp ect", + "un it", + "Ġdi ver", + "ĠW orld", + "Ġmark ed", + "al y", + "Ġcomplex es", + "ĠSumm ary", + "Ġpro pose", + "ĠA ustr", + "Ġmax im", + "Ġro und", + "Ġinhib itor", + "Ġeff icacy", + "act or", + "b ur", + "Ġtrans f", + "ĠG al", + "Ġpro ved", + "ĠDef ined", + "A t", + "Ġse lect", + "Ġnanopar ticles", + "W h", + "k en", + "ĠS P", + "en ge", + "Ġdeliver y", + "Ġdis order", + "ĠIn ChI", + "ĠCompar ison", + "if ying", + "ĠM echan", + "Ġconcl ude", + "Ġrepe ated", + "ell ow", + "Ġà Ģ", + "C I", + "ĠH z", + "an alysis", + "T r", + "à Ń", + "eli hood", + "Ġexp and", + "ĠDevelop ment", + "ĠSt ate", + "Ġt et", + "ff ic", + "Ġp arent", + "Ġscenari o", + "r s", + "ĠW hat", + "â ī", + "Ġstim ulation", + "ĠO bs", + "z ero", + "Ġman ner", + "as hed", + "ĠL og", + "Ġox ide", + "ph osph", + "Ġmig ration", + "Ġsub group", + "ros is", + "ip p", + "D R", + "d ec", + "os omal", + "Ġseg ment", + "ogen ous", + "F P", + "h and", + "ĠSur face", + "it z", + "Ġcryst all", + "th is", + "Ġbuild ing", + "t ag", + "Ġreduc ing", + "Ġun s", + "Ġrecom b", + "Ġc am", + "Ġlim its", + "oc ardi", + "& &", + "Ġsepar ate", + "Ġsup plement", + "ke le", + "Ġgra d", + "Ġiss ue", + "ĠQu antum", + "Ġcurrent ly", + "Ġqu ite", + "E P", + "Ġr ules", + "Ġwe ights", + "u ary", + "ill i", + "Ġbec ame", + "à ³", + "Ġnormal ized", + "ĠNetwork s", + "erv ed", + "Ġstat istics", + "ĠT ime", + "ĠU V", + "Ġc av", + "us ed", + "Ġf ish", + "Ġmajor ity", + "ĠP e", + "Ġcoh ort", + "Ġsem i", + "Ġg ame", + "mon ary", + "M M", + "od ed", + "Ġv ent", + "Ġaut o", + "Ġabund ance", + "n ov", + "Ġasympt otic", + "Ġtreat ments", + "ul y", + "Ġconstra int", + "Ġbe y", + "ĠS O", + "Ġst d", + "Ġdevelop ing", + "ĠN ot", + "L emma", + "Ġapp arent", + "Ġcirc uit", + "F rom", + "ĠEurope an", + "Ġsol ve", + "ĠÍ ij", + "u x", + "Ġbey ond", + "ep t", + "Ġapp e", + "requ ency", + "Ġvac u", + "ĠInd eed", + "ĠC hemical", + "ĠUnd efined", + "N ote", + "Ġn ull", + "Ġin verse", + "Ġnam ely", + "Ġshe ar", + "m L", + "A ll", + "R ec", + "Ġgeneral ized", + "ran es", + "ĠT est", + "il ing", + "Ġfluores cence", + "ĠÎ £", + "Ġind epend", + "d iff", + "Ġprovid ing", + "p henyl", + "h ing", + "Ġvir al", + "ĠB ecause", + "Ġint rac", + "ĠH ig", + "Ġw ant", + "Ġprincip le", + "an ol", + "Ġh a", + "ov ascular", + "Ġform er", + "Ġestabl ish", + "Ġadvant age", + "II I", + "Ġsequ encing", + "Ġproced ures", + "t ra", + "in dex", + "f e", + "Ġp i", + "Ġob vious", + "Ġreg ime", + "s ur", + "Ġpres ents", + "Ġdis plac", + "Ġdec l", + "ĠAp pendix", + "Ġinter act", + "land s", + "in ate", + "om orphic", + "Ġlow est", + "Ġar tif", + "Ġinvol ving", + "Ġcom merc", + "Ġd op", + "Ġcon form", + "ĠI g", + "rol og", + "v ised", + "Ġfl o", + "Ġcardi ac", + "p ts", + "r ig", + "Ġens ure", + "Ġaccum ulation", + "Ġent ropy", + "Ġide a", + "per ature", + "Ġques tions", + "ĠP R", + "Ġstat istically", + "d agger", + "Ġn itrogen", + "sc r", + "ĠDisc ussion", + "Ġre ports", + "Ġpul se", + "Ġrequire ments", + "Ġcompar ing", + "qui red", + "l ayer", + "Ġspect roscopy", + "viron ments", + "Ġscal ing", + "Ġex posed", + "M B", + "Î ¾", + "Ġh ole", + "Ġ á", + "Ġsimilar ity", + "Ġvari ants", + "b ody", + "Ġke ep", + "ĠC ancer", + "ed i", + "os omes", + "Ç «", + "A d", + "âĪ ŀ", + "mon ic", + "g ing", + "s plit", + "kn ow", + "Ġro ugh", + "hemat ical", + "v ision", + "Ġd ed", + "Ġcycl es", + "Ġfam il", + "Ġadminist ration", + "et al", + "Ġcor on", + "Ġinf ections", + "Ġmac roph", + "atic s", + "Ġpredic tions", + "is her", + "ere nt", + "re ted", + "incl ude", + "Ġclim ate", + "s ec", + "==== ====", + "ĠM S", + "Ġcomp e", + "r atic", + "l ig", + "pos es", + "Ġpolar ization", + "ll ip", + "der ived", + "Ġrele ased", + "Ġconn ection", + "l ic", + "Ġcol i", + "Ġout side", + "Ġabs olute", + "es ian", + "ĠE nd", + "ĠO f", + "Ġiden tical", + "Ġmod ule", + "Ġmitochond rial", + "Ġadv anced", + "ing ly", + "form ance", + "Ġto ward", + "ud ing", + "e k", + "Ġmean ing", + "c rib", + "ul ator", + "F N", + "k ey", + "c ons", + "Ġapp lying", + "is hes", + "Ġm amm", + "Ġderiv atives", + "Ġorient ation", + "Ġst ochastic", + "ĠA ug", + "Ġre nal", + "ĠG reen", + "Ġcomple ment", + "ob l", + "pir ical", + "or ts", + "B M", + "Ġex cess", + "Ġmorph ology", + "Ġs ound", + "if ier", + "Ġim plications", + "ĠDes ign", + "appro x", + "pro p", + "Ġcandid ate", + "Ġde pos", + "Ġequ ip", + "ust ain", + "ines e", + "et ry", + "Ġpot entially", + "Ġstra ight", + "Ġcr uc", + "i ology", + "Ġk ernel", + "Ġal coh", + "idd en", + "ret urn", + "Ġcorrec tion", + "ro t", + "Ġmic roscopy", + "Ġf oot", + "G L", + "ĠCell s", + "ir th", + "y g", + "ĠP ath", + "out hern", + "ĠL ong", + "Ġre vers", + "Î µ", + "ar se", + "Ġcere b", + "ist ed", + "Ġpul s", + "Ġdis k", + "it ud", + "Ġd u", + "Ġang ular", + "c hem", + "l ength", + "Ġexact ly", + "ro ke", + "ut h", + "Ġcon d", + "ins ic", + "Ġr ise", + "t ake", + "Ġtop ological", + "Ġrem ark", + "oll ary", + "Ġc er", + "T E", + "n ment", + "Ġbu ilt", + "Ġf re", + "Ġen ergies", + "ect ing", + "ĠT em", + "ra red", + "ĠN ow", + "ch arge", + "Ġloc ations", + "Ġbal ance", + "Ġl a", + "Ġre ached", + "lamm atory", + "Ġf abric", + "ific ations", + "Ġdiagnos tic", + "Ġmut ant", + "ĠN O", + "H D", + "ĠA B", + "Ġdisc rim", + "Ġprec ip", + "ĠTh ree", + "Ġins er", + "Ġinf ected", + "Ġconst ants", + "Î ©", + "neg ative", + "Ġconf idence", + "ĠPati ents", + "ollow ing", + "ad s", + "Ġhyper t", + "ĠIntern ational", + "D ef", + "ari ate", + "Ġinter vals", + "Ġex ercise", + "Ġeduc ation", + "Ġremov al", + "ther n", + "st er", + "Ġinte ger", + "ĠP A", + "Ġk id", + "Ġcategor ies", + "ĠG iven", + "Ġv ascular", + "here nce", + "math scr", + "ĠR et", + "Ġins ulin", + "tic ip", + "ĠC F", + "Ġlo ok", + "ymmet ry", + "Ġfor ces", + "ĠPhys ical", + "L S", + "c are", + "Ġh ouse", + "Ġind uce", + "Ġbel ie", + "ri a", + "ĠAs sum", + "Ġcomput ing", + "Ġb us", + "âĪ İ", + "Ġprac tical", + "t rain", + "T T", + "Ġpl astic", + "ĠN or", + "Ġfe as", + "ĠHamilton ian", + "Ġt ail", + "ĠZ n", + "Ġinterpret ation", + "duc ing", + "I s", + "Ġexam ine", + "ul ates", + "Ġmat ch", + "Ġ Ä", + "iv es", + "amet ers", + "Ġμ M", + "Ġexhib it", + "Ġn it", + "ot o", + "ĠCl inical", + "erv ation", + "ĠAd ditionally", + "ar ant", + "Ġel astic", + "D A", + "otop ic", + "Ġactiv ated", + "Ġt er", + "Ġconsequ ence", + "Ġend ot", + "oph ag", + "Ġcompar able", + "Ġdom inant", + "Î ·", + "Ġvalid ation", + "I m", + "Ġ Å", + "Ġle af", + "Ġf ung", + "tain ing", + "Ġun ivers", + "Ġph yl", + "Ġl ibr", + "Ġext ra", + "Ġpr int", + "medi ately", + "Ġmax imal", + "id ae", + "Ġor al", + "b in", + "Ġpepti de", + "ĠM ax", + "ar p", + "Ġconcl usion", + "Ġsatisf y", + "Ġanalyz e", + "o is", + "Ġinf er", + "Ġd raw", + "Ġdep ression", + "Ġmet all", + "Ġpost erior", + "Ġpeak s", + "s ol", + "Ġhorizon tal", + "Ġlater al", + "ĠO R", + "N N", + "Ġem o", + "P V", + "T A", + "Ġincub ated", + "Ġret rie", + "Ġhum ans", + "Ġ ri", + "Ġs oci", + "on ia", + "Ġinter ven", + "Ġvary ing", + "Ġs ti", + "ĠIm mun", + "Ġon set", + "Ġle aves", + "Ġother wise", + "Ġbl ocks", + "Ġass igned", + "SC s", + "Ġbi os", + "Ġmix ing", + "ar a", + "l i", + "Ġde formation", + "Ġcost s", + "Ġper ipher", + "ĠT ra", + "Ġat omic", + "Ġrandom ly", + "Ġarg ument", + "Ġit ems", + "Ġsu ff", + "Ġprob ably", + "n ers", + "Ġinhibit ors", + "Ġbe h", + "ĠDe ep", + "Ġp ig", + "ĠT ype", + "ĠM ost", + "ur a", + "itud inal", + "Ġderiv ative", + "Ġexpl ore", + "ĠIn formation", + "Ġg rap", + "ĠÎ Ķ", + "Ġprog ress", + "******** ********", + "Ġ ul", + "AR S", + "or al", + "os tic", + "C om", + "ĠEx ternal", + "ĠSt atistical", + "ĠR am", + "ĠL o", + "Ġelect rical", + "l ong", + "N et", + "EN T", + "v a", + "à ¤", + "ur ations", + "Ġdes ired", + "ir ing", + "Ġphys ics", + "Ġmass es", + "k i", + "Ġband s", + "Ġal k", + "ĠSimilar ly", + "Ġsur round", + "Ġcon vex", + "ost er", + "Ġlink ed", + "Ġfocus ed", + "Ġh ot", + "Ġmat ching", + "Ġoxid ation", + "Ġan ten", + "m iss", + "Ġm ental", + "il le", + "ici ency", + "ĠLi u", + "Ġprob e", + "ĠEs tim", + "Ġindic es", + "c he", + "ĠR ob", + "Ġcon v", + "ĠV er", + "ap se", + "S i", + "ph al", + "Ġles ions", + "Ġmolec ule", + "Ġa di", + "Ġd ate", + "Ġcompos ed", + "Ġa ud", + "struct ure", + "ot on", + "in for", + "Ġclust ering", + "ac ent", + "st ar", + "P O", + "ĠCh inese", + "Ġspec ifically", + "eren tial", + "Ġcap ture", + "ĠL ow", + "Ġf ine", + "Ġfem ales", + "ĠH ow", + "Ġa er", + "v ector", + "port un", + "form s", + "z o", + "Ġprec ision", + "yp t", + "Ġmin utes", + "Î º", + "Ġoxid ative", + "con n", + "ens us", + "Ġtrac e", + "Ġcon jug", + "Ġhigh light", + "s s", + "ĠExperim ental", + "ĠTh at", + "art ment", + "M O", + "' '", + "omet er", + "Ġst op", + "Ġ rib", + "Ġout er", + "r h", + "ri pt", + "Ġfluct uations", + "ob s", + "n on", + "Ġqu ark", + "Ġà °", + "ĠM ac", + "Ġperiod s", + "roll ed", + "A V", + "ĠO c", + "ĠIm age", + "ĠB el", + "Ġpropag ation", + "ĠD on", + "ww w", + "gl ish", + "Ġexhib ited", + "ogene ity", + "ĠB ack", + "Ġac tions", + "sk i", + "ĠAm ong", + "Ġb rief", + "ri ers", + "ĠN F", + "pos itive", + "sequ ently", + "ul ence", + "Ġen vironments", + "Ġcur v", + "om ics", + "Ġb it", + "Ġg el", + "Ġrepresent ations", + "Ġa way", + "ĠF ield", + "ob ic", + "C G", + "Ġcomp rehens", + "Ġh ierarch", + "Ġinduc es", + "B D", + "Ġh app", + "Ġe ight", + "Ġgra vity", + "Ġadap tive", + "B L", + "gen ic", + "Ġin struc", + "Ġanaly tical", + "ĠO x", + "ĠC ON", + "Ġsur gical", + "Ġd ip", + "at o", + "Ġrandom ized", + "Ġro les", + "d ep", + "ĠâĪ ĩ", + "ch ang", + "Ġdispers ion", + "Ġsepar ated", + "ĠOr gan", + "ĠV i", + "ĠJoh n", + "Ġan not", + "Ġres ource", + "en ergy", + "rel ation", + "me an", + "ĠB en", + "Ġconfir m", + "W ith", + "Ġinf inite", + "ĠSc ience", + "Ġsuccessful ly", + "Ġlocal ization", + "m ode", + "h ttps", + "geb ras", + "idel ines", + "Ġeff ectiveness", + "h yd", + "Ġs aid", + "ic o", + "Ġtrans itions", + "ed ing", + "Ġprogram s", + "Ġmob ile", + "Ġim mediately", + "ec tivity", + "ĠThe rm", + "ogene tic", + "Ġse ven", + "Ġem ph", + "G E", + "ne um", + "Ġf usion", + "lim its", + "Ġcalc ium", + "ra f", + "min us", + "Ġt rap", + "Ġspecim ens", + "anc ing", + "ĠM arch", + "Ġt en", + "Ġfamil ies", + "ĠH D", + "is ons", + "Ġpre paration", + "h old", + "et her", + "ĠV ol", + "ĠD ise", + "Ġrun ning", + "Ġqual it", + "Ġeff ectively", + "ffici ently", + "B I", + "Ġden oted", + "ĠEqu ation", + "Ġdem and", + "it ory", + "ach ing", + "Ġs odium", + "Ġrepro duc", + "ch o", + "Ġb il", + "P i", + "um b", + "Ġreconstr uction", + "for ward", + "O ne", + "Ġcon version", + "Ġform ulation", + "Ġnear ly", + "ĠL ag", + "S tr", + "ter ior", + "Ġoper ating", + "and om", + "Ġmov ing", + "ĠRe view", + "// //", + "n ai", + "p p", + "oti de", + "lab el", + "oc occ", + "Ġne ver", + "ak er", + "Ġdig ital", + "B l", + "U n", + "Ġmem ber", + "s el", + "Ġpot enti", + "Ġcop y", + "Ġelect rons", + "ch lor", + "ann el", + "yl ind", + "Ġm is", + "ĠS et", + "Ġnut ri", + "Ġdescrib es", + "Ġassum ptions", + "Ġvir tual", + "Ġcoordin ate", + "Ġv or", + "ĠA rab", + "ĠIm p", + "Ġde position", + "Ġins tit", + "Ġrepresent ative", + "ever al", + "Ġmill ion", + "ĠM A", + "Ġmal es", + "Ġcruc ial", + "Ġcol d", + "Ġload ing", + "Ġtrans lation", + "Ġst ead", + "ra ys", + "Ġchall enge", + "ac tivity", + "id al", + "u ff", + "Ġse em", + "Ġn ational", + "Ġf a", + "Ġmin or", + "Ġunderg o", + "c r", + "Ġcap t", + "e le", + "up le", + "ĠM g", + "le ge", + "G R", + "Ġr ig", + "Ġar ri", + "Ġdet ector", + "Ġst rict", + "Ġad hes", + "Ġse a", + "the less", + "Ġs leep", + "ĠCom mun", + "Ġanti oxid", + "Ġmark er", + "Ġflow s", + "anc re", + "ĠJan uary", + "in put", + "U P", + "Ġst ored", + "ad ing", + "iti vely", + "Ġsl ope", + "Ġshe ll", + "Ġelev ated", + "il k", + "Ġfrequ ently", + "Ġb all", + "urb an", + "Ġm l", + "us ive", + "ĠA nt", + "am ino", + "S im", + "Ġphys iological", + "reg ulation", + "es ity", + "Ġexpl an", + "Ġad en", + "re me", + "Ġdiff er", + "Ġmod ification", + "Ġir radi", + "H e", + "ac ial", + "Ġsupp ress", + "qu is", + "Ġd ry", + "er ated", + "Ġpro jection", + "Ġpo ol", + "ple te", + "Ġdirec tions", + "Ġchang ed", + "ĠI ts", + "Ġst er", + "Ġradi al", + "Ġg r", + "Ġperiod ic", + "Ġb in", + "Ġp ip", + "m en", + "t hen", + "p c", + "am ily", + "ĠD M", + "Ġsed iment", + "m i", + "Ġclos ely", + "Ġrep air", + "Ġrespir atory", + "Ġh orm", + "A ns", + "d r", + "l s", + "Ġhom ogeneous", + "et ric", + "D S", + "Ġresid ues", + "ĠVal ue", + "F s", + "Ġwh y", + "S p", + "Ġc a", + "Ġn arrow", + "g ent", + "Ġb r", + "Ġqu asi", + "Ġp ict", + "m o", + "Ġat om", + "Ġh abit", + "Ġlimit ations", + "con duc", + "Ġsh ock", + "cept or", + "ĠDet ection", + "S h", + "ub e", + "Ġe llip", + "U R", + "Ġstain ing", + "Ġrapid ly", + "ĠB ur", + "ĠB ro", + "Ġup take", + "Ġchalleng es", + "S N", + "Ġan is", + "Ġbound s", + "st ep", + "omer ic", + "ten tion", + "ĠEval uation", + "Ġrecomm end", + "M e", + "Ġmod erate", + "ell ed", + "Ġt it", + "ĠY ang", + "Ġph armac", + "inf lammatory", + "ĠJ une", + "Ġsens ors", + "ai red", + "Ġapproxim ate", + "S V", + "Ġb und", + "r c", + "om an", + "Ġvis ible", + "Ġmeas uring", + "og onal", + "ĠFour ier", + "Ġthe ories", + "Ġprof ession", + "tain ed", + "at as", + "ĠInt erest", + "par am", + "ĠStruct ure", + "Ġl iving", + "D ata", + "ĠS M", + "Ġn et", + "Ġsimultaneous ly", + "cont inu", + "Ġsh or", + "#### ####", + "Ġdecre asing", + "Ġrefer red", + "g g", + "Th us", + "Ġd ro", + "pr il", + "ĠP ers", + "Ġenc oding", + "Ġar c", + "Ġregul atory", + "Ġtra ined", + "cep ts", + "Ġro ut", + "ly s", + "P ar", + "ĠU l", + "ĠG raph", + "âĪ Ĥ", + "Ġir re", + "oid al", + "Ġex ceed", + "Ġmost ly", + "ĠP at", + "ater nal", + "Ġ er", + "Ġco verage", + "F S", + "ĠR ot", + "Ġclass ified", + "Ġexc itation", + "Ġconduc tivity", + "Ġcommerc ial", + "ĠD el", + "ĠP olar", + "H R", + "Ġtra ffic", + "z ing", + "Ġsetting s", + "Ġincl usion", + "Ans wer", + "Ġv it", + "vit ational", + "Ġb ind", + "Ġo c", + "ĠW estern", + "Ġpro sp", + "Ġn orth", + "it ch", + "ĠR iver", + "Ġvehic le", + "Ġlik elihood", + "L D", + "Ġin sp", + "âĪ Ĩ", + "Ġle uk", + "ĠB re", + "Ġsynt hetic", + "ĠGerm any", + "ĠThe ir", + "t arget", + "ĠEn glish", + "Ġnot ation", + "ĠA TP", + "ĠMod els", + "Ġab normal", + "ĠConcl usions", + "Ġoccur rence", + "Ġmicro bi", + "ĠW ar", + "tem ber", + "Ġloc ally", + "bor n", + "Ġbar rier", + "Ġexpression s", + "ov al", + "Ġfl av", + "emb le", + "Ġdynam ical", + "Ġphot on", + "app ed", + "Ġgl ut", + "Ġkine tic", + "Ġalcoh ol", + "Ġtrans plant", + "L P", + "Ġdef ault", + "Ġop portun", + "arg s", + "ĠD av", + "Ġfron t", + "h om", + "Ġw ays", + "ĠAss ociation", + "Ġkid ney", + "Ġpropor tional", + "W hen", + "Ġepit helial", + "Ġf resh", + "Ġrec all", + "Ġenzym es", + "b r", + "Ġmal ign", + "text rm", + "ĠU se", + "N ow", + "ĠL ie", + "Ġimp air", + "Ġgu arant", + "Ġin ver", + "Ġtranscri pt", + "Ġs ustain", + "Ġact ually", + "al ities", + "ĠM ic", + "ĠI C", + "ĠMe asure", + "Ġï£ ´", + "Ġd ensities", + "Ġgalax y", + "Ġsu fficiently", + "Ġor bit", + "f ord", + "Ġpar tially", + "ĠP y", + "Ġre verse", + "Ġsur ve", + "ĠW ork", + "Ġas k", + "H owever", + "Ġsit u", + "Ġvacu um", + "to ber", + "Ġsp ac", + "an th", + "O r", + "ag s", + "Ġb ig", + "her ical", + "er ge", + "ell ite", + "Ġinvol ves", + "ĠV is", + "Ġsumm ary", + "ĠSup plementary", + "ĠC oll", + "Ġadj acent", + "ont aneous", + "ab s", + "Ġresearc hers", + "k a", + "Ġinter n", + "Ġmon th", + "ĠNe ural", + "ap or", + "ĠN an", + "Ġst ri", + "E E", + "Ġconsist ing", + "Ġupd ate", + "Ġphot o", + "V al", + "s ens", + "Ġve get", + "B R", + "Ġco inc", + "ĠJ uly", + "til ity", + "ĠEx pression", + "Ġtop ology", + "Ġgrow ing", + "ap tic", + "uc ed", + "Ġperipher al", + "en es", + "Ġpl ots", + "Ġexpl o", + "Ġw or", + "b a", + "ati tis", + "i ef", + "w ave", + "Ġprot ection", + "Ġdef ects", + "Ġads orption", + "Ġsh ared", + "Ġst ellar", + "ĠB a", + "ĠEn ergy", + "que ous", + "ĠAug ust", + "Ġl ys", + "Ġpl us", + "i rel", + "ĠG P", + "ĠNe u", + "d ist", + "g ers", + "if er", + "is p", + "Ġstr at", + "ion e", + "ĠMaterial s", + "Ġl n", + "Ġpul monary", + "en ed", + "pl an", + "M od", + "Ġorgan ization", + "Ġrelax ation", + "Ġcor tex", + "Ġmod ulation", + "og l", + "sh ift", + "Ġsec urity", + "Ġfat ty", + "Ġm s", + "l ocal", + "erg ic", + "Ġinter ference", + "ins on", + "c f", + "Ġre asons", + "p red", + "Ġinterven tions", + "Ġj o", + "ĠI D", + "ĠAre a", + "ĠH a", + "u its", + "out put", + "L e", + "y cl", + "in ted", + "Ġnan o", + "N C", + "ĠC ap", + "Ġchang ing", + "Ġc ust", + "Ġappe ared", + "Ġgrow n", + "ĠU K", + "Ġrad ical", + "ĠP ot", + "ĠPro gram", + "ĠS R", + "Ġsh ap", + "os cop", + "ĠCh ang", + "Ġquanti ty", + "ĠT axon", + "id ation", + "Ġadd ing", + "ĠLe e", + "Ġam ounts", + "Ġdes pite", + "Ġremain ed", + "Ġscenari os", + "le ts", + "om ing", + "Ġcurv ature", + "Ġd imensional", + "Ġprom ising", + "ĠF il", + "str ing", + "Ġattrib uted", + "ym er", + "Ġneigh b", + "Ġinput s", + "Ġmagn et", + "Ġtre es", + "Ġent er", + "r uit", + "st able", + "to plas", + "Ġmess age", + "roph ic", + "Ġisol ates", + "t z", + "Ġdisplay ed", + "H A", + "oc l", + "Ġder ive", + "Ġsyn chron", + "Q U", + "à ŀ", + "Ġexam ination", + "Ġde b", + "Ġdef in", + "Ġf ault", + "Ġstead y", + "Ġphen otype", + "Ġpers pective", + "Ġstat ement", + "d f", + "v oid", + "Ġprom ote", + "ill ary", + "ĠE th", + "Ġw alk", + "Ġrepresent ing", + "Ġgen omic", + "ĠG r", + "sh ape", + "ĠP et", + "ĠL ocal", + "plic ity", + "ĠProb lem", + "G S", + "Ġcomple ted", + "ink ing", + "Ġread s", + "Ġin de", + "ce ived", + "ĠP L", + "ĠMe an", + "ĠSch ool", + "Ġbiom ark", + "irel ess", + "c ut", + "os ing", + "n el", + "ĠA pril", + "ĠB al", + "Ġadop ted", + "Ġcom plications", + "Ġassemb ly", + "f ort", + "h ar", + "Ġad oles", + "Ġans wer", + "Ġcommun ities", + "ĠInstit ute", + "Ġvari ant", + "F inally", + "mit te", + "Ġrestric ted", + "Ġman ip", + "at ers", + "E X", + "Ġd ust", + "Ġsupp ly", + "Ġper me", + "Ġreli able", + "ĠRes p", + "Ġsub t", + "o ks", + "Ġpol l", + "Ġcan c", + "ĠUn it", + "Ġendot helial", + "d y", + "ĠBl ack", + "Ġem pirical", + "Ġp ort", + "op y", + "Ġiniti ally", + "Ġcond ens", + "Ġe ye", + "Ġlist ed", + "ur rence", + "Ġreplac ed", + "Ġselec tive", + "Ġdist ances", + "Ġpar as", + "ĠP ost", + "ĠSep tember", + "Ġmiss ing", + "vere x", + "E r", + "Ġthough t", + "th al", + "Ġchrom at", + "Ġbenef it", + "ram es", + "ĠSup pose", + "Ġsub s", + "Ġang i", + "or i", + "Ġre plic", + "Ġschem es", + "p re", + "pl ane", + "Ġs outh", + "ag er", + "Ġbegin ning", + "v ents", + "on ent", + "i ples", + "ĠH er", + "Ġspect rom", + "Ġden se", + "Ġto ok", + "iver se", + "Ġdist urb", + "p ass", + "Ġillustr ated", + "Ġreve als", + "am a", + "Ġref lec", + "Ġallow ing", + "Ġexpon ential", + "ous tic", + "subset eq", + "Ġs n", + "Ġ urban", + "Ġext end", + "Ġass ays", + "ric e", + "Co V", + "quis ition", + "r ine", + "ĠIn tegr", + "f il", + "V D", + "Ġfib ro", + "Ġcomp ens", + "ĠIm pro", + "ĠĠĠĠĠĠĠĠ ĠĠ", + "ĠG R", + "Ï Ī", + "Ġbas al", + "Ġol ig", + "H T", + "Ġv ess", + "uz zy", + "Ġposs ibly", + "Ġtoler ance", + "The ta", + "Ġvi ol", + "uc lear", + "ĠL im", + "g el", + "Ġmetric s", + "ĠM us", + "am ination", + "Ġelectro de", + "Ġpers onal", + "Ġcool ing", + "Ġac quired", + "ĠF unction", + "ow s", + "oles ter", + "D P", + "Ġreli ability", + "Ġm uc", + "ĠOc tober", + "Ġg old", + "c a", + "Ġc ul", + "f it", + "Ġle m", + "Ġexc it", + "Ġnucle us", + "i ation", + "Ġpregn ancy", + "Ġsynt hesized", + "hem istry", + "Ġmemb ranes", + "ver t", + "ĠK im", + "ten ance", + "Ġquanti ties", + "Ġecon omic", + "Ġbenef its", + "Ġc ylind", + "pl er", + "ĠL arge", + "Ġengine ering", + "ĠE p", + "Ġco ating", + "ati v", + "Ġconduc t", + "Ġabs orb", + "ĠDec ember", + "Ġop posite", + "ĠGl obal", + "Ġl if", + "ĠD ue", + "Ġint ake", + "od ynamic", + "T M", + "Ġf ed", + "Ġspec ified", + "Ġge ometric", + "Ġresp ective", + "Ġb irth", + "ĠComp ound", + "Ġstar ted", + "Ġm other", + "ar r", + "Ġprim arily", + "Ġp aren", + "Ġtub e", + "Ġinter s", + "Ġgrap hene", + "iti al", + "ous ly", + "Ġcardi ovascular", + "Ġe V", + "Ġhe ating", + "Ġmat hematical", + "Ġindepend ently", + "B A", + "Ġaff ects", + "um or", + "ĠM P", + "ĠD em", + "ĠW est", + "ĠD om", + "it ter", + "Ġdis rup", + "op ed", + "Ġphenomen on", + "Ġl umin", + "A c", + "Ġpre fer", + "om ers", + "Ġg ender", + "ĠG L", + "F C", + "Ġinde ed", + "Ġr ational", + "ĠS C", + "Ġprincip al", + "Ġperf ect", + "Ġintro duction", + "t es", + "Ġpi ec", + "Ġc ity", + "Ġpop ular", + "Ġc oding", + "cl er", + "ag ue", + "ĠH R", + "Ġtrack ing", + "k er", + "Ġphosphor ylation", + "Ġpath s", + "Ġsol ving", + "Ġd y", + "Ġplay ed", + "Ġprec ise", + "ĠS l", + "ĠS em", + "Ġgener ating", + "ĠS un", + "Ġcriter ion", + "Ġbran ch", + "ĠÎ ¶", + "ti sh", + "S e", + "Ġanti gen", + "Ġcal ibration", + "E s", + "ĠI tal", + "Ġmass ive", + "E n", + "N o", + "Y P", + "y a", + "Ġsatisf ying", + "Ġqu ick", + "H O", + "Ġbehavi ors", + "icro bial", + "Ġam b", + "Ġpro ton", + "S L", + "Ġus ual", + "row s", + "en ch", + "U C", + "Ġweight ed", + "Ġrec ords", + "ĠA C", + "G T", + "in n", + "Ġe q", + "ĠW il", + "y roid", + "Ġset up", + "I A", + "p ress", + "is ely", + "Ġent ry", + "% %", + "ĠS il", + "e ast", + "ĠE volution", + "ĠR andom", + "Ġcav ity", + "Ġnam ed", + "know led", + "m ber", + "ues tion", + "ĠâĪ ©", + "g i", + "Ġdeterm ining", + "t in", + "Ġgen us", + "Ġtox icity", + "oc yt", + "Ġperturb ation", + "rough t", + "ĠB ri", + "Ġcar b", + "ĠG ra", + "ĠF lu", + "un s", + "Ġdri ven", + "Ġb atch", + "r if", + "P l", + "Ġdisplac ement", + "ĠC L", + "Ġdep ic", + "Ġpredic tive", + "I nt", + "hydro xy", + "ti d", + "d ri", + "Ġp ancre", + "Ġdiag onal", + "Ġsever ity", + "Ġlong itudinal", + "ĠE D", + "ati ble", + "d ir", + "ĠAn other", + "ĠH el", + "v an", + "Ġp neum", + "Ġspecific ity", + "s qu", + "Ġ ign", + "Ġb ed", + "ĠW T", + "aw a", + "es ter", + "Ġk g", + "Ġcomp ression", + "ever theless", + "Ġm ask", + "-------- ---", + "Ġt ens", + "row th", + "ĠG o", + "Ġf aster", + "Ġcan onical", + "Ġdeterm in", + "ust rial", + "ĠEar th", + "wh ile", + "our nal", + "Ġcount ry", + "Ġf erm", + "r ist", + "Ġpro xim", + "Ġmicro bial", + "Ġext ensive", + "Ġch am", + "Ġ §", + "s uch", + "w ent", + "Ġl ar", + "U sing", + "ĠP M", + "Ġoff set", + "ĠP I", + "ĠBay esian", + "H S", + "ĠAfric a", + "Ġsuscepti bility", + "ĠâĬ Ĥ", + "ococc us", + "ĠD ir", + "Ġb os", + "Ġdys function", + "ove mber", + "Ġunder st", + "Ġlarg ely", + "ĠC M", + "Ġmaintain ed", + "Ġposs ess", + "Ġexcl uded", + "ens is", + "ĠD C", + "ops is", + "Ġtor ch", + "id ine", + "Ġfore st", + "ĠEx act", + "ĠStud ies", + "iff iff", + "ĠC am", + "ang ular", + "Ġrem ove", + "o ir", + "av a", + "id a", + "Ġm ant", + "L og", + "Ġrang ing", + "ro g", + "Ġchain s", + "Ġ Ç«", + "ĠC ase", + "ĠA P", + "po ints", + "Ġtarget ing", + "Ġsc ience", + "Ġep is", + "ĠS oci", + "Ġphys ic", + "Ġpromot er", + "ĠEar ly", + "es tic", + "tiv es", + "Ġassum ing", + "ĠM i", + "Ġlem ma", + "Ġconfig urations", + "al ia", + "Ġp ay", + "r ino", + "e b", + "Ġvari ed", + "oun ted", + "Ġinter view", + "ĠGe V", + "O M", + "ogn ition", + "Ġenhance ment", + "ĠM ach", + "pl ies", + "O b", + "set minus", + "Ġintr insic", + "Ġcompar isons", + "b old", + "xi ety", + "Ġst roke", + "G B", + "anc ial", + "ste ad", + "Ġro ck", + "th on", + "ĠC urrent", + "c at", + "Ġgu idelines", + "cy cl", + "Ġintrac ellular", + "one y", + "k o", + "Ġdirec ted", + "rip ts", + "Ġtra vel", + "Ġl ens", + "id i", + "ĠAss ess", + "Ġd x", + "ĠP os", + "Ġmethod ology", + "Ġpred om", + "def ined", + "ĠP op", + "Ġgover nment", + "ell ig", + "ph yl", + "ol i", + "rop ical", + "Ġembed ded", + "ed om", + "crib ed", + "ĠDise ase", + "Ġmedi ated", + "Ġcirc ular", + "ĠTop ological", + "Ġear th", + "ri tis", + "g al", + "m ass", + "Ġcomprehens ive", + "ĠA ir", + "Ġn erve", + "Ġimpl ant", + "Ġextrem ely", + "ĠS E", + "Ġmark et", + "Ġconserv ed", + "emb rane", + "Ġsched ul", + "Ġrun s", + "P h", + "Ġtechn ical", + "T L", + "Ġregion al", + "Ġg erm", + "ĠPro t", + "Ġb right", + "Ġarter y", + "Ġmacroph ages", + "mitte e", + "ĠSing le", + "Ġcom e", + "w a", + "ac char", + "ple t", + "Ġsens ing", + "ros p", + "at om", + "Ġcomp r", + "ĠL u", + "Ġavail ability", + "pro t", + "Ġfit ting", + "sel ves", + "ĠP rim", + "re w", + "Ġwas te", + "ĠK ing", + "p ot", + "Ġinstr ument", + "ĠY ork", + "A F", + "an tial", + "stand ing", + "Ġpl anning", + "ust er", + "Ġâ Ĩ", + "N T", + "ic ular", + "Ġmel an", + "Ġexc ell", + "ill er", + "ĠL D", + "inf o", + "Ġsh are", + "v as", + "Ġl um", + "Ġa queous", + "Ġqu ery", + "Ġm ag", + "ult ure", + "ĠB er", + "Ġof fer", + "ĠN MR", + "ace ae", + "Ġmod ern", + "Ġcirc um", + "Ġcult ures", + "Ġd og", + "Ġc ir", + "Ġpol i", + "Ġchem otherapy", + "Ġpl ates", + "Ġrestric tion", + "st ack", + "ĠF low", + "ĠB u", + "ĠC enter", + "Ġpro ceed", + "tim icrobial", + "s he", + "Ġthere by", + "Ġkn ock", + "Ġdi verse", + "ustr y", + "Ġst ated", + "ĠH ol", + "M ore", + "Ġconserv ation", + "Ġpre vention", + "n orm", + "Ġp al", + "ĠCal c", + "Ġcle an", + "ĠPl as", + "`` `", + "per p", + "pro d", + "Ġâī ¡", + "por ter", + "Ġtrans ient", + "as p", + "Ġtarget ed", + "ĠP ri", + "Sup plementary", + "ĠT reatment", + "z en", + "ĠM art", + "ĠF erm", + "us cript", + "ĠS ynthesis", + "Ġcomb inations", + "UL L", + "Ġwe b", + "Ġth rom", + "Ġexplicit ly", + "an ks", + "Ġadapt ation", + "ĠSequ ence", + "Ġac ts", + "Ġrang es", + "f s", + "b ru", + "Ġsystem ic", + "Ġste el", + "Ġpri vate", + "Ġob esity", + "ĠP art", + "ment ed", + "bre ak", + "ER T", + "Ġfib ers", + "Ġis o", + "Ġtrans verse", + "CT ION", + "ĠR i", + "it in", + "ĠRep resent", + "oph ys", + "Ġco ast", + "Ġal ignment", + "AC T", + "es ides", + "op en", + "g ly", + "Ġsal t", + "unc ed", + "ia z", + "Ġcos m", + "Ġang les", + "ĠâĢ ł", + "ĠIdentif ication", + "he x", + "ĠH all", + "Ġhep at", + "Ġseg ments", + "ĠPh ase", + "ĠL and", + "form ing", + "h box", + "ic ations", + "Ġsubsequ ently", + "ĠC ur", + "Ġlab els", + "vid ence", + "ual ity", + "Ġhe ld", + "em ann", + "Ġcam era", + "c ing", + "ub ic", + "ĠS ARS", + "ul atory", + "kele tal", + "ĠInf lu", + "ĠInd ia", + "am ic", + "Ġs and", + "Ġcom es", + "Ġassoci ations", + "Ġcharg ed", + "Ġs per", + "opro tein", + "ii i", + "od al", + "Ġbound aries", + "ti zation", + "ĠHe avy", + "ĠRe al", + "ĠA F", + "Ġcontroll er", + "Ġantioxid ant", + "Ġb ars", + "Ġw et", + "en er", + "ĠComplex ity", + "Ġst ack", + "There fore", + "Ġre plication", + "Ġappear ance", + "Ġtraject ory", + "Ġunderst ood", + "Ġd ot", + "Ġim ag", + "Ġsc anning", + "T i", + "r uct", + "ĠL y", + "Ġsp ontaneous", + "l at", + "om on", + "Ġro ots", + "Ġl ive", + "Ġfin ally", + "¿ ½", + "Ġappro ved", + "ĠAp plications", + "ĠP an", + "Ġl ost", + "Ġsatisf ied", + "Ġg amma", + "ion al", + "Ġimpro ving", + "Ġmanif old", + "Ġc odes", + "b b", + "ĠN ovember", + "Ġr ich", + "N P", + "ĠE le", + "S B", + "Ġde al", + "Ġop tions", + "Ġcult ured", + "Ġv ul", + "> >", + "ar ithm", + "o ys", + "The se", + "ĠDet erm", + "Ġquad ratic", + "ĠCom b", + "iss on", + "ĠPer formance", + "Ġex ception", + "Ġnucle i", + "Ġad verse", + "k et", + "ĠP al", + "ĠM any", + "Ġdiff raction", + "Ġtrans mit", + "Ġphosph ate", + "olester ol", + "Ġquestion nai", + "ĠSe a", + "bru ary", + "Ġmod elling", + "ĠD R", + "ol in", + "ch mark", + "Ġprec isely", + "g ans", + "v in", + "rid ge", + "ĠInc re", + "Ġneur onal", + "Ġâī Ī", + "Ġexcell ent", + "et ary", + "Ġoverl ap", + "Ġstrong er", + "Ġfract ure", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠ", + "Ġclin ic", + "ĠL ist", + "Ġhist or", + "gen eration", + "ric hed", + "ill us", + "Ġà ħ", + "ĠR ole", + "Ġlabel ed", + "Ġorth ogonal", + "Ġis chem", + "Ġinst ability", + "lo op", + "Ġplot ted", + "ĠProcess ing", + "ĠT a", + "ĠConcl usion", + "Ġm agne", + "Ġunivers al", + "Ġj et", + "Ġreg im", + "flo at", + "Ġc od", + "ad j", + "bold math", + "Ġar rang", + "Ġtrend s", + "Ġprecip itation", + "f requency", + "Ġcont rad", + "Ġtransfer red", + "Ġmain tenance", + "Î Ķ", + "n p", + "ist ence", + "he res", + "lec tive", + "ĠSur vey", + "Ġ Ð", + "Ġst and", + "Ġdisc overy", + "ain s", + "vers ely", + "Ġnumer ous", + "yl ated", + "Ġembed ding", + "Ġcoll abor", + "en ame", + "im mun", + "Ġadjust ed", + "i res", + "c ur", + "Ġvacc ine", + "Ġtra its", + "Ġmorph ological", + "Ġprec urs", + "roscop e", + "ad i", + "ec utive", + "u an", + "Ġt ract", + "ĠP res", + "Ġmy el", + "Ġad equ", + "Ġeth anol", + "i h", + "Ġmet h", + "Ġcoun ts", + "Ġqualit ative", + "Ġmus ic", + "Ġre infor", + "A fter", + "Ġac quisition", + "Ġh ttps", + "all ing", + "it a", + "ic ate", + "sc ript", + "Ġoptim ized", + "ĠH o", + "Ġm ild", + "opl as", + "Ġo verex", + "ĠâĪ §", + "Ġcol lect", + "ĠM ain", + "Ġextrac ellular", + "Ġan c", + "ra wn", + "Ġexpl ored", + "Ġres erv", + "ĠAp plication", + "c ase", + "Ġmar ine", + "ĠĠĠĠĠĠĠĠ ĠĠĠĠĠ", + "il ed", + "Ġmes h", + "ĠMon te", + "cl os", + "Ġperform ing", + "A g", + "reg ular", + "Ġc atal", + "Ġpotenti als", + "ant ly", + "U RE", + "Ġacc omp", + "Ġreason able", + "Ġpresent ation", + "abol ic", + "ĠOn ly", + "ann ed", + "Ġsubst antial", + "Ġdiet ary", + "Ġsubstr ates", + "ap ter", + "Ġint estinal", + "Ġproduc es", + "Pro position", + "ro gen", + "ĠSt at", + "bur g", + "ren ch", + "text bf", + "ystem s", + "at able", + "ĠV ir", + "Ġsol ved", + "ic ense", + "Ġs ong", + "Ġext reme", + "pt y", + "ĠC ity", + "ve red", + "ĠMR I", + "Ġtw ice", + "ĠM n", + "Ġm erg", + "ac tivation", + "Ġn g", + "Ġo dd", + "Ġatt rac", + "Ġatt empt", + "Ġsepar ately", + "Ġrob ot", + "ĠMulti ple", + "Ġsc ientific", + "ĠP P", + "Ġmin eral", + "Ġprotoc ols", + "Ġsuper ior", + "oc amp", + "box yl", + "Ġuniform ly", + "ĠS everal", + "Ġm ol", + "C or", + "under line", + "Ġinflu enced", + "Ġcur ren", + "us ing", + "rac e", + "ĠN evertheless", + "Ġacc om", + "Ġgra vitational", + "Ġindi rect", + "Ġcap able", + "Ġanalys ed", + "Ġdis charge", + "Ġv es", + "Ġlig and", + "l ik", + "Ġs i", + "Ġag ed", + "Ġcryst als", + "Ġspe ech", + "Ġcop per", + "ĠS an", + "ĠA rm", + "Ġman uscript", + "Ġsec retion", + "w edge", + " ·", + "Ġra w", + "Ġaim ed", + "Ġevolution ary", + "Ġconsequ ences", + "Ġit em", + "Ġw estern", + "Ġsol vent", + "Ġstim uli", + "Ġrequire ment", + "h ttp", + "ef ore", + "ĠAt l", + "Ġatmosp heric", + "Ġpack age", + "Ġmy ocardi", + "Ġd ashed", + "Ġver ify", + "ativ istic", + "Ġto m", + "av irus", + "ak en", + "ĠNum er", + "Ġadvant ages", + "F R", + "ĠS elf", + "rec ted", + "con fig", + "Ġit eration", + "Ġeigen values", + "Ġprob abilities", + "F IG", + "ĠW ater", + "ĠA u", + "Ġg ave", + "Ġv ar", + "ric ular", + "opath y", + "Ġr h", + "ord ance", + "Ġw in", + "ĠS cale", + "Ġann ual", + "atas et", + "Ġp el", + "ĠâĪ ª", + "ĠC C", + "it ors", + "Ġl ith", + "Ġchrom osome", + "Ġf uel", + "Ġmul tiv", + "Ġmanufact ure", + "l a", + "ĠS a", + "um es", + "ig m", + "Ġnan oc", + "E GF", + "Ġsign ature", + "N S", + "Ġme et", + "Ġf air", + "met h", + "Ġlocal ized", + "ĠCent ral", + "de g", + "Ġsurround ing", + "Ġn one", + "ĠM O", + "ĠInterest ingly", + "Ġmul tic", + "ĠK e", + "Ġinhib ited", + "ĠC are", + "ĠOp en", + "Ġgl ob", + "E A", + "ĠF ound", + "Ġpix el", + "ok e", + "R D", + "l oc", + "ti ous", + "Ġdistingu ish", + "Ġan terior", + "ur ch", + "Ġj ud", + "ĠP ower", + "Ġswit ch", + "ĠS yn", + "Ġinvolve ment", + "uc l", + "Ġlibr ary", + "ĠCon st", + "Ġsp herical", + "ĠT NF", + "Ġal tered", + "v ance", + "trans fer", + "M s", + "ĠO per", + "in ement", + "se q", + "C ons", + "ho le", + "ĠPh ot", + "Ġg ut", + "acter ial", + "ĠI P", + "un t", + "Ġn om", + "h as", + "ĠFe bruary", + "Ġpro state", + "ĠM L", + "h igh", + "ĠBack ground", + "ul ent", + "Ġo cean", + "a fter", + "ĠO ff", + "l oss", + "Ġfav or", + "Ġwork ers", + "Ġh idden", + "Ġextrac ts", + "raz il", + "s ign", + "N one", + "Ġcolum ns", + "Ġfrac tions", + "Ġco vered", + "ĠS erv", + "Ġin form", + "b ed", + "Ġatt em", + "rain ing", + "Ġneut ron", + "Ġr ice", + "Ġmo tif", + "Ġartif icial", + "Ġinhibit ory", + "Ġd t", + "AG E", + "Ġsam pled", + "Ġb atter", + "Ġsub jected", + "Ġgener ic", + "ĠN H", + "Ġcontin ue", + "ution al", + "Ġa ug", + "i us", + "Ġexec ution", + "ĠW illi", + "ĠDes pite", + "A MI", + "Ġcont ents", + "ĠS ens", + "og ens", + "C ol", + "Ġf o", + "Ġad di", + "u ated", + "Ġrecomm ended", + "ĠS W", + "Ġar ch", + "ĠY es", + "Ġh ol", + "atur ally", + "ti tive", + "Ġc he", + "Ġs ector", + "ĠDef inition", + "Ġcon cepts", + "or ous", + "sm all", + "ers on", + "in ator", + "ĠM T", + "Ġhypert ension", + "c ks", + "Ġn ative", + "Ġt ax", + "r yl", + "Ġre active", + "r b", + "duc ible", + "om m", + "Ġdiagnos ed", + "Ġdri ving", + "Ġbiom ass", + "u ate", + "Ġp il", + "c alled", + "Ġser ve", + "Ġinter fer", + "ipp ocamp", + "Ġalgebra ic", + "Ġbe gan", + "Ġpict ure", + "ind ependent", + "Ġutil ized", + "go ing", + "or a", + "n m", + "Ġdown stream", + "Ġorb ital", + "oun tain", + "ĠH is", + "Ġres ol", + "Ġcorrec tions", + "on ym", + "sc ripts", + "Ġsil icon", + "Ġc um", + "ĠT ri", + "Ġpepti des", + "Ġrece iving", + "Ġstation ary", + "Ġμ L", + "cler osis", + "Ġmod ules", + "em a", + "ĠAfric an", + "struc tion", + "Ġf arm", + "Ġlear n", + "n ode", + " ®", + "Ġsuper conduc", + "ĠL inear", + "Ġtechn ologies", + "Ġnecess arily", + "Ġcoron ary", + "ĠE ast", + "Ġf rames", + "Ġseg mentation", + "V s", + "Ġbehavior al", + "Î ĵ", + "Ġlog ic", + "Ġaccomp an", + "tif ied", + "han ol", + "ĠIn hib", + "il ation", + "and er", + "Ġeff ort", + "ĠD en", + "D I", + "op tim", + "term inal", + "Ġmob ility", + "Ġconsider ation", + "O VA", + "Ġpar ad", + "ox o", + "Ġdef iciency", + "ult ural", + "Ġvalid ity", + "Ġord ers", + "Ġloc us", + "Ġar th", + "em at", + "Ġfeed ing", + "Ġprogram ming", + "Ġtem plate", + "el ian", + "Ġop tion", + "ĠF ollowing", + "Ġen able", + "Ġass ign", + "Ġform ul", + "p u", + "Ġatmosp here", + "sl ant", + "ĠR uss", + "ĠE vidence", + "Ġsimilar ly", + "Ġc amp", + "Ġw ound", + "ĠCharacter ization", + "ĠP BS", + "e es", + "ĠDi rect", + "ĠS L", + "Ġfr uit", + "Ġg ate", + "it o", + "C hem", + "Ġcoll ision", + "or tic", + "Ġpolym orphism", + "enz a", + "w hat", + "Ġexperiment ally", + "Ġult ra", + "e z", + "Ġn erv", + "Ġess entially", + "ĠAustr alia", + "ĠSt andard", + "Ġmedic ine", + "ad ian", + "ĠHig gs", + "u ge", + "Ġsup ports", + "um a", + "Ġcom plicated", + "d ate", + "ophag y", + "ĠMark ov", + "Ġoccur ring", + "opl us", + "P ub", + "pro b", + "ur able", + "Ġk ept", + "Ġisol ation", + "Ġev ol", + "ili ary", + "Ġreg ist", + "Ġh oles", + "Ġcl ar", + "ip ar", + "Ġen rich", + "Ġro ute", + "ay ers", + "edi atric", + "Ġpolynomial s", + "Ġtri vial", + "ĠS am", + "vari ant", + "Ġfre edom", + "pos s", + "Ġinf erence", + "ol a", + "Ġinterp reted", + "C a", + "em ory", + "Ġcent ury", + "ĠR em", + "ĠW u", + "Ġsupp ression", + "Ġgener ator", + "ĠH om", + "Ġvis cos", + "Ġpseud o", + "ĠCh ild", + "ĠS A", + "ib er", + "Ġequival ence", + "if ies", + "ĠCons ider", + "ol ine", + "âī ¤", + "Ġde ple", + "Ġaver aged", + "Ġs outhern", + "Ġord ered", + "ĠB rown", + "Ġmethyl ation", + "ĠAd ap", + "Ġm aternal", + "ond ed", + "ĠBe havi", + "Ġidentif iers", + "Ġprocess ed", + "G G", + "V I", + "Ġch a", + "un k", + "ĠF unctional", + "Ġhydro ph", + "Ġfin ancial", + "ec ond", + "ĠÎ ¨", + "Ġemph as", + "Ġdef ect", + "m ar", + "Ġnor thern", + "c ore", + "Ġadhes ion", + "Ġte le", + "Ġw arm", + "rif ug", + "rang ian", + "res olution", + "Ġhe x", + "h bar", + "Ġhar monic", + "Ġcont rac", + "Ġread ing", + "Ġeff orts", + "ĠO l", + "Ġan xiety", + "b ul", + "T C", + "ip id", + "R emark", + "Ġform ing", + "il bert", + "am ond", + "Ġanaly tic", + "ore c", + "ch a", + "ĠCon sequently", + "ĠS u", + "for all", + "Ġà ŀ", + "Ġasp ect", + "Ġins ights", + "ati vity", + "io tics", + "he imer", + "ĠL abor", + "Ġa ware", + "ĠBri tish", + "c hemical", + "Ġâ ĭ", + "cl usion", + "ĠM ich", + "Ġgra de", + "ĠS EM", + "ĠC irc", + "hes es", + "W L", + "Ġen abl", + "Ġd end", + "Ġind ustry", + "Ġimpro ves", + "t et", + "Ġt el", + "Ġwas hed", + "Ġshor ter", + "Ġinc ident", + "ĠAc tivity", + "Ġdos es", + "ĠB razil", + "Ġtransform ations", + "Ġform at", + "ĠPro of", + "Ġl en", + "ul ative", + "Ġcycl ic", + "Ġrec ruit", + "pt r", + "T H", + "Ġrece ive", + "ĠNe xt", + "ĠEx p", + "i ant", + "in stein", + "S et", + "re ne", + "Ġge omet", + "Ġconsider able", + "S o", + "ugh t", + "Ġpaper s", + "ĠC S", + "z a", + "Ġis omorphism", + "ho u", + "Ġmut ants", + "Ġpor tion", + "Ġà ¾", + "Ġcontinu um", + "C u", + "ĠComput ed", + "Ġcomb ining", + "ov a", + "ĠN P", + "Ġc rack", + "Ġsome times", + "Ġcontinu ed", + "Def inition", + "arc in", + "ĠC d", + "ĠMed ical", + "i ences", + "ĠC ross", + "Ġtranscription al", + "ĠZ e", + "st d", + "if orn", + "Ġfail ed", + "Ġidentif ying", + "Ġm ir", + "Ġmetast asis", + "O F", + "n n", + "ĠC ID", + "Ġoscill ations", + "anc ies", + "wr ite", + "Ġband width", + "Ġtra de", + "Ġag ing", + "ĠModel ing", + "Ġass ert", + "Ġcurren ts", + "Ġf ire", + "ub iqu", + "Ġalb um", + "Ġfrequ ent", + "N ame", + "Ġpur ch", + "Ġpl ayer", + "ĠE sc", + "Ġno tion", + "Ġintern ational", + "ul um", + "o ic", + "Ġincub ation", + "Ġphenomen a", + "Ġser ver", + "ut er", + "Ġv en", + "qu in", + "Ġhyp ox", + "ĠR F", + "it on", + "Er ror", + "Ġhe mat", + "Ġthem selves", + "Ġper p", + "id ual", + "Ġpur poses", + "m es", + "w ing", + "ro v", + "Ġem iss", + "Ġexperi enced", + "qu es", + "ĠL C", + "ĠRec ent", + "bo ok", + "Ġalk al", + "id x", + "hy th", + "Ġconc rete", + "Ġswit ching", + "Ġexplan ation", + "ird s", + "Ġsign s", + "Ġob j", + "Ġcytok ines", + "ub ble", + "ad der", + "Ġuncertain ties", + "Ġprom otes", + "Ġcom pl", + "Ġsc an", + "Ġpr ime", + "P H", + "Ġheter ogeneous", + "ĠY ou", + "Al though", + "Ġser ious", + "Ġdri ve", + "Ġheter ogeneity", + "ryst all", + "Ġo d", + "Ġcon volution", + "ĠâĬ Ĩ", + "ĠSp ace", + "Ġgast ric", + "ĠSt re", + "ĠP V", + "b ase", + "M et", + "Ġloss es", + "Ġcyt otox", + "Ġcontroll ing", + "le ase", + "Ġreg ulated", + "ĠEng ine", + "ĠH ospital", + "B r", + "on om", + "hy de", + "st age", + "Ġgiv ing", + "ĠP en", + "ĠSoci ety", + "dri ven", + "i ang", + "Ġmod ifications", + "B V", + "Ġaccel eration", + "Ġm ilk", + "on omic", + "Ġth ink", + "ogl ob", + "Ġfeas ible", + "n am", + "Ġref lection", + "ĠPol y", + "Ġsummar ized", + "F L", + "Ġrec t", + "Ġpredom inant", + "Ġbl ot", + "de hyde", + "Ġtransform ed", + "Ġfacilit ate", + "ĠCar lo", + "Ġgreat ly", + "ĠS ocial", + "Ġparen ts", + "big g", + "ros pective", + "Ġprogn osis", + "Ġcharacter ize", + "Ġconn ectivity", + "Ġtraject ories", + "ĠS H", + "Ġl ies", + "Ġcandid ates", + "rom y", + "Ġs or", + "ĠIn s", + "Ġth or", + "Ġmet als", + "ĠS V", + "Ġtim ing", + "Ġutil ity", + "Ġnew ly", + "ĠI FN", + "Ġaffect ing", + "ce ment", + "ĠM el", + "ĠÌ ģ", + "typ es", + "lys is", + "erc ul", + "Ġdist or", + "act ors", + "ps y", + "Ġbo ok", + "ĠE ven", + "tem perature", + "Ġinvas ion", + "Ġrecogn ized", + "fact or", + "N e", + "Ġinter section", + "Ġcor tical", + "n g", + "Ġde ploy", + "Ġamplit udes", + "Ġd a", + "ĠG C", + "Ġchalleng ing", + "Ġpre lim", + "G M", + "A cc", + "Ġfour th", + "al c", + "ĠP S", + "ĠGene tic", + "l ock", + "err or", + "sk ip", + "s ime", + "Ġan a", + "sime q", + "Ġcereb ral", + "ĠE X", + "av ed", + "roph y", + "id opsis", + "Ġbeh ind", + "Ġen ables", + "Ġind ustrial", + "ĠP ac", + "Ġdefin itions", + "Ġcataly tic", + "Ġdiss ip", + "erv ical", + "Ġcom mut", + "Ġrepe at", + "Ġch iral", + "Ġp ron", + "p ol", + "Ġgo ing", + "Ġmic roscope", + "Ġhealth care", + "ĠClass ification", + "tit ude", + "ĠFerm i", + "Ġh ttp", + "are st", + "Ġsupport ing", + "Ġw ood", + "n ight", + "Ġkine tics", + "Ġsubset s", + "Ġsub unit", + "ĠCan ada", + "at on", + "Ġaccur ately", + "Ġres istant", + "ĠïĢ ½", + "ric tion", + "Ġcham ber", + "ig ue", + "ĠPh il", + "Ġrec over", + "c s", + "Ġsp here", + "ĠSpec ifically", + "Ġan ne", + "Ġiniti ation", + "ĠT H", + "Ġb ud", + "ord ered", + "Ġdi electric", + "ĠCol lege", + "Ġproduc ing", + "Ġanten na", + "B s", + "ĠF rench", + "O X", + "ĠAmeric a", + "ĠâĢ Ķ", + "oun ting", + "ful ly", + "Ġserv ed", + "Ġresid ue", + "Ġarg uments", + "Ġp and", + "Ġcomp any", + "Ġcondition al", + "m ia", + "ĠQ CD", + "Ġviscos ity", + "Ġprosp ective", + "as onal", + "Ġdom inated", + "Ġpen et", + "op o", + "Ġn ine", + "ĠI ll", + "ĠVis ual", + "Ġfil es", + "Ġy east", + "Ġthan k", + "G N", + "re al", + "Ġver ified", + "ĠInd ian", + "Ġsti ff", + "rolog ical", + "Ġd ram", + "Ġt ight", + "ĠGerm an", + "ĠTechn ology", + "ĠAppro ach", + "rom atic", + "Ġac oustic", + "ti an", + "os in", + "ĠDep artment", + "ot ropy", + "Ġem pty", + "tri vial", + "of il", + "Ġal gebras", + "tex ts", + "Ġwe bs", + "Ġp ore", + "Ġpack et", + "T ime", + "im g", + "on y", + "ri tic", + "Ġveloc ities", + "ĠD ynamics", + "Ġcanc ers", + "Ġtr unc", + "ĠForm ation", + "ĠDon or", + "ĠM it", + "I ST", + "Ġconcl uded", + "Ġan tag", + "ĠSo ft", + "app end", + "Ġfrag ments", + "ĠPro f", + "Ġflu or", + "ĠJ ac", + "ĠS n", + "Ġle pt", + "Ġsplit ting", + "Ġsex ual", + "ĠF ore", + "ĠGen er", + "Ġneighbor hood", + "Ġben chmark", + "ĠR A", + "Ġdiv ision", + "iforn ia", + "Tr ue", + "Ġf uzzy", + "Ġt ro", + "c ents", + "Ġconstit u", + "ati al", + "as tern", + "ĠT im", + "Ġper ception", + "Ġsubst anti", + "Ġmac ro", + "Ġout l", + "ĠObs erv", + "pr ising", + "ok ed", + "orec tal", + "ĠCh o", + "ĠDiff erent", + "Ġinvestig ations", + "Ġconsist ency", + "i ents", + "ĠF OR", + "AS S", + "ĠV an", + "Ġsit uations", + "ĠB R", + "Ġinf rared", + "ym al", + "Ġpix els", + "Ġcar rier", + "s en", + "IN T", + "Ġeffici ently", + "D T", + "ĠEx pl", + "ion ic", + "Ġn aturally", + "Ġpro pos", + "Ġgu ide", + "Ġconcl usions", + "o on", + "Ġg rant", + "Ġinst ances", + "Ġreview ed", + "Ġelect romagnetic", + "Ġth reat", + "ed ia", + "ĠOptim ization", + "ĠB io", + "Ġtrig ger", + "ici ent", + "otyp ic", + "Ġst ret", + "Ġan tic", + "Ġtox ic", + "Ġsp inal", + "UP AC", + "Ġover view", + "o tion", + "Ġstraight forward", + "Ġpos itively", + "as te", + "Ġref erences", + "ul ose", + "ĠG re", + "Ġantag on", + "Ġshif ts", + "Ġd rawn", + "ĠWh ite", + "Ġfrac tional", + "Ġbund le", + "Ġexhib its", + "Ġreserv oir", + "ĠA lex", + "Ġaggreg ation", + "Ġcirc le", + "Ġprac tices", + "ĠC oval", + "ĠDist ribution", + "Ġt ang", + "ĠM ut", + "Ġreg ulate", + "osp here", + "i ro", + "AMI NO", + "v est", + "Ġphot os", + "Ġev ident", + "Ġbus iness", + "cont rol", + "Ġw orth", + "ĠPo isson", + "ĠArab idopsis", + "ĠT arget", + "Ġregul ates", + "ĠI r", + "ĠAd v", + "Ġens emble", + "pr ing", + "Ġp rice", + "ĠF L", + "ĠImp act", + "Ġevent ually", + "in ating", + "Ġcent rifug", + "f rame", + "Ġdiagram s", + "Ġt ag", + "Ġt ry", + "sur face", + "ĠIdentif iers", + "ra ined", + "Ġs ides", + "Ġin n", + "Ġflex ible", + "Ġsat ellite", + "Ġaff inity", + "Ġsum mer", + "G P", + "am b", + "Ġa qu", + "Str ing", + "t reatment", + "ĠD ynamic", + "math op", + "Ġno tice", + "n es", + "row ave", + "ves tig", + "Ġoutput s", + "Ġco herent", + "Ġillustr ate", + "Ġvalid ated", + "ĠSc hem", + "Ġask ed", + "b atch", + "Ġpur ified", + "Ġminim ize", + "ĠD E", + "U M", + "c heck", + "vari an", + "ĠG old", + "yl ene", + "I O", + "Ġch olesterol", + "Pub Chem", + "ĠK ore", + "ĠCount y", + "Ġi i", + "ĠM AP", + "ect omy", + "Ġsem antic", + "Ġcoll agen", + "Ġper ceived", + "ich ia", + "Ġadminist ered", + "con taining", + "ran k", + "In ChI", + "Ġirradi ation", + "Ġlog arithm", + "Ġg ames", + "Ġinj ected", + "ĠM Hz", + "Ġd ors", + "Ġevalu ating", + "ĠHy per", + "Ġchromat ography", + "p hen", + "ĠK ar", + "Ġan timicrobial", + "ri end", + "Ġdescrib ing", + "Ġw t", + "Ġhorm one", + "A K", + "ĠI UPAC", + "G a", + "Ġvit amin", + "Ġconn ections", + "u ous", + "ĠL ine", + "Ġbenef icial", + "c ases", + "ic ated", + "is ks", + "p arent", + "I d", + "er ies", + "r un", + "Ġm ind", + "it t", + "s ulf", + "z heimer", + "Ġinter f", + "V ert", + "Ġan th", + "olog ous", + "ĠL ife", + "Ġm ur", + "Ġper mut", + "ot ing", + "Ġneut rino", + "Ġb orn", + "p matrix", + "ĠCal ifornia", + "ag ent", + "Ġcoll isions", + "ĠN S", + "Ġh ippocamp", + "Ġpow der", + "Ġv aries", + "Ġepid em", + "ĠWe b", + "ul er", + "Ġinterest ed", + "Ġdevelopment al", + "Ġlength s", + "Ġcol our", + "Ġqu as", + "ĠR ich", + "E q", + "Ġinf ants", + "ĠP H", + "ophil a", + "Ġcaus ing", + "G e", + "mod ule", + "I B", + "Ġcontrib uted", + "ro se", + "Ġcy toplas", + "---------------- ----------------", + "Ġro ad", + "s ymmetric", + "U s", + "Ġweak ly", + "ti te", + "Ġdef ines", + "ĠP E", + "Ġmetabol ites", + "Ġl ob", + "Ġterm inal", + "Ġdemonstr ates", + "ĠAc ceptor", + "ĠC lo", + "Ġinfer red", + "Ġv ill", + "F irst", + "Ġneg lig", + "Ġw ireless", + "A b", + "par ticle", + "ois otopic", + "Ġexc ited", + "P M", + "Ġcons ecutive", + "ĠIs otype", + "Ġstim ulus", + "ĠM C", + "tim ate", + "ĠCoval ently", + "B onded", + "Ġy ellow", + "Ġall oy", + "d ensity", + "Ġfil ters", + "Ġampl ification", + "Ġw on", + "h t", + "Ġimp acts", + "Ġst aff", + "ĠâĪ Ģ", + "ĠIs omeric", + "Ġsm oking", + "Q u", + "Ġcapt ured", + "h aps", + "ĠN ULL", + "Ġri ver", + "c ount", + "Ġmanif est", + "Ġdiab etic", + "Ġalter ations", + "ĠRot atable", + "ĠP RO", + "ĠMon oisotopic", + "Ġï Ĥ", + "sp ect", + "Ġcataly st", + "Ġmodel ed", + "Ġp age", + "ĠR OS", + "ĠCanonical ized", + "ĠT w", + "Ġa ux", + "av age", + "ĠRam an", + "st o", + "per f", + "Ġreplac ement", + "ĠEn vironment", + "Ġac ting", + "p ati", + "ific ant", + "th rough", + "Ġsat uration", + "Ġt ip", + "Ġrec urrence", + "ĠHist ory", + "Ġprot ective", + "Ġbur den", + "ad o", + "y es", + "in st", + "A p", + "ĠS y", + "Ġph on", + "ĠâĪ ij", + "Ġgen otype", + "Ġcovari ance", + "Ġquick ly", + "ĠD u", + "Ġs ug", + "Ġdec line", + "ĠT B", + "Ġstrict ly", + "Ġmo ist", + "und red", + "ĠC B", + "ati le", + "ĠH F", + "Ġar ticles", + "Ġp s", + "ĠEn h", + "ist ing", + "Ġbi ology", + "Ġb odies", + "ĠA k", + "ĠNumer ical", + "ĠLag rangian", + "Ġdisc overed", + "Ġv ic", + "op es", + "Ġfrag ment", + "Ġt y", + "ism ic", + "Ġhep atic", + "Ġen riched", + "p an", + "Ġinflu ences", + "ĠL ake", + "col or", + "Ġenrich ment", + "oc hemistry", + "Ġun stable", + "ĠIg G", + "der ly", + "Ġe cos", + "Ġconcer ning", + "ĠR isk", + "Ġmarg in", + "Ġpath ogenesis", + "Ġp ump", + "Ġprelim inary", + "Ġtum our", + "F urther", + "az ole", + "Ġelectro des", + "Ġd ial", + "ub es", + "ĠN atural", + "ĠM ul", + "ĠïĢ Ń", + "Ġn ic", + "Ġimp ed", + "on ly", + "Ġcompar ative", + "rec tion", + "ak i", + "Ġre nd", + "Ġsp arse", + "Ġindic ator", + "l ocation", + "tis m", + "ac tivated", + "ĠP b", + "epti de", + "Ġend ogenous", + "Ġcent ers", + "a o", + "s w", + "Ġcons ensus", + "Ġattrib utes", + "Ġsaf e", + "Ġbelie ve", + "ov irus", + "Ġimmun ity", + "Ġfit ted", + "Ġcontrib utes", + "i able", + "Ġvirus es", + "Ġins ight", + "ĠNo vel", + "ĠAl zheimer", + "cep ted", + "ĠP t", + "Ġcent re", + "n at", + "Ġbios ynthesis", + "m its", + "Ġchem istry", + "Ġj us", + "an ish", + "Ġre frac", + "ĠT or", + "Ġpan els", + "Ġimp ly", + "Ġmat ched", + "us c", + "w ord", + "v ae", + "ĠSt ar", + "s yn", + "M at", + "Ġapplic able", + "ĠP seud", + "amp ions", + "ĠR en", + "Ġus age", + "ĠL ight", + "p rec", + "Ġfib rosis", + "Ġreconstr uc", + "ĠO N", + "ĠG Hz", + "G D", + "al gebra", + "ig er", + "Ġdec isions", + "inf ected", + "knowled g", + "Ġexpress ing", + "Ġmyocardi al", + "ord ination", + "Ġprogn ostic", + "Ġfibro bl", + "Ġaccel er", + "ĠAssess ment", + "Ġconstra ined", + "Ġalle le", + "r ide", + "Ġrequ est", + "abil istic", + "te b", + "Ġg a", + "Ġrec overed", + "Ġpro min", + "urs es", + "ĠH C", + "ĠM ur", + "ĠEq s", + "Ġdef ining", + "Ġm er", + "im age", + "Ġorgan isms", + "g rad", + "Ġref lected", + "el astic", + "e ties", + "dim ethyl", + "EL O", + "ra ndom", + "ĠDi agn", + "ercul osis", + "ro b", + "Ġmom ents", + "ĠE C", + "Ġexperi ences", + "erv ing", + "ĠN C", + "Ġvor tex", + "g re", + "struct ures", + "el t", + "Ġcar ry", + "ĠTh rough", + "Ġpre ced", + "rast ruct", + "it us", + "Ġpsych ological", + "Ġlimit ing", + "t wo", + "ĠB ound", + "ĠC re", + "ĠSm ith", + "Ġc ast", + "Ġcompe tition", + "s ch", + "Ġcap ability", + "ach ment", + "Ġinhib its", + "à °", + "ĠDiff erential", + "Ġautom atically", + "Ġg est", + "Ġw aters", + "Ġun iqu", + "z er", + "E qu", + "Ġstudy ing", + "Ġdi ed", + "Ġo s", + "Ġrecomb ination", + "unc il", + "Ġpath ogen", + "GF R", + "U V", + "en eration", + "ĠS ta", + "Ġinst ant", + "Ġpro ven", + "Ġd s", + "Ġd amp", + "N ext", + "ĠY oung", + "Ġpower ful", + "Ġwr iting", + "k l", + "Ġcare er", + "ĠCor ollary", + "N s", + "Ġï ¿½", + "ĠM il", + "Ġb urn", + "tic ular", + "ond on", + "P r", + "ĠL in", + "ĠJapan ese", + "ĠL ab", + "Ġst rip", + "pro tein", + "Ġh our", + "angle ment", + "angu ages", + "r d", + "par se", + "Ġemiss ions", + "H ence", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠ", + "Ġj ob", + "ĠA S", + "Ġax ial", + "ĠT ur", + "car bon", + "M F", + "ĠN E", + "Ġar ise", + "Ġlinear ly", + "Ġprol ong", + "Ġle ak", + "ĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠ", + "Ġmov ed", + "orb idity", + "Ġprofession al", + "c ode", + "os ine", + "Ġpol ic", + "Ġbond s", + "m ask", + "Ġconver ted", + "v ille", + "ec tious", + "par allel", + "ĠH al", + "ĠT GF", + "ment al", + "Ġread er", + "Ġstandard s", + "ag o", + "Ġ EN", + "Ġst ations", + "Ġnormal ization", + "ĠÎ ĺ", + "ch ain", + "W hat", + "Ġtom ography", + "Ġent ries", + "bl ue", + "ĠPre vious", + "i as", + "Ġquestionnai re", + "Ġh az", + "Ġhom ology", + "ver y", + "Ġnucle otide", + "ĠGen ome", + "Ġμ l", + "Ġutil ization", + "Ġpolym ers", + "ro te", + "Ġsmall est", + "cal c", + "Ġs pl", + "Ġt ension", + "Ġdis continu", + "al a", + "h ol", + "Ġdeterm ines", + "Ġpro j", + "ĠOver all", + "Ġb le", + "f o", + "Ġprinc iples", + "Ġinteract ing", + "Ġhard ware", + "l ife", + "ail s", + "Ġdifficult y", + "Ġcho ices", + "Ġc ard", + "Ġl act", + "Ġro ll", + "Ġquantif ied", + "ĠSc ientific", + "Ġland sc", + "al igned", + "Ġcompos ites", + "her ichia", + "Ġen velop", + "iti g", + "S te", + "Ġcomp et", + "Ġimpair ment", + "Ġclos ure", + "Ġreturn ed", + "Ġrece iver", + "Ġpe er", + "Ġcons ent", + "Ġult ras", + "Ġphot ons", + "Ġsup pose", + "Ġpredic ting", + "ĠâĬ ķ", + "Ġcomp an", + "Ġneglig ible", + "c urrent", + "um ber", + "Ġcomp atible", + "i op", + "ĠStruct ural", + "R ef", + "Ġs on", + "Ġequ ality", + "Ġconsist ed", + "Ġv ibr", + "ou pling", + "v ation", + "Ġover come", + "s uper", + "l ict", + "Ġpancre atic", + "G s", + "ap ed", + "as al", + "w an", + "Ġlat ent", + "Ġcover ing", + "Ġles ion", + "i ance", + "ĠF T", + "wo od", + "ject ure", + "ĠB C", + "link ed", + "ĠL aw", + "Ġem it", + "Ġunc lear", + "Ġpre m", + "ac ted", + "p olar", + "c re", + "Ġmod ulus", + "rop ath", + "S ub", + "am i", + "Ġp ick", + "ER R", + "Ġmove ments", + "N i", + "Ġmechan ics", + "od ic", + "Ġg al", + "ĠMan agement", + "h ost", + "ew ise", + "ĠT otal", + "ĠInflu ence", + "Ġ ubiqu", + "roph ys", + "Ġcap s", + "Ġparticip ant", + "Ġpol yp", + "t d", + "Ġiter ations", + "dom inal", + "B B", + "Ġcharacter s", + "Ġdevi ations", + "res istant", + "Ġmal aria", + "Ġrem ote", + "h skip", + "Ġunder went", + "u til", + "bl ock", + "ucl ide", + "Î ¦", + "elect ron", + "Ġsens ory", + "ĠSim ulation", + "Ġre ward", + "Ġpand emic", + "Ġb or", + "ynt hetic", + "Ġinvas ive", + "R F", + "ĠSm all", + "ĠF isher", + "val ent", + "ĠM I", + "roc ytes", + "ĠT E", + "Ġst re", + "Ġperturb ations", + "Ġsim plicity", + "ĠG rowth", + "ĠÎ ł", + "Ġin oc", + "ard ing", + "at um", + "m ulti", + "ĠD iv", + "an es", + "ac illus", + "Ġlife time", + "ĠH ep", + "Ġa z", + "us p", + "ĠAssum e", + "Ġbre aking", + "ĠAt t", + "ticip ants", + "Ġlumin osity", + "Ġdon or", + "par ams", + "oh yd", + "Ġpro gen", + "ĠP O", + "G O", + "ĠL eg", + "Ġbiomark ers", + "Ġr ural", + "Ġne on", + "gl uc", + "ĠP B", + "Ġgu id", + "Ġc ervical", + "p ace", + "Ġc ord", + "um n", + "Ġsub space", + "Ġatt ached", + "Ġdepos ited", + "Ġindic ators", + "ĠS F", + "qui re", + "Ġdiss olved", + "r ite", + "ĠN A", + "Ġj u", + "Ġadd ressed", + "Ġsupp ressed", + "Ġpneum onia", + "Ġs ession", + "ĠC he", + "ĠF er", + "Ġacc ordance", + "D es", + "Ġqu ar", + "Ġfit ness", + "Ġvi ability", + "os h", + "Ġphyl ogenetic", + "ect in", + "p at", + "ĠFran ce", + "Ġmess ages", + "Ġl oci", + "Ġconf lict", + "Ġrele vance", + "Ġinstruc tions", + "Ġsome what", + "chang ed", + "Ġcorrect ly", + "oz yg", + "av ig", + "ĠL at", + "Ġo varian", + "ĠR emark", + "j oint", + "ain t", + "w est", + "s ample", + "Ġdiver gence", + "Ġh air", + "ag onal", + "Ġm im", + "Ġim mediate", + "ĠP ort", + "Ġoff ers", + "Ġdepic ted", + "Ġhydro x", + "ĠT ow", + "Ġemerg ing", + "ou pled", + "Ġh undred", + "Ġadap ted", + "ell er", + "ĠRel ations", + "et te", + "Ġgast ro", + "Ġm orphism", + "Ġequip ment", + "p op", + "un ately", + "Ġtransplant ation", + "if iers", + "Ġel derly", + "on ucle", + "Ġref ers", + "ar ial", + "ĠCom mittee", + "Ġmalign ant", + "omon as", + "Ġall ocation", + "og ether", + "Ġnan ot", + "pl ot", + "ĠM es", + "Ġplan ar", + "ell s", + "s ource", + "ow ski", + "Ġn a", + "Ġcl ock", + "Ġamb ient", + "oc ene", + "Ġfluores cent", + "Ġval u", + "ĠM agnetic", + "Ġde part", + "phosph ate", + "Ġrough ly", + "Ġne ither", + "ĠAl tern", + "Ġst ay", + "Ġsp ot", + "ĠE nt", + "Ġsecond s", + "h ard", + "Ġrec urrent", + "Ġpat ch", + "Ġlimit ation", + "ĠD er", + "Ġsh arp", + "Ġexpect ation", + "ĠL ore", + "d ict", + "R eg", + "Ġneut roph", + "Ġn ur", + "Ġstar ts", + "ost asis", + "Ġorgan ized", + "Ġc DNA", + "or ient", + "ĠEx ample", + "ĠF und", + "ay lor", + "id ering", + "Ġtri ple", + "n ic", + "Ġattack s", + "ĠD ros", + "à ¨", + "ĠE M", + "Ġoptim um", + "Ġp ull", + "Ġc e", + "ery th", + "Ġr ating", + "Ġreproduc tive", + "Ġdec ades", + "Ġre place", + "L ist", + "ĠF ast", + "Ġred shift", + "op sy", + "ill a", + "do uble", + "ter a", + "Ġgo als", + "ĠS k", + "IN E", + "Ġbi ochemical", + "u int", + "Ġf etal", + "ĠRi emann", + "ur ies", + "Ġp p", + "Ġsymbol s", + "ĠK a", + "D i", + "ĠG alax", + "ĠComp ared", + "Ġc asc", + "Ġb its", + "Ġsc aff", + "Ġestim ator", + "ĠAd ditional", + "Ġimprove ments", + "ectiv es", + "Ġh ous", + "ĠM agn", + "Ġmultiv ariate", + "Ġag ric", + "v o", + "ut ter", + "ĠAc knowledg", + "s u", + "Ġam mon", + "Ġaim s", + "Ġz inc", + "Ġel ong", + "ĠG O", + "Q uestion", + "incl uding", + "Log P", + "Ġint ellig", + "Ġcon e", + "ĠFound ation", + "Ġimp aired", + "Ġill ness", + "ĠEsc herichia", + "Ġabund ant", + "s cal", + "ens ively", + "Ġneg atively", + "par ameter", + "Ġperme ability", + "dom ain", + "r ated", + "Ġep och", + "Ġadoles cents", + "Ġdef ic", + "ĠEstim ation", + "Ġrout ine", + "P er", + "t ol", + "Ġellip tic", + "ĠH E", + "obl ast", + "Ġre aches", + "Ġflux es", + "Ġs un", + "ĠAn aly", + "âĢ ľ", + "ĠX LogP", + "Ġfilter ing", + "ri an", + "ĠS cal", + "Ġp in", + "ĠTi O", + "im ents", + "Ġmarg inal", + "Ġrecomb inant", + "Ġenc our", + "Ġal umin", + "Ġt f", + "ataly tic", + "Ġobserv ational", + "Ġgeneral ization", + "Ġï£ ¬", + "Ġantib iotic", + "Ġgener ates", + "Ġd B", + "S pec", + "r ically", + "Ġvalu able", + "Ġtop ic", + "Ġterm in", + "Ġsem icon", + "Ġquantif ication", + "ub b", + "Ġkin em", + "err ing", + "Ġa eros", + "p ack", + "Ġfew er", + "Ġfat igue", + "Ġgo es", + "Ġn ight", + "ĠU s", + "âĢ ¬", + "ĠPr inc", + "Ġsp ring", + "Ġconcer ns", + "Ġsm art", + "Ġsec ret", + "Ġmm ol", + "Ġbel ief", + "D C", + "Ġsubstanti ally", + "âĪ ĩ", + "Ġsubstit ution", + "map sto", + "sk y", + "ill ance", + "Ġstud ent", + "ok ine", + "Ġinter ior", + "Ġeigen value", + "m y", + "Ġclos er", + "eren ti", + "Ġec ological", + "ĠFig ures", + "oly tic", + "Ġar rays", + "ĠC as", + "Ġlo ops", + "Ġcorrec ted", + "Ġr he", + "Ġin version", + "Ġprefer red", + "um ab", + "ĠD I", + "Ġadequ ate", + "ir m", + "Ġim plicit", + "sh ip", + "Ġplay ers", + "Ġdelay ed", + "Ġw inter", + "Ġvul ner", + "Ġshap es", + "Ġstain ed", + "ĠM ajor", + "Ġhierarch ical", + "ĠD ig", + "ers ion", + "ĠE fficient", + "Ġwall s", + "d frac", + "Ġclass ifier", + "Ġmon ol", + "Ġupd ated", + "Ġm ature", + "ĠL I", + "ear ing", + "Ġf inger", + "oun ter", + "ank ton", + "Wh ile", + "Ġreal istic", + "ĠC amp", + "Ġf illed", + "Ġde ad", + "ĠPac ific", + "Ï ĩ", + "ĠDav id", + "Ġaddi tive", + "ench ymal", + "Ġobs er", + "Ġst ere", + "Ġultras ound", + "ĠPred ic", + "Ġend s", + "section al", + "m as", + "om at", + "iv ity", + "Ġhand le", + "Ġmetast atic", + "ole t", + "r yp", + "AC E", + "Ġpor ous", + "Ġconcer n", + "it ored", + "Ġcir cles", + "Ġemo tional", + "g ered", + "Ġf riction", + "f irst", + "oph y", + "es cop", + "ad ed", + "Ġres olved", + "ER S", + "Ġpath ogens", + "Ġgrad ually", + "ĠB rain", + "x f", + "an ium", + "a el", + "N ew", + "Ġcytok ine", + "ĠB P", + "Ġspecim en", + "ole an", + "Ġt axon", + "Ġsequ ential", + "κ B", + "ad emic", + "pl ings", + "~ ~", + "erm al", + "t ree", + "Ġcaus al", + "ari an", + "Ġc rop", + "op ol", + "ch annel", + "ĠM ex", + "Ġcl on", + "ĠRec ently", + "ĠIn vestig", + "Ġrecommend ations", + "form at", + "ĠM ET", + "Ġsent ence", + "Ġb p", + "ĠG W", + "Ġrec ording", + "Ġp le", + "to tic", + "Ġï£ ·", + "Ġrang ed", + "en tion", + "obacter ia", + "cep tions", + "ĠIm port", + "d ynamic", + "por ary", + "G iven", + "Ġturb ulence", + "Ġg ram", + "Ġequ ally", + "c d", + "ĠO s", + "Ġturn s", + "Ġdetect ing", + "ati o", + "gen erate", + "gra de", + "Ġcirc ulation", + "Ġmanufacture r", + "L a", + "ĠH ilbert", + "T s", + "in tegr", + "Ġbelong s", + "ĠIntern et", + "ang l", + "ĠâĬ ¥", + "ĠDros ophila", + "uclide an", + "t an", + "Ġext ends", + "Ġexpand ed", + "ill in", + "squ are", + "ys acchar", + "Ġquantif y", + "Ġpuls es", + "Ġves ic", + "ĠN K", + "ores cence", + "ĠPh osph", + "Ġv ision", + "ĠHu ang", + "ĠResp onse", + "h ouse", + "ear s", + "Ġe g", + "Ġac cepted", + "ĠT M", + "amet ric", + "Ġpath ological", + "Ġrecruit ment", + "AT A", + "Ġfig ures", + "ĠP ress", + "Ġal igned", + "Ġpost operative", + "ĠMe V", + "Ġconsider ably", + "Ġconform al", + "ĠIs land", + "num ber", + "Ġautom atic", + "Ġs plic", + "Ġcyt os", + "Ġdesc rip", + "ĠS ant", + "l ies", + "u ity", + "it one", + "E CT", + "ĠB on", + "Ġdis app", + "bo ard", + "or rh", + "Ġcalc ulating", + "ne e", + "ĠMe as", + "Ġgen omes", + "Ġphot oc", + "Ġread ily", + "ov ine", + "ĠDe v", + "Ġsat ur", + "Ġkind s", + "ĠP K", + "Ġro d", + "Ġj unction", + "ĠH A", + "Ġdesign s", + "h n", + "Ġorder ing", + "Ġcosm ological", + "Ġpil ot", + "Ġcol orectal", + "ĠL ondon", + "ĠDir ac", + "C ont", + "ĠW ind", + "ĠT re", + "id in", + "ĠïĢ «", + "ilt ration", + "More over", + "Ġre tention", + "tim ately", + "hydro gen", + "d el", + "bol ic", + "ĠQu anti", + "per iod", + "Ġretrie val", + "at ase", + "end icular", + "ulti es", + "R S", + "N H", + "Ġin formed", + "Ġfil tered", + "m embrane", + "Ġstiff ness", + "ĠO cean", + "ĠS Y", + "Ġl ot", + "ĠFig s", + "Ġans w", + "ĠEng land", + "ĠAtl antic", + "process ing", + "Ġdog s", + "Ġl ie", + "Ġun ion", + "ĠT an", + "Ġhal o", + "Ġcontinuous ly", + "B u", + "A MP", + "ĠAp p", + "Ġmoist ure", + "Ġth yroid", + "Ġaccompan ied", + "Ġfol d", + "Ġorig inally", + "Ġsp an", + "ĠF A", + "conn ected", + "Ġrec urs", + "vi an", + "ĠEqu ations", + "en a", + "arcin oma", + ".. ..", + "Ġdisc rep", + "U H", + "Ð ¾", + "ang er", + "Ġmon itored", + "Ġinflu enza", + "Ġs ure", + "bl ack", + "o e", + "Ġall oc", + "Ġhabit at", + "op henyl", + "Ġvent ricular", + "Ġpolic ies", + "am ate", + "Ġreport ing", + "Ġsol uble", + "======== ========", + "Ġdip ole", + "Ġirre ducible", + "ĠP rec", + "acet yl", + "Ġth read", + "ĠAppro xim", + "Ġm apped", + "i pro", + "Ġt ropical", + "S ch", + "ĠAN OVA", + "Ġl anguages", + "ic ine", + "ĠF amily", + "f unctions", + "E F", + "Ġnut rient", + "Ġanalyz ing", + "ines cence", + "Ġthrom b", + "Ġk it", + "Ġmamm alian", + "op totic", + "Ġequip ped", + "on a", + "Ġqu e", + "Ġc ame", + "Ġsimpl ified", + "Ġdec ays", + "Ġpass ive", + "Ġdele tion", + "Ġobtain ing", + "Ġmixt ures", + "Ġprim ers", + "ĠP sy", + "os c", + "om ent", + "Ġchlor ide", + "ĠPa ul", + "st art", + "int estinal", + "hel ium", + "ar th", + "od ot", + "Ġf its", + "Ġsqu ares", + "ĠCar di", + "ak a", + "rib uted", + "Ġinequ alities", + "omet hing", + "hed ral", + "ĠF uture", + "Ġgl i", + "Ġmetall ic", + "Ġfac ilities", + "Ġob st", + "poss ible", + "Ġz ones", + "uc id", + "Ġdr ift", + "d epend", + "val ued", + "Ġn ons", + "Ġworld wide", + "Ġtr ust", + "Ġso le", + "ĠLe vel", + "ĠS ha", + "Ġregard less", + "Ġspectrom etry", + "duc tor", + "le uk", + "Ġsk ills", + "Ġincorpor ated", + "Ġlear ned", + "Ġ ure", + "Ġext inc", + "OD U", + "Ġgrain s", + "ater n", + "ĠInd ex", + "com put", + "u a", + "Ġcont amination", + "ĠA ff", + "un ing", + "Ġas ymmetric", + "Ġopen ing", + "Ġb at", + "Ġag ree", + "IT Y", + "ĠChang es", + "organ ic", + "ĠR ay", + "ĠH and", + "n i", + "in ic", + "Ġr isks", + "Ġst ock", + "Ġnec k", + "Ġvol umes", + "ĠP rac", + "Ġincreasing ly", + "S c", + "os es", + "GF P", + "Ġass ignment", + "ĠF ed", + "osp it", + "Ġoverex pression", + "Ġm aster", + "Ġo pt", + "il er", + "in variant", + "Ġconver ges", + "Sim ilar", + "n y", + "Ġst ore", + "Ġelev ation", + "Ġco al", + "he t", + "it em", + "PL C", + "oh ist", + "G en", + "ĠC hem", + "ĠC ost", + "p air", + "Ġnumer ically", + "Ġpre ference", + "ĠN ucle", + "ĠB D", + "T I", + "ĠH yp", + "ro y", + "T e", + "ĠF in", + "Ġclaim s", + "ib ilities", + "Ġlar vae", + "im a", + "emb ly", + "Ġc it", + "L L", + "Ġsil ica", + "ĠV I", + "Ġreach ing", + "O f", + "ĠAustr alian", + "t ub", + "w orld", + "on i", + "ĠF P", + "Ġbrief ly", + "ĠDes cription", + "Î ¶", + "ch arg", + "Ġc is", + "ĠC at", + "Ġrec ip", + "Ġemerg ency", + "Ġst rand", + "Ġreal ized", + "pos ing", + "ot ope", + "Ġmaintain ing", + "ĠCh rist", + "Ġcre ating", + "Ġembry os", + "Ġs keletal", + "Ġag es", + "rep resent", + "C r", + "Ġestim ating", + "Ġre ar", + "ĠY u", + "ĠP i", + "m g", + "Ġflo at", + "ĠR oy", + "p us", + "Ġch ick", + "Ġmicrobi ota", + "vas ive", + "ĠB ern", + "ĠPat tern", + "l ines", + "Ġfl ood", + "ĠL ou", + "ilit ary", + "ros ion", + "Ġsurve ys", + "F I", + "ia e", + "Ġse arc", + "m ol", + "Ġt itle", + "ĠMach ine", + "Ġcirc uits", + "ĠNum ber", + "z i", + "ĠB MI", + "Ġautom ated", + "plic ate", + "ĠL PS", + "Ġelectro chemical", + "Ġwebs ite", + "Ġanis otropy", + "Ġr ings", + "Ġin nov", + "b its", + "w in", + "ĠN AD", + "Acc ording", + "ĠCon n", + "ure us", + "ĠFe ature", + "ĠIn stead", + "C omp", + "it udes", + "M o", + "Ġsc ope", + "tif ication", + "ĠI S", + "ĠNe ut", + "Ġreg ulating", + "c oding", + "Ġrow s", + "h l", + "ĠK n", + "ist or", + "ampions hip", + "Ġpromin ent", + "Ġr s", + "um atic", + "A m", + "Ġdifferenti ally", + "ug in", + "Ġadv ance", + "ph ys", + "Ġsh aring", + "Ġar t", + "v acy", + "ti tions", + "Ġst yle", + "Fig ures", + "Ġg lu", + "Ġvacc ination", + "ĠOp tical", + "flu id", + "ĠF re", + "Ġgradi ents", + "op hyl", + "ĠP ubl", + "Ġacc retion", + "Ġâ̲ â̲", + "ress ing", + "Ġtrans mitted", + "Ġnerv ous", + "um ar", + "Ġreview s", + "Ġgen otypes", + "low er", + "ĠE V", + "Ġcont ract", + "ati bility", + "Ġchild hood", + "Ġon c", + "Ġbi ofil", + "Ġaut ophagy", + "Ġads orb", + "ĠSup port", + "Ġlig ands", + "p ower", + "rec tional", + "ĠR ap", + "sim ilar", + "Ġinf arc", + "Ġelectro ly", + "Ġinc ome", + "ar ity", + "ĠA v", + "er ic", + "Ġclin ically", + "un ch", + "Ġattrib ute", + "Ġcomm and", + "rib utions", + "Ġgly c", + "Ġtranscri pts", + "ogram s", + "Ġassess ing", + "F O", + "script style", + "j i", + "ric k", + "en vironment", + "Ġlaw s", + "Ġnorm ally", + "Ġdeple tion", + "ĠR O", + "Ġenc oded", + "h ma", + "Ġbran ches", + "Ġarg s", + "oun ger", + "or ge", + "um ps", + "Ġview ed", + "Ġult r", + "R R", + "uls ion", + "ĠH or", + "Ġf ro", + "ĠMeasure ment", + "x x", + "erm an", + "ĠO nce", + "Ġorient ed", + "ĠP oint", + "Ġto wn", + "Ġformul as", + "S Y", + "ĠA M", + "Ġconsider ations", + "ĠT C", + "ĠK it", + "Ġact in", + "Ġplas mid", + "Ġhistor ical", + "Ġd ye", + "Ġhe ur", + "ĠLe ague", + "ĠM ad", + "Ġgra ft", + "Ġsil ver", + "O ver", + "ĠC os", + "ograph ical", + "Ġprecurs or", + "r us", + "Ġregard ed", + "ĠH am", + "f unctional", + "iv eness", + "ffici ency", + "ig ene", + "oc ol", + "Ġcum ulative", + "Ġse asonal", + "Ġm u", + "ĠB an", + "omy cin", + "Ġb ool", + "ĠM ag", + "ĠAn al", + "enti a", + "a ign", + "Ġfoot ball", + "act ing", + "Ġreturn s", + "ĠT om", + "sh aped", + "it ance", + "ĠExperim ent", + "ĠO S", + "Ġabs ent", + "ran ial", + "Ġtherap ies", + "O p", + "o unced", + "AT E", + "Val ue", + "g reen", + "Ġveget ation", + "D s", + "Ġinc om", + "à §", + "Ġm arrow", + "ĠCo uncil", + "Ġinv est", + "Ġcl ub", + "T rans", + "dev ice", + "Ġv ibration", + "ĠX u", + "//// ////", + "ĠH en", + "vi er", + "Ġanalog ous", + "Ġd elta", + "Ġsal ine", + "Ġrequ iring", + "Ġneur on", + "o o", + "ĠQ uality", + "Ġte ac", + "ĠE c", + "L i", + "Ġpubl ication", + "ĠPhys ics", + "Ġp pm", + "th ase", + "Ġcre ation", + "ĠA ge", + "Ġbelong ing", + "Ġion ic", + "ĠS I", + "u ating", + "end if", + "ĠC our", + "Ð °", + "Ġd ots", + "Ġe ast", + "ar com", + "Ġâ ĩ", + "Ġr ights", + "ess ions", + "Ġvers ions", + "ĠF ree", + "ĠSt ress", + "Ġsed iments", + "Ġm itig", + "Ġb ow", + "ĠAc t", + "ĠCar bon", + "t here", + "te en", + "Ġphen otypes", + "Ġne arest", + "ĠPot ential", + "Ġde form", + "Ġreflec ts", + "Ġpart ners", + "Ġan est", + "Ġad vers", + "ĠF actor", + "Ġconven ient", + "ul os", + "ĠP ur", + "ĠM er", + "Ġfl ag", + "Ġtri ang", + "Ġseed s", + "Ġf if", + "ob il", + "ĠC K", + "men tioned", + "Ġv apor", + "og ue", + "Ġpredic tor", + "O ut", + "Ġcomple tion", + "ĠS eg", + "Ġdiff use", + "Ġra ised", + "Ġco ordination", + "Ġsyn aptic", + "ĠB or", + "ĠB ol", + "Ġpolymer ase", + "Ġwhe at", + "Ġinser tion", + "Ġes c", + "ĠW al", + "Ġdist al", + "transfer ase", + "Ġinter faces", + "Ġins u", + "Ġpoor ly", + "Ġa ureus", + "Ġben z", + "Ġun iverse", + "ĠInter action", + "ĠF rame", + "ĠIm aging", + "Ġexpl oration", + "ĠEngine ering", + "ĠB esides", + "ti a", + "Ġen um", + "an ine", + "Ġto t", + "ĠE duc", + "Ġderiv ation", + "Ar ray", + "yl oid", + "ĠAr ch", + "is en", + "ac ity", + "ak ers", + "Ġshe et", + "ĠE st", + "Ġwe ar", + "Ġ eryth", + "EC K", + "hem atics", + "Ġarter ial", + "cript style", + "scripts criptstyle", + "echan ical", + "Ġparticip ation", + "c her", + "ur ance", + "ĠF R", + "ĠC V", + "Ġcomplement ary", + "ain e", + "empt y", + "Ġdig es", + "Ġexpon ent", + "Ġsim ulate", + "U E", + "Ġantib iotics", + "ĠUn ivers", + "Ġpath ology", + "ther mal", + "p a", + "Ġstress es", + "ĠLabor atory", + "N ode", + "Ġle ave", + "ash ing", + "Ġdisc re", + "Ġsusp ension", + "ree k", + "Ġschedul ing", + "ĠD A", + "ary n", + "ĠNa Cl", + "st rain", + "ST R", + "ĠC ong", + "ol f", + "Ġcal ibr", + "ĠOptim al", + "Ġ ó", + "G l", + "ĠR h", + "Ġdiffic ulties", + "Ġvess els", + "Ġas ymmetry", + "Ġco herence", + "ĠTaxon omy", + "Ġp ed", + "ĠH ouse", + "tit udes", + "ĠF ar", + "O Y", + "Ġconcentr ated", + "Ġsign alling", + "Ġfung al", + "Ġconsist ently", + "Ġenh ances", + "Ġfore cast", + "Ġc ubic", + "ĠE P", + "Ġparticip ate", + "ĠPl ant", + "r isk", + "A nd", + "ad ic", + "of lu", + "Ġsper m", + "ĠCh ris", + "N D", + "col on", + "Ġf aces", + "Ġtub erculosis", + "ryst al", + "flo or", + "up s", + "Ġg ray", + "ĠP ublic", + "t ensor", + "Ġrig id", + "Ġeas tern", + "ĠItal y", + "Ġsign atures", + "Ġshall ow", + "ó n", + "ĠC e", + "Ġpro jects", + "Ġro uting", + "Ġpredic ts", + "ĠFe atures", + "ĠDist rict", + "Ġcar rying", + "ĉ ĠĠĠĠ", + "ĠT O", + "H M", + "d ings", + "Ġre normal", + "Ġb ring", + "p in", + "al ed", + "Ġcloud s", + "n ames", + "ox in", + "Ġperp endicular", + "W T", + "ers hip", + "Ġrec on", + "Ġwork ed", + "ĠâĢ «", + "rastruct ure", + "Ġpo inted", + "E V", + "ĠT aylor", + "Ġhep atitis", + "Ġorb its", + "ĠF actors", + "c ellular", + "Ġf ocal", + "Ġbo ost", + "Ġmic rowave", + "ĠPro ject", + "B F", + "Ġpoli tical", + "Ġsupplement ed", + "Ġillustr ates", + "Ġide as", + "ĠDr ug", + "ob ile", + "ĠH O", + "Ġrobust ness", + "ros ine", + "ĠN ormal", + "Ġstim ulated", + "Ġimped ance", + "fort unately", + "zym e", + "Ġbar riers", + "act ory", + "lear ly", + "Ġpre print", + "sens itive", + "Ġturb ulent", + "th ing", + "Ġbo ard", + "Ġp it", + "Ġintegr ity", + "Ġrot ating", + "ud a", + "Ġv enti", + "ĠSN Ps", + "Ġcorrespond ence", + "Ġvisual ization", + "av ail", + "Ġbe ams", + "ĠCont inu", + "Ġpers istent", + "Ġb ath", + "Ġmi RNAs", + "Ġcust om", + "Ġord inary", + "Ġgener ators", + "Ġb ridge", + "Ġdom in", + "am y", + "Ġlo oking", + "t able", + "F alse", + "Ġsoil s", + "Ġmat ches", + "Ġprog ressive", + "st ates", + "ĠSh ort", + "Ġco res", + "Ġintro ducing", + "Ġar rest", + "Ġtext ure", + "Ġdors al", + "Ġd rain", + "iz oph", + "ĠQ ue", + "à ±", + "dis c", + "Ind ex", + "Ġext ensively", + "Ġplastic ity", + "Ġre ally", + "ĠEr ror", + "Ġsugg es", + "Ġconsequ ently", + "Ġperform s", + "lik ely", + "ive red", + "Ġtherm odynamic", + "Ġk er", + "Ġacet ate", + "Ġg ets", + "leq slant", + "Ġpredict ors", + "ĠSw ed", + "n an", + "he ter", + "Ġanomal y", + "Ġoper ational", + "Ġret rospective", + "Ġt ends", + "ad en", + "Ġb order", + "Ġmet hanol", + "ĠEn ter", + "Ġcoll apse", + "Ġpurch ased", + "D a", + "ĠH T", + "Ġf ulf", + "Ġcr ust", + "st one", + "Ġpen al", + "Ġtun n", + "ĠTem perature", + "Ġpot ent", + "lec ule", + "Ġco vers", + "Ġbatter y", + "Ġbe g", + "Ġor gans", + "ĠTh omas", + "Ġsol ub", + "oc rine", + "ĠSp in", + "Ġinterest s", + "d oc", + "Ġundergo ing", + "u i", + "Ġin herent", + "Ġintegr als", + "ira ble", + "as hi", + "Ġreg eneration", + "Ġinf lation", + "man if", + "ĠRec ognition", + "Ġdisplay s", + "An other", + "Ġcont amin", + "j unction", + "Ġcop ies", + "MR I", + "Ġvehic les", + "G et", + "Ġper haps", + "Ġw est", + "Ġint ensive", + "Ġs omething", + "Ġhypox ia", + "Ġcou plings", + "Ġfeas ibility", + "az ine", + "un ic", + "in er", + "ĠI T", + "Ġdist rict", + "ĠJ ames", + "e val", + "Ġplace bo", + "a que", + "Ġel ucid", + "ĠJac ob", + "Ġcoun ting", + "Ġflex ibility", + "Ġper man", + "Ġadv ances", + "ul ph", + "Ġent anglement", + "Ġinte gers", + "Ġfocus ing", + "k ov", + "Ġh ospit", + "Ġap plies", + "Ġc ot", + "S m", + "ass ium", + "Ġdocument ed", + "Ġload ed", + "Ġre ly", + "Ġinf ectious", + "Ġprob es", + "Ġhighlight ed", + "Ġp ediatric", + "Ġwe ather", + "Ġman ual", + "Ġc ation", + "Ġinterp olation", + "ĠSte p", + "ĠK al", + "D H", + "d b", + "izoph ren", + "ad er", + "car b", + "Ġag on", + "orph ous", + "t ors", + "at z", + "Ġb if", + "Ġcharg es", + "ĠAg ain", + "Ġb ron", + "ĠG over", + "Ġmin ing", + "a ver", + "Ġearth qu", + "Ġview s", + "Ġsc ene", + "par ameters", + "Ġbro ken", + "T est", + "ĠS um", + "ĠP rom", + "Î Ľ", + "Ġcut off", + "Ġb irds", + "Ġar ising", + "ĠA I", + "ĠC E", + "Ġpron ounced", + "asp ase", + "Ġint ended", + "Ġaff ine", + "Ġur ine", + "Ġbelie ved", + "ĠPrim ary", + "ĠCon f", + "Ġab dominal", + "sp in", + "un iform", + "ĠSt ochastic", + "ĠPro v", + "Ġmi RNA", + "ĠB ell", + "B O", + "ĠSoft ware", + "ĠT s", + "ut ri", + "ick ing", + "i en", + "Ġmic ros", + "ĠN R", + "Ġleuk emia", + "Ġsuper nat", + "f amily", + "Ġall oys", + "ĠP ET", + "ĠA bs", + "ĠG A", + "ĠQu antitative", + "L o", + "Ġis land", + "sec ond", + "pec tives", + "Ġlat ency", + "ang i", + "Ġfl ight", + "ĠE uclidean", + "em y", + "ĠBl ood", + "leuk in", + "L T", + "en h", + "Ġs we", + "Ġunit ary", + "ĠRep ublic", + "Ġstructure d", + "ĠS en", + "M n", + "cent ric", + "Ġtrans genic", + "Ġhelp ful", + "py x", + "Ġhome ostasis", + "N a", + "Ġpass ed", + "Ġe yes", + "Ġab stract", + "ul se", + "Ġmir ror", + "Ġregul ator", + "Ġmur ine", + "load ed", + "Ġmod ular", + "Ġlandsc ape", + "ic ks", + "Ġs now", + "Ġb ovine", + "ell i", + "Ġdatab ases", + "Ġout break", + "l arg", + "ĠR un", + "B E", + "Ġsur prising", + "Ġaccept able", + "Ġrot ational", + "p g", + "F E", + "w ik", + "Ġy ounger", + "ash ion", + "Ġmic roscopic", + "reg ation", + "Ġfib r", + "ĠPl an", + "Ġha pl", + "Ġmanif olds", + "Ġout per", + "Ġcho osing", + "e per", + "Ġke V", + "ĠT yp", + "p read", + "nt z", + "ĠRe port", + "ĠMat rix", + "Ġint u", + "Ġproper ly", + "og ly", + "oscop ic", + "ĠA MP", + "ĠB M", + "Ġelement ary", + "kele ton", + "Ġsyn thase", + "Ġion ization", + "b es", + "oph age", + "duc es", + "acc o", + "Ġprot ect", + "ĠCo ul", + "Ġsp ent", + "Ġm and", + "Ġh ind", + "flu or", + "ĠG ood", + "Ġdo ing", + "Ob ject", + "duc ts", + "o yl", + "chi atric", + "Ġo v", + "c el", + "Ġb ases", + "Ġmitochond ria", + "p ted", + "art z", + "Ġb rown", + "Ġequ als", + "ti ble", + "Ġopportun ity", + "az ol", + "Ġoff icial", + "ail ed", + "Ġur inary", + "ĠH an", + "B e", + "res ult", + "un its", + "Ġb ad", + "ĠSt ring", + "iz able", + "con dition", + "ĠElect ron", + "immun e", + "ĠM E", + "ha o", + "Î £", + "ĠM AT", + "Ġad opt", + "Ġel ic", + "Ġsh r", + "Ġproxim al", + "F D", + "ĠS S", + "Ġentire ly", + "es ium", + "ĠE EG", + "Ġpa ired", + "ĠT P", + "ĠD O", + "NA L", + "ides pread", + "Ġmov es", + "s ite", + "Ġra in", + "Ġl ap", + "ĠF u", + "ĠM eta", + "irc raft", + "Ġmagne tization", + "oper ation", + "Ġpro st", + "Ste p", + "Ġsubgroup s", + "ĠS outhern", + "Ġat he", + "lu or", + "ĠTaxon omic", + "ĠE instein", + "Ġr ace", + "ĠK en", + "Ġattem pts", + "Ġcos mic", + "ĠD op", + "Ġfix ation", + "Ġremov ing", + "B T", + "Ġlim b", + "Ġal ign", + "Ġd ried", + "d u", + "Ġput ative", + "uc cess", + "per t", + "Ġslow ly", + "al so", + "ol ip", + "Ġcl ient", + "Ġbas in", + "Ġsuscepti ble", + "Ġcom ing", + "ns on", + "ĠN GC", + "ass ert", + "Ġtens ile", + "Ġar ises", + "cut aneous", + "Ġc aro", + "B i", + "Ġdiscuss ions", + "Ġabnormal ities", + "Ġpoll ution", + "ĠA x", + "Ġload s", + "D o", + "ia o", + "Ġmed ication", + "Ġint act", + "ĠC X", + "Ġbre eding", + "ĠUn ion", + "ĠB at", + "ĠPar ticipants", + "ĠReg ulation", + "Ġcontrad iction", + "Ġint ensities", + "ence phal", + "ri le", + "ĠT LR", + "Ġred und", + "Ġpers ons", + "ĠAr c", + "sol id", + "l aw", + "Res ults", + "il ic", + "z one", + "ocyt osis", + "Ġtri angle", + "ST M", + "ĠV irus", + "Ġa id", + "so ft", + "Ġso on", + "exp ected", + "Ġan ch", + "ĠM u", + "ĠS r", + "ĠL O", + "Ġc ry", + "Ġup stream", + "ox ic", + "math it", + "ĠK le", + "Ġis otropic", + "Ġspati ally", + "ĠH ard", + "Ġext r", + "b as", + "e or", + "iv il", + "y an", + "Ġshif ted", + "Ġbi opsy", + "Ġfe el", + "gl ut", + "S ize", + "Ġ erg", + "ĠT er", + "Ġdeath s", + "bor ne", + "Ġrel ativistic", + "ĠV EGF", + "at ab", + "s pring", + "res tim", + "ĠS earch", + "yp henyl", + "ec al", + "ur c", + "Ġl amin", + "Ġser ial", + "l as", + "ĠPro duction", + "Ġsoci o", + "Ġmod ify", + "ĠServ ice", + "Ġb ary", + "Ġradi ative", + "big l", + "Ġparad igm", + "pati ent", + "Ġsp p", + "ph one", + "Ġ î", + "Ġro cks", + "ĠMart in", + "m n", + "Ġflu ids", + "ĠIN TR", + "od s", + "Ġdiv is", + "Cons ider", + "comp onent", + "Ġanomal ies", + "Ġk nee", + "ĠRelations hip", + "a ud", + "Ġover night", + "Ġra inf", + "Ġanne aling", + "Ġtre ating", + "Ġco arse", + "Mod el", + "Ġp ose", + "Ġocc as", + "ĠWilli am", + "o or", + "Ġadjust ment", + "ĠF unctions", + "im eter", + "Ġdet ectors", + "Ġinstit utional", + "Ġthrough put", + "iv idual", + "Ġenti ties", + "Ġprolong ed", + "Ġsh ip", + "Ġpres erved", + "ODU CTION", + "Ġlog istic", + "ĠPred iction", + "ti zed", + "ĠOr ig", + "ĠH em", + "onom ous", + "######## ########", + "ĠGen eration", + "b ottom", + "ĠK now", + "cl inical", + "Ġtra uma", + "Ġiter ative", + "Ġfac ility", + "ron t", + "ĠB us", + "Ġret inal", + "Ġcon duction", + "Ġcheck ed", + "Ġcall s", + "olog ists", + "C ON", + "ĠSc iences", + "Ġnon zero", + "Ġb rack", + "Ġmel ting", + "Ġas c", + "Ġmen tion", + "ĠB L", + "Ġver ification", + "uk ary", + "ĠSp atial", + "ĠG ram", + "Ġpl aces", + "Ġnec rosis", + "ĠChild ren", + "Ġdel ivered", + "Ġres ection", + "Ġdetermin istic", + "S ection", + "Ġmul tim", + "D F", + "Ġhypot heses", + "Ġra ise", + "Ġse ismic", + "Ġl am", + "ĠH CC", + "big r", + "Ġhe aling", + "is y", + "Ġoptim ize", + "obacter ium", + "ed y", + "Ġtr uth", + "Ġspace time", + "Ġchrom atin", + "Ġdom estic", + "Ġrec ru", + "ĠJ ose", + "ĠTherm al", + "Ġenvelop e", + "v able", + "Ġinc ons", + "Ġn od", + "Ð ¸", + "Ġcontrib uting", + "Ġguarant ee", + "ĠP hen", + "Ġra b", + "M an", + "Ġsurve illance", + "Ġth ings", + "Ġpre v", + "ĠNon linear", + "Ġg aps", + "ay a", + "ĠC ri", + "Ġcrystall ine", + "str ict", + "Ġcomput ations", + "Ġun able", + "h abil", + "um ina", + "Ġpromot ing", + "eg rad", + "Ġreg ister", + "Ġcross ing", + "ul ators", + "ĠL anguage", + "ĠA A", + "Ġin er", + "ĠL V", + "os an", + "Ġcoast al", + "Ġbi od", + "ĠM OD", + "Ġneighb our", + "Ġpredominant ly", + "ĠNew ton", + "ĠStr ateg", + "be ing", + "Ġ ì", + "Ġcap abilities", + "Ġun less", + "form al", + "Ġvess el", + "b matrix", + "ES S", + "Ġrainf all", + "à £", + "Ġpre par", + "ax ial", + "Ġd ental", + "ĠPro te", + "Ġwor se", + "d oped", + "hen tic", + "Ġvalid ate", + "Z n", + "Ġspec ification", + "s i", + "ĠAn g", + "Ġtub es", + "ul ic", + "ĠAn y", + "ĠM ap", + "Ġfabric ated", + "Ġfor ced", + "ĠWil son", + "ol ysis", + "ĠW ave", + "ĠC ast", + "Ġast hma", + "Ġper i", + "ĠC yt", + "ast y", + "Ġsk y", + "rup t", + "D ec", + "Ġmelan oma", + "P ER", + "Ġcontinu ity", + "B ox", + "s ystem", + "Ġn avig", + "Ġcirc ulating", + "Ġcolon y", + "less sim", + "ad ium", + "Ġtet ra", + "Ġacc ounts", + "Ġpresent ing", + "ĠL ik", + "Ġres is", + "Ġdamp ing", + "ĠG ly", + "ĠNeu ro", + "us er", + "Ġcap ital", + "ur ate", + "ĠM W", + "Ġcorrel ates", + "ĠG ib", + "Ġhapp ens", + "Ġg all", + "ĠWith in", + "Ġcomb ine", + "Ġsin us", + "ĠK in", + "**************** ****************", + "M ap", + "Ġmat uration", + "Ġblock ing", + "ĠClo ud", + "Ġcont acts", + "Ġs ac", + "AL L", + "ĠR ab", + "z z", + "ut ch", + "Ġcar riers", + "ĠSN R", + "er b", + "Ġprot ected", + "rack ing", + "radi ent", + "Ġattrac tive", + "Ġl ag", + "Ġop in", + "ĠG i", + "Ġdef ense", + "Ġtun ing", + "Ġelect roph", + "Ġgreat est", + "Ġreconstruc ted", + "ĠPop ulation", + "M AP", + "Ġw rote", + "AN D", + "ec onomic", + "ĠMich ael", + "ĠBl ock", + "Ġv o", + "op rop", + "Ġprof iling", + "oot st", + "ĠAs ian", + "Ġoscill ation", + "ĠâĨ IJ", + "U D", + "Ġsign ed", + "ĠE uler", + "ĠCompar ative", + "ĠW here", + "ĠJ ack", + "Ġpass ing", + "Ġvill age", + "Ġa u", + "ĠNor thern", + "ess age", + "m atic", + "Ġaff ili", + "ĠF ac", + "Ġoverl apping", + "she ll", + "Ġobst ac", + "Ġbec oming", + "enti ve", + "Ġeas ier", + "init ely", + "Ġcent ered", + "Ġac ademic", + "ann els", + "Ġir regular", + "Ġproj ections", + "Ġpro position", + "Ġdiscrim ination", + "Ġrem od", + "Ġsh oot", + "mon th", + "ess or", + "Ġdiff ers", + "ĠT V", + "ĠZ hou", + "Ġin her", + "Ġmach ines", + "Ġm ell", + "Ġconjug ate", + "Ġc oc", + "un a", + "an yl", + "Ġoff ic", + "Ġopportun ities", + "Ġve in", + "ĠCharacter istics", + "Ġpath ogenic", + "OY SA", + "ĠPark inson", + "ĠGal actic", + "FF FA", + "ys es", + "UH FFFA", + "UHFFFA OYSA", + "act in", + "Ġun us", + "hes ia", + "ace u", + "ad ow", + "os ide", + "Ġgly cos", + "Ġdil uted", + "ĠS ource", + "ol ated", + "arm aceu", + "ant om", + "Ġmus c", + "Ġaver aging", + "Ġvis it", + "Ġc atch", + "Ġsatisf action", + "Ġv on", + "val id", + "Ġyield ed", + "Ġpack ets", + "Ġreson ant", + "p ret", + "ĠG FP", + "Ġcut ting", + "Ġreplac ing", + "az e", + "P a", + "Ġto day", + "Ġdec ided", + "il ateral", + "im ate", + "l ings", + "ĠRob ust", + "ĠA st", + "od ynamics", + "Ġlack ing", + "izophren ia", + "Ġcont raction", + "um ann", + "ĠS ample", + "Ġdi amond", + "met hod", + "T OR", + "Ġcom ments", + "se y", + "Ġmanufact uring", + "ĠD a", + "N R", + "Ġoper ated", + "r ates", + "Ġextinc tion", + "u vant", + "ĠF inite", + "Ġlymph ocytes", + "b ro", + "om ology", + "Ġinstr uments", + "b ec", + "og le", + "Ġqu oti", + "Ġhyper bolic", + "Ġtr im", + "Ġp ap", + "atur ated", + "h aus", + "Ġs essions", + "Ġcamp aign", + "Ġvari eties", + "Ġpro jected", + "Ġr id", + "b one", + "Ġanc est", + "ĠE T", + "ma il", + "ĠTrans port", + "// /", + "ĠAn n", + "Ġcompos itions", + "ĠINTR ODUCTION", + "ĠâĪĴ âĨĴ", + "Ġwhen ever", + "ĠL ip", + "par ts", + "Ġis omorphic", + "Ġsulf ate", + "Ġh op", + "Ġg on", + "ĠOb ject", + "Ġpip eline", + "Ġm a", + "ĠG as", + "Ġtend ency", + "ob ject", + "Ġparamet ric", + "ĠRet urn", + "Ġd war", + "Ġpress ures", + "ĠBi os", + "Ġmulti plication", + "Ġdim in", + "Ġcol ors", + "ĠTr ue", + "M ax", + "ĠD epend", + "Ġpair wise", + "Ġl ake", + "Ġhierarch y", + "Ġthresh olds", + "ĠAdap tive", + "m aking", + "Ġcataly sts", + "ip al", + "Ġeg gs", + "Ġw ire", + "ophyl l", + "ict or", + "label ed", + "Ġmus cles", + "ĠUnder standing", + "Ġfib re", + "cont rolled", + "Ġinvari ance", + "Ġc ache", + "Ġbos on", + "Ġnear by", + "ĠW omen", + "ĠIn itial", + "Ġprob abilistic", + "Ġembry onic", + "ĠB etween", + "Ġcon jecture", + "i enti", + "t x", + "g ens", + "anc k", + "Ġg ir", + "ĠL ower", + "Ġhospit als", + "brid ge", + "Met hod", + "Ġthe ta", + "j a", + "Ġconcept ual", + "Ġcol le", + "ĠS af", + "d ic", + "Ġp et", + "Ġprim er", + "ĠO h", + "Ġun treated", + "long rightarrow", + "Ġl icense", + "Ġhel ps", + "Ġcle avage", + "Ġampl ified", + "Ð µ", + "Ġaccess ible", + "ĠSe lection", + "ĠLore ntz", + "P y", + "Ġpolar ized", + "ĠST AT", + "mit t", + "U p", + "Ġon going", + "Ġne ph", + "e fficient", + "ac tiv", + "ĠR R", + "Ġfunction ing", + "ot in", + "Ġl ists", + "Ġformal ism", + "Ġoscill ator", + "Ġgastro intestinal", + "ootst rap", + "ĠAs ia", + "ĠD ay", + "Ġcomp eting", + "ival ent", + "Ġbl adder", + "Ġh it", + "Ġapproxim ations", + "ĠE g", + "ĠCl ust", + "Ġrel ies", + "N E", + "cop ro", + "Ġb ank", + "Ġintegr ating", + "ĠH ear", + "Ġiniti ated", + "ac ryl", + "ĠB H", + "rac ted", + "y c", + "ĠR a", + "Ġremark able", + "Ġ Ë", + "ten ess", + "Ġemploy ing", + "ste ine", + "Ġï£ Ń", + "Ġtransf ected", + "Ġinj uries", + "ĠB rief", + "Ġw idespread", + "ĠA K", + "IV E", + "Ġh arm", + "Ġpo le", + "Ġanis otropic", + "at en", + "gen e", + "iv ariate", + "In ter", + "duct ors", + "Ġaccom pl", + "oglob in", + "c ong", + "Ġqu eries", + "escop e", + "ĠH op", + "Ġenti ty", + "Ġoff ered", + "St ate", + "ĠExperim ents", + "ann er", + "ĠW ood", + "ard ed", + "ag on", + "Ġfibrobl asts", + "Ġnan os", + "Ġper oxid", + "Ġev id", + "Ġï£ ¸", + "Ġre tained", + "os qu", + "Ġle aving", + "Ġf ashion", + "Ġn M", + "Ġmut ual", + "appro xim", + "Ġwalk ing", + "Ġim possible", + "Ġdemonstr ating", + "Ġde gener", + "ĠA V", + "Ġcont rary", + "us tion", + "ocl onal", + "A nal", + "Ġperform ances", + "Ġcomp rom", + "orm s", + "Ġbud get", + "ĠH aw", + "Ġarth ritis", + "ob j", + "no ise", + "Ti O", + "och rome", + "Ġge odes", + "be an", + "Ġselec tivity", + "ĠF ood", + "ugh ter", + "Ġpermut ation", + "ĠR P", + "os al", + "Ġadi p", + "armaceu tical", + "w hen", + "ĠT ext", + "we ek", + "Ġbond ing", + "ar b", + "oc or", + "Ġv oc", + "Ġup regulated", + "Ġneighb ors", + "Ġtra it", + "Ġthe ore", + "Ġc f", + "ĠB erg", + "ĠL A", + "Ġl as", + "un te", + "cept ual", + "AS E", + "Ġischem ic", + "Ġb ending", + "d ataset", + "Ġkeep ing", + "Ġar rows", + "Ġsubst ances", + "Ġn s", + "Ġext ending", + "ĠR u", + "Ġsupplement ation", + "cri tical", + "ĠT raining", + "bul let", + "Ġpar a", + "ta il", + "ĠRef erence", + "Ġï£ ¶", + "Ġdissip ation", + "Ġaux iliary", + "ĠCy cl", + "s tim", + "Ġdil ution", + "bu f", + "ĠM iss", + "Ġul timately", + "Ġpow ers", + "Ġst ands", + "ust ed", + "ĠO H", + "habil itation", + "an aly", + "ĠB ra", + "ad ding", + "Cor ollary", + "Ġd rought", + "qu ality", + "Ġstandard ized", + "ĠJ e", + "ĠAc id", + "Ġm ism", + "ĠCh rom", + "d raw", + "ĠBi om", + "ĠSt ability", + "Further more", + "l ast", + "v ic", + "Ġab st", + "Ġb is", + "Ġemerg ence", + "Ġg iant", + "D e", + "ĠS amples", + "AB A", + "n as", + "Ġon t", + "Ġev ap", + "le vant", + "m ain", + "ĠR od", + "Ġc ros", + "it ary", + "Ġdo ub", + "r ö", + "igene tic", + "Ġincom plete", + "dep th", + "ï ģ", + "Ġsatur ated", + "Ġaeros ol", + "As sum", + "Ġimmun os", + "Ġlip ids", + "itone al", + "Ġbe aring", + "ĠIm plications", + "Ġsustain ed", + "Ġcompe titive", + "Ġmo tivation", + "Ġdisturb ance", + "rystall ine", + "Ġtax a", + "Ġdem entia", + "Ġconcer ned", + "PI O", + "hom ogeneous", + "ĠE v", + "ĠGe orge", + "ĠAlgorithm s", + "ick el", + "us ively", + "Ġcor ner", + "ĠR est", + "Ġinf inity", + "ĠTrans form", + "hen g", + "Ġneuro de", + "ol im", + "Í ij", + "Ġsk ew", + "ĠB S", + "sc ore", + "Y PE", + "em an", + "el le", + "ĠCor relation", + "Ġcult ural", + "oph osph", + "Ġatten uation", + "Ġaggreg ate", + "Ġam big", + "Ġanomal ous", + "Ġt ors", + "Ġplan et", + "ĠN Ps", + "h r", + "ĠDiv ision", + "ĠEduc ation", + "lec tic", + "Ġb rought", + "ĠM orph", + "Ġplan es", + "Ġsug ar", + "Ġdend ritic", + "Ġcont our", + "Ġcylind er", + "p ost", + "Ġw ent", + "R L", + "Ġad mission", + "MS E", + "I X", + "Ġdis joint", + "Ġannot ation", + "Ġis otope", + "Ġμ ν", + "Ġelim inate", + "Ġre actor", + "on ents", + "Ġreason ing", + "Ġm orbidity", + "Ġcor rosion", + "other mal", + "arc tic", + "ĠM B", + "ĠZ hao", + "Ġhist ological", + "Ġsuperconduc ting", + "at tered", + "Ġhouse hold", + "ĠPro p", + "Ġass er", + "he red", + "Ġte ams", + "Ġvan ishes", + "P re", + "am ents", + "Ġam orphous", + "ĠDeterm ination", + "miss ions", + "Ġover head", + "det erm", + "Ġutil izing", + "f a", + "ip olar", + "Ġform ulated", + "Ġext rap", + "gr id", + "Ġhum idity", + "ub er", + "t umor", + "ro us", + "Ġdistor tion", + "d ynamics", + "ĠL oss", + "Ġscal ed", + "Ġischem ia", + "Ġax es", + "Ġqu antit", + "n it", + "ĠReg ion", + "ain ed", + "Ġf ill", + "Ġbran ching", + "ĠT iss", + "c ross", + "Ġplate let", + "iffiff iffiff", + "ro ps", + "lu x", + "j oin", + "ur acy", + "ic ide", + "ĠLou is", + "Ġï£ «", + "Ġstr ings", + "ys et", + "Ġfac ial", + "ĠM MP", + "RE S", + "Ġhydro lysis", + "ĠCan adian", + "Ġpro jective", + "Ġsc atter", + "ur on", + "ĠPsy ch", + "com plex", + "ĠN am", + "Ġconc urrent", + "ION S", + "Ġth ous", + "Ġch ance", + "Ġplac ement", + "Ġaware ness", + "Ġt rib", + "ĠT ex", + "ĠTh ird", + "Ġlabel ing", + "cer ol", + "Ġs aw", + "ĠB and", + "ĠP ear", + "Ġpregn ant", + "ĠD own", + "pl atin", + "S eq", + "x e", + "ethyl ene", + "ĠHig her", + "Ġre ality", + "ur is", + "ĠP AR", + "l b", + "d ose", + "sh if", + "ili ar", + "t otal", + "S W", + "Ġval ve", + "nd er", + "Ð ½", + "am ous", + "Ġend omet", + "LI SA", + "Ġfract ures", + "Ġfil t", + "ro le", + "Ġmicro structure", + "ĠSN P", + "T ER", + "ĠZn O", + "ov ing", + "al i", + "ĠG M", + "unc t", + "Ġext ensions", + "exp ression", + "Ġesc ape", + "ĠM as", + "ĠSp anish", + "Ġflo or", + "ĠCom mon", + "otop y", + "plement ation", + "Ġr hyth", + "Ġserv es", + "y to", + "Ġwavelength s", + "empt yset", + "ĠH ill", + "n or", + "ĠElect ro", + "Ġde hydrogen", + "Ġwh om", + "im etric", + "ĠR oman", + "ĠV e", + "âī ¥", + "ĠK u", + "ĠTrans fer", + "Ä ĩ", + "ĠT F", + "b rain", + "copro tein", + "ĠG reat", + "av en", + "ĠInd ividual", + "ur i", + "Ġfung i", + "Ġpar am", + "pt on", + "s ymmetry", + "Ġloc k", + "me as", + "Ġha em", + "Ġh ip", + "As s", + "eng er", + "Ġpot assium", + "an al", + "ibr ary", + "Ġschool s", + "n atal", + "Ġalle les", + "ĠH LA", + "ox ygen", + "ĠC up", + "Ġpure ly", + "D O", + "Ġch ip", + "ô ı", + "C ar", + "s il", + "Ġun likely", + "cor respond", + "ĠD P", + "Ġint ense", + "Ġfor cing", + "ĠJ ournal", + "Ġar row", + "ocy an", + "Ġcul tiv", + "Ġbl ind", + "Ġselect ing", + "oc arcinoma", + "ran ce", + "Ġhydroph obic", + "clos ed", + "Ġens ures", + "Ġprom oted", + "Ġdetect able", + "rane an", + "Ġsched ule", + "Ġpart ly", + "Ġgl and", + "Ġco uple", + "ĠEm erg", + "Ġtrac es", + "p oly", + "Ġprote ase", + "ys tic", + "Ġdoc uments", + "pos itions", + "Ġdri ver", + "ti um", + "ĠC YP", + "cl ose", + "ĠRec ep", + "Ġper mit", + "Ġblock ed", + "Ġinvestig ating", + "ĠT umor", + "ĠB ig", + "Ġwave gu", + "Ġsubst ance", + "Ġweak er", + "ĠM ont", + "ro vers", + "ĠMex ico", + "p res", + "ĠAc ute", + "Ġmicro gl", + "ĠE S", + "itor ing", + "ĠSer ies", + "l ights", + "Ġhypot hesized", + "Ġconstruc ts", + "Ġfilt ration", + "Bl ack", + "Ġun changed", + "Ġobserv able", + "Ġra y", + "b etween", + "Ġï£ ¯", + "ĠPos ition", + "Ġth i", + "ĠSystem atic", + "Cl ass", + "k m", + "ĠT ak", + "Ġrespond ents", + "Ġinn ate", + "Ġan t", + "Ġconn ecting", + "R el", + "Ġmanip ulation", + "ĠN eg", + "N Ps", + "ĠDi ab", + "ĠAc tive", + "ĠG all", + "ĠCoul omb", + "Ġspac ing", + "ĠF lor", + "Ġconduct ance", + "Ġtrac ks", + "ĠZh u", + "weight ed", + "ro cy", + "Ġfat her", + "id ium", + "struct ured", + "ĠT el", + "Ġst rom", + "ith ub", + "cer tain", + "B ut", + "ĠAc cess", + "Ġprevent ing", + "rest rial", + "ĠCons idering", + "tr ue", + "Ġhost s", + "Ġwor st", + "ĠP d", + "gre di", + "Ġgly col", + "Ġst ory", + "osqu ito", + "par atus", + "Ġme eting", + "Ġepis ode", + "n c", + "ĠS and", + "Ġu int", + "ynam ical", + "ur t", + "Ġeduc ational", + "Ġfocus es", + "g t", + "ĠH S", + "Ġdeterm inant", + "Ġlith ium", + "ĠDig ital", + "Ġguid ance", + "Ġprior ity", + "Ġpar ty", + "or ial", + "T wo", + "ĠProblem s", + "Ġsem an", + "ĠCN N", + "ĠE pid", + "Ġplay ing", + "Ġelim ination", + "ĠS at", + "Ġobj ectives", + "p lectic", + "Ġcircum st", + "ĠG S", + "oc ellular", + "ot rans", + "Ġfind s", + "Ġa romatic", + "iz ers", + "Ġfavor able", + "st andard", + "ich lor", + "mod els", + "otyp ing", + "Ġstabil ization", + "Ġhand ling", + "Ġco ated", + "e ven", + "Ġlet ter", + "Z E", + "Ġultr ason", + "Ġf riend", + "Ġsens iti", + "Ġatt achment", + "Ġap art", + "Ġgre y", + "Ġa ircraft", + "Ġr RNA", + "Ġenabl ed", + "Ġbu ff", + "Ġred ox", + "ass isted", + "Ġgener ality", + "PS S", + "Ġe lection", + "resp onse", + "Ġded icated", + "Ġdem ographic", + "Ġim posed", + "ĠK ir", + "ĠRad io", + "ĠE LISA", + "ga e", + "Ġres c", + "ĠR ic", + "raph ic", + "Ġra il", + "Ġj ournal", + "ol er", + "W S", + "Ġincorpor ation", + "w ind", + "Ġaud itory", + "A E", + "t ask", + "Ġp c", + "w all", + "Ġapp rec", + "aterial s", + "Ġpart ner", + "Ġcollec tive", + "Ġsc oring", + "ĠFran k", + "Ġperman ent", + "ĠI ran", + "um ination", + "M ed", + "ĠHy brid", + "Ġphen otypic", + "Ġdisrup tion", + "vi olet", + "osp heric", + "Ġregim es", + "ĠCol or", + "ĠPati ent", + "Ġf ever", + "Ġn n", + "Ġvari ational", + "ke ys", + "Ġdis till", + "Ġspect roscopic", + "ĠAr chitect", + "ac ing", + "Ġpro ves", + "Ġver teb", + "ĠComput er", + "Ġexp ensive", + "Ġfro zen", + "arcom a", + "N K", + "Ġhist one", + "Ġpolymer ization", + "Ġto b", + "Ġturn ed", + "eff ective", + "ĠAut hor", + "AP I", + "Ġdec ade", + "ĠRo bert", + "Ex ample", + "over set", + "AB LE", + "ĠBehavi or", + "f eed", + "ĠT ai", + "Ġï£ º", + "Ġe gg", + "Ġc ath", + "au x", + "ĠJoh nson", + "Ġtor que", + "Ġpur ification", + "Wh ite", + "c ious", + "ĠS ong", + "Ġprecip it", + "resh old", + "Ġm ilitary", + "Ġconv ection", + "ĠM iddle", + "ĠW he", + "Ġ ôı", + "al and", + "ar ation", + "fig ure", + "Ġded uce", + "chlor o", + "c ost", + "ithm etic", + "ĠItal ian", + "miss ible", + "ĠCommun ity", + "ĠN ature", + "Ġdi oxide", + "Ġbal anced", + "et t", + "ST AT", + "ild ing", + "Ġev olved", + "Ġmon ot", + "p ur", + "Ġpref erences", + "ding er", + "Ġarg ue", + "Ġmo tions", + "Ġinf ant", + "Ġaccel erated", + "Ġobser ver", + "Ġfabric ation", + "ĠMechan isms", + "Ġfunc tor", + "Ġhar ves", + "r ase", + "ĠSpec ial", + "Ġdepos its", + "Ġr ub", + "à ¸", + "ĠCP U", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ Ġ", + "atom ical", + "Ġfin it", + "Ġsec ure", + "Ġnutri tional", + "ren al", + "ĠF alse", + "Ġshe l", + "Ġrecru ited", + "am big", + "ĠSign aling", + "K O", + "organ isms", + "ĠL T", + "el en", + "ĠM arc", + "ab atic", + "Ġt ables", + "Ġconf ined", + "ĠA z", + "Ġproduc tivity", + "Ġad herence", + "Ġreplic ates", + "Ġvir t", + "f in", + "Ġagric ultural", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠ", + "ĠCh ampionship", + "and a", + "ĠCh urch", + "D uring", + "Ġinser ted", + "igh ter", + "Ġx en", + "Ġs ave", + "Ġtang ent", + "ven ous", + "Ġconver ge", + "Ġdistingu ished", + "Ġexpl os", + "Ġa ortic", + "Ġj ump", + "Ġneon atal", + "ud den", + "Ġslow er", + "Ġinfarc tion", + "Ġpre vents", + "u er", + "Ġ eros", + "R P", + "Ġcontin ues", + "OR T", + "Ġconsid ers", + "ĠN uclear", + "ly mp", + "Ġacc ounted", + "ores is", + "Ġneighbor ing", + "ĠRich ard", + "Ġen for", + "ĠCh ronic", + "Ġdisc over", + "ĠH ong", + "cell s", + "ĠCh all", + "Ġhom ogen", + "Ġathe ros", + "Ġisol ate", + "ĠPlas ma", + "ĠD L", + "par ametric", + "ĠUp per", + "H P", + "Ġintro duces", + "Ġmother s", + "Ġatt ract", + "Ġexcl usion", + "gra vity", + "ĠK r", + "Ġsp ike", + "ĠHe at", + "v ival", + "ĠRNA s", + "b ach", + "ator ial", + "ĠL td", + "on omy", + "in vasive", + "l ass", + "Ġwell s", + "Ġimag inary", + "Ġcarb ohyd", + "od a", + "Ġactiv ate", + "µ Ħ", + "Ġenzym atic", + "p es", + "Ġstat ements", + "Ġapproxim ated", + "ĠSal mon", + "ophage al", + "ĠH PV", + "con f", + "um at", + "Ġsulf ur", + "ĠRec all", + "Ġch ond", + "Ġvi able", + "por ation", + "Ġcare fully", + "tet ra", + "Ġlymph oma", + "st at", + "Ġconserv ative", + "atab ase", + "m and", + "Ġsc ored", + "Ġv as", + "Ġpri vacy", + "onym ous", + "Ġlogarithm ic", + "ĠE con", + "Ġachie ves", + "Ġabund ances", + "c am", + "Ġcy an", + "ĠE L", + "idel ity", + "j o", + "Ġan ticip", + "re ported", + "Ġarrang ement", + "iter ranean", + "ps is", + "ich i", + "Ġt a", + "um ping", + "ĠAc tivation", + "Ġmel t", + "Ġan no", + "og e", + "ĠD am", + "optim al", + "Ġneu rological", + "s a", + "ĠPar ameters", + "off set", + "Ġc ement", + "Ġinhib iting", + "Ġch ose", + "itz er", + "at tr", + "Ġmod er", + "ator ies", + "Ġte aching", + "ĠC ore", + "ph thal", + "ĠL uc", + "Ġin gredi", + "Ġclear ance", + "Ġachie ving", + "t age", + "Ġbur st", + "vi e", + "ĠSp ain", + "pt o", + "Ġtrans membrane", + "Ġsup plementary", + "Ġto ken", + "Ġobvious ly", + "ĠV ector", + "Ġdest r", + "H OD", + "Ġassum es", + "Ġpenet ration", + "Ġsub jective", + "h olds", + "ã o", + "Ġmo tiv", + "Ġprovid ers", + "v ascular", + "Ġdepart ment", + "ock et", + "F ile", + "Ġbre ath", + "ĠB est", + "gra ble", + "Ġl iqu", + "ĠAr g", + "ĠB ob", + "Ġfrag mentation", + "ec tic", + "Ġv ital", + "s ince", + "all oc", + "ox yphenyl", + "Ġradi otherapy", + "ĠSD S", + "Ġcyt ometry", + "n ucle", + "ĠI M", + "ĠTe V", + "raf ish", + "ĠKore a", + "Ġstreng then", + "Ġb are", + "Ġw oman", + "Ġrad ar", + "Ġplatform s", + "ozyg ous", + "ĠA h", + "Ġsub types", + "py rid", + "ĠTrans cription", + "Ġá º", + "ĠMeasure ments", + "Ġsurv iv", + "ĠN ear", + "Ġcasc ade", + "out he", + "B U", + "Ġexpon entially", + "Ġhaz ard", + "Ġsi RNA", + "Ġcell ulose", + "Fig s", + "Ġdifferenti ated", + "Ġim plicated", + "met ric", + "Ġcorrel ate", + "Ġm ission", + "Ġmant le", + "ĠP hyl", + "ĠH art", + "Ġg ases", + "Ġun ity", + "Ġexper t", + "Ġchar t", + "Ġd ict", + "Ġep ile", + "Ġoff spring", + "Ġemerg ed", + "Ġdem ands", + "Ġpres um", + "orb id", + "ĠMed icine", + "Ġstream s", + "tic ed", + "ĠN ic", + "Ġf illing", + "ĠC ro", + "Ġrestric tions", + "S ee", + "ĠM ill", + "Ġparent al", + "Ġdetermin ants", + "Ġecos ystem", + "ĠW all", + "ĠM emory", + "ple ts", + "Ġaggreg ates", + "per turb", + "Ġresid ents", + "AC K", + "v ectors", + "Ġman ually", + "Ġï ĺ", + "ĠFrame work", + "Ġv ag", + "eb rafish", + "l ib", + "ĠHear t", + "ĠAn imal", + "Ġwid er", + "G ene", + "ĠR os", + "Ġoper ate", + "Ġposs ibilities", + "ĠStr ong", + "Ġpy ro", + "resp ectively", + "Ġhybrid ization", + "ip edia", + "x in", + "Ġst om", + "f ish", + "ĠFor ce", + "Ġdim er", + "SU L", + "el se", + "Ġund e", + "g ar", + "con v", + "Ġarri val", + "Ġmon oclonal", + "I AL", + "Ġl y", + "Ġsymmet ries", + "Ġnur sing", + "rac h", + "Ġó µĦ", + "Ġbi ased", + "Ġc ues", + "Ġbiomark er", + "d ers", + "Ġc row", + "ern els", + "Ġbil ateral", + "Ġphys ically", + "Ġpat ches", + "Ġunc on", + "ĠB efore", + "def ault", + "est yle", + "t frac", + "ĠC ox", + "Ġinf iltration", + "Ġconver t", + "Ġstreng ths", + "ĠS ar", + "ig ible", + "oc omp", + "Ġsti r", + "Ġsch izophrenia", + "w as", + "Ġo w", + "et erm", + "ĠOr der", + "Ġf oss", + "Ġline age", + "Ġrab bit", + "Ġregular ization", + "ran ch", + "opl astic", + "T O", + "Ġmeas urable", + "Ġm ang", + "in itial", + "Ġbuild ings", + "Ġsystem atically", + "Ġferm ions", + "Ġlibr aries", + "Ġab lation", + "ide os", + "ĠW i", + "ph oton", + "ĠTest ing", + "ĠComput ing", + "ti er", + "in et", + "Ġprim itive", + "Ġcap illary", + "Ġsl ip", + "ver gence", + "rap eutic", + "ĠBl ue", + "ĠAc ad", + "ha i", + "ĠL ew", + "Ġtri angular", + "MS O", + "Ġsal inity", + "Ġnanoc om", + "o a", + "Ġhom omorphism", + "ĠM M", + "Ġres in", + "D B", + "um inescence", + "d ashed", + "ĠK h", + "qu ark", + "emb les", + "Ġidentif ies", + "Ġfol lic", + "Ġmet am", + "ĠH erm", + "Ġtob acco", + "Ġreal ization", + "hydro x", + "ĠB et", + "B ecause", + "Ġpiec es", + "Ġt alk", + "Ġopen ed", + "as ome", + "Ġsur ge", + "Ġfluct uation", + "g ithub", + "ĠB acter", + "Ġbind s", + "ĠRap id", + "au er", + "p H", + "emb ed", + "ĠD oc", + "uch i", + "ĠC andid", + "Ġrare ly", + "Ġm ountain", + "ĠF at", + "Ġs end", + "ov sk", + "ĠOrgan ization", + "ĠFran c", + "ĠO P", + "âĪ ¼", + "ok es", + "ec e", + "def icient", + "Ġlink age", + "od on", + "Ġf ly", + "Ġt idal", + "ĠEx amples", + "ĠR out", + "Ġaccom mod", + "Sup pose", + "ad ap", + "Ġdi e", + "ro ot", + "Ġh on", + "Ġminim izing", + "Ġrough ness", + "Ġgr ass", + "ent a", + "ĠL ang", + "ed u", + "ĠSim ple", + "en ic", + "Ġinduc ing", + "t f", + "Ġcon texts", + "ĠGeneral ized", + "ĠW nt", + "P b", + "at omic", + "d em", + "ĠPre paration", + "Ġinsu fficient", + "s am", + "ĠSpec ies", + "ĠS olar", + "Ġuns igned", + "ĠH ER", + "â Ĭ", + "Ġpar ity", + "Ġnit rate", + "ĠC er", + "p tic", + "id entif", + "ge al", + "Ġemo tion", + "ĠL P", + "Ġenh ancing", + "Ġmeaning ful", + "st ation", + "Ġrel ig", + "y o", + "Ġpers pectives", + "Ġsc ans", + "ugin osa", + "Ġsummar ize", + "rel ations", + "Ġdist ant", + "Ġfunction ality", + "Ġde eper", + "ol ate", + "ĠP or", + "graph s", + "ĠW a", + "ophil ic", + "CL US", + "ropath y", + "Ġc red", + "Ġun iversity", + "se g", + "ve e", + "O G", + "ĠM en", + "ĠCri tical", + "ã ģ", + "Ġex it", + "var theta", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠ", + "Ġun f", + "Ġpropos al", + "Ġty rosine", + "oti des", + "Ġproxim ity", + "Ġbox es", + "cat en", + "ĠEnvironment al", + "bound ed", + "down arrow", + "Ġfall s", + "Ġfer til", + "Ġcompr ised", + "Ġmell itus", + "Ġleak age", + "ut y", + "Ġchrom osomes", + "ĠStat istics", + "%% %%", + "Ġcomb inator", + "Ġk et", + "ad vant", + "T her", + "Ġtop ics", + "fl at", + "n ia", + "ĠSpect ral", + "Ġsynchron ization", + "var rho", + "Ġcolon ies", + "ĠF ive", + "ag ues", + "ĠF C", + "ID S", + "Ġa ward", + "Ġyield ing", + "Ġarchitect ures", + "ashing ton", + "chit z", + "per ty", + "Ġmod uli", + "m oment", + "sp eed", + "Ġmes enchymal", + "op tera", + "Ġinc omp", + "C ell", + "ĠM ice", + "Ġg ot", + "te ger", + "Ġt au", + "ĠAd S", + "Ġb ill", + "Ġdr inking", + "uls ive", + "Ġknock down", + "Ġarm s", + "ĠAut om", + "ĠIncre ased", + "H F", + "Ġglob ally", + "Ġdop ing", + "Ġat h", + "ĠC op", + "Ġsuccess ive", + "UL T", + "el ess", + "Ġble eding", + "Ġfood s", + "Ġimmun ohist", + "Ġdef inite", + "ĠJ ones", + "ĠT S", + "Ġjo ined", + "ĠTow ards", + "ĠC s", + "Ġun like", + "Ġval ence", + "d or", + "o S", + "Ġp ush", + "Ġoff ice", + "Ġalumin um", + "id yl", + "idi rectional", + "wr itten", + "Ġb ubble", + "H I", + "Ġmarked ly", + "ĠT ok", + "Ġvesic les", + "Ġquoti ent", + "Ġrepro duce", + "Ġelse where", + "ĠMy c", + "Ġinf rastructure", + "Ġgain ed", + "ab el", + "ĠS ex", + "ĠT ables", + "et in", + "Ġhom olog", + "Ġleg al", + "he a", + "Ġsoci ety", + "Ġman aged", + "id ase", + "ĠInhib ition", + "Ġparas ite", + "Ġvol unte", + "AT P", + "i os", + "Ġse psis", + "Ġrib osomal", + "Ġconf ound", + "ĠSta phyl", + "aryn geal", + "ï Ģ", + "com b", + "ĠOb jective", + "SUL TS", + "Ġthor ough", + "m t", + "Ġc hest", + "V ector", + "ele ment", + "Ġvir ulence", + "Ġhem isp", + "Ġso ught", + "ĠK o", + "Ġnutri tion", + "ul ing", + "ian a", + "Ġprot otype", + "ĠO nt", + "c ine", + "Ġdot ted", + "Ġob ese", + "ount ered", + "Ġphysic ians", + "Ġmin i", + "Ľ ľ", + "sp aces", + "Ġexcl usively", + "ĠCon volution", + "Ġc aspase", + "ĠL ink", + "di v", + "ĠRoy al", + "h ist", + "it ness", + "Ġes ter", + "Ġconduc ting", + "Ġparticip ated", + "Ġair way", + "Ġaer uginosa", + "E xt", + "arg ument", + "ock ing", + "Ġintegr ate", + "Ġcont rovers", + "ap es", + "train ing", + "ĠPre valence", + "tem p", + "b oth", + "Ġre activity", + "Ġrank ing", + "Ġtunn eling", + "OD E", + "ĠMed iterranean", + "Ġreson ances", + "M g", + "Ġl ib", + "ĠH eter", + "Ġnot hing", + "Ġindic ation", + "ĠH M", + "ocy tic", + "st rand", + "Ġcollabor ation", + "Ġelectro static", + "Ġindepend ence", + "h ab", + "Ġconf lic", + "Ġi od", + "in us", + "Ġdepend ency", + "ĠL am", + "Ġexam ining", + "Ġoccup ied", + "Ġque ue", + "ĠB ul", + "Ġregist ered", + "Ġindivid ually", + "R x", + "aus al", + "V E", + "Ġbright ness", + "resp ons", + "bal ance", + "Ġcytotox ic", + "f all", + "com mut", + "IC AL", + "ur an", + "ain ing", + "ra ulic", + "res ults", + "Ġepis odes", + "Y S", + "ĠG ar", + "Ġsur fact", + "dr ug", + "Ġc ities", + "ĠCh ange", + "os ition", + "Ġtrig gered", + "Ġcytoplas mic", + "erv es", + "Ġle x", + "Ġasymptotic ally", + "ph y", + "Ġfron tal", + "ĠD ensity", + "Ġsyn erg", + "cy cle", + "ĠImpro ved", + "à ¸", + "Ġmon o", + "Ġaccum ulated", + "orient ed", + "b our", + "Ġtun nel", + "com ing", + "Ġap paratus", + "Ġenc ountered", + "C re", + "Ġlet ters", + "et ch", + "Ġexcess ive", + "Ġbiofil m", + "Ġrear rang", + "Ġpolymorphism s", + "er obic", + "Ġconn ect", + "res olved", + "ĠN N", + "Ġret ro", + "ĠIn iti", + "ĠQuanti f", + "Ġp up", + "T ensor", + "Ġsent ences", + "l ay", + "ran ts", + "pl oid", + "ĠAnd erson", + "Ġdes irable", + "st ud", + "i ability", + "Ġd rying", + "ec ess", + "Ġd ens", + "Ġdescri pt", + "ĠË Ĩ", + "Ġcl ones", + "Ġju ven", + "b p", + "Ġk il", + "H L", + "Ġhem orrh", + "ĠK i", + "H ow", + "Ġen erge", + "Ġsub section", + "ĠS ac", + "di al", + "Ġcardi omy", + "Ġto uch", + "d m", + "Ġsc ienti", + "oid es", + "Ġà Ĥ", + "ysacchar ide", + "Ġs clerosis", + "ĠZe aland", + "in ine", + "Ġunus ual", + "ĠB A", + "ips chitz", + "g ap", + "ĠDiff erences", + "Ġdual ity", + "ed ical", + "Ġl ign", + "Ġfail s", + "Ġ lect", + "Ġrel ate", + "Ġincor rect", + "Ġspec ify", + "Ġcylind rical", + "ĠP F", + "ĠL ind", + "Ġdet erior", + "Ġher b", + "d z", + "Ġw eld", + "Ġnom inal", + "cop y", + "Ġacet yl", + "ht ml", + "Ġrecogn ize", + "** *", + "iti an", + "W A", + "ĠM N", + "ĠF ind", + "Ġaut hentic", + "per ture", + "Ġcytotox icity", + "of l", + "ĠG et", + "Ġcoh omology", + "Ġremain der", + "Ġexpand ing", + "Ġhe av", + "oster one", + "R ight", + "Ġcop ol", + "Ġs hed", + "Ġcompl iance", + "Ġacid ic", + "or ic", + "Ġam yloid", + "Ġevap oration", + "d l", + "Ġdel ays", + "P o", + "ĠCH ECK", + "tain s", + "Ġrevers ed", + "ĠMP a", + "Ġprocess or", + "Ġh all", + "ĠL ast", + "Ġplas m", + "ĠAss ociated", + "ĠBas ic", + "in os", + "Ġsympt om", + "ã Ģ", + "Ġanth rop", + "Ġjud g", + "Ġe ti", + "k le", + "Ġwr ong", + "ro om", + "Ġdevelop ments", + "ĠMax imum", + "Ġcoating s", + "Ġheur istic", + "ron tal", + "S ome", + "Ġutil ize", + "ĠâĪ ħ", + "c oll", + "ĠRel ated", + "Ġde generation", + "tem plate", + "Ġmod ulated", + "Ġparamet ri", + "Ġsal iv", + "ĠPseud omonas", + "Ġanti gens", + "Ġhar mon", + "ĠL HC", + "do i", + "ens itive", + "ĠNo tice", + "ĠM oh", + "til age", + "AC S", + "Ġdiscrep ancy", + "Ġsp ik", + "Ġre strict", + "it rile", + "le g", + "ĠB ase", + "Ġconvolution al", + "ĠRes istance", + "Ġappear ing", + "ĠIm ages", + "ĠM ann", + "Ġre act", + "Ġmacroph age", + "Ġwave let", + "och rom", + "Ġfair ly", + "Ġpreced ing", + "Ġsp ir", + "n etwork", + "ĠN ak", + "IF T", + "Ġag o", + "Ġenc ryp", + "al d", + "ens in", + "Ġs ulph", + "ĠPol ymer", + "ĠAr t", + "Ġsub units", + "sh ot", + "Ġbeg ins", + "Ġex er", + "pro pto", + "Ġn urses", + "Ġsuff ices", + "Ġgra ded", + "ĠR ock", + "Ġuniqu ely", + "it ol", + "Ġsp iral", + "Ġthan ks", + "char acter", + "ĠDist ributed", + "ĠC art", + "F orm", + "Ġform ulations", + "iction ary", + "Ġspread ing", + "Ġsingular ity", + "Ġpig s", + "it u", + "ot rophic", + "Ñ Ģ", + "Ġsemicon ductor", + "Ġd rag", + "ne xt", + "ma xim", + "un n", + "Ġarg ued", + "pl astic", + "Ġdehydrogen ase", + "Ġreinfor cement", + "ent ral", + "ĠD S", + "Ġcompan ies", + "Ġquanti zation", + "ĠD ri", + "Ġsimpl er", + "Ġradi i", + "ĠEth ics", + "ĠElect ronic", + "t aken", + "Ġpharmac ological", + "ps on", + "Ġpair ing", + "Ġn est", + "ĠR S", + "Ġl ic", + "oc on", + "Ġobserv ing", + "ĠF M", + "I ES", + "Ġsub mitted", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠ", + "Ġno isy", + "Ġvan ishing", + "ĠTechn ologies", + "il st", + "ag ic", + "Ġembed dings", + "Ġpl ans", + "re ak", + "oc t", + "Ġepit helium", + "Ġrevers ible", + "Ġrequ ests", + "V i", + "ĠPro g", + "meth oxy", + "ur ia", + "Ġsl ice", + "Ġmetast ases", + "ĠM ary", + "Ġprior i", + "Ġexplain s", + "ĠS igma", + "ĠArm y", + "Ġpre y", + "K L", + "ĠP ass", + "Ġrepro duction", + "Ġfer mentation", + "ul o", + "Ġproof s", + "ĠAccording ly", + "ti st", + "ĠïĢ ©", + "Ġme at", + "Ġpl anned", + "Ġangi ogenesis", + "W R", + "ĠA ust", + "Similar ly", + "ĠW ashington", + "Ġref inement", + "Ġembry o", + "Ġdiss ociation", + "á n", + "plas ia", + "ĠG ro", + "Ġsimilar ities", + "Ġsolub ility", + "Ġimm obil", + "ĠSc ot", + "ĠSub sequently", + "di vid", + "Ġclos est", + "ĠW at", + "Ġâ Į", + "ĠA GN", + "Ġpres cribed", + "Ġm osquito", + "Ġf irm", + "Ġde generate", + "Ġeth yl", + "Ġhar vest", + "ĠSpec ific", + "Ġcomp artment", + "p ublic", + "ĠBi ological", + "Ġpiec e", + "Ġat titudes", + "Ġsp ray", + "ĠS ix", + "Ġprofession als", + "Ġsl ot", + "Ġretrie ved", + "ve ment", + "Ġexec uted", + "se ed", + "Ġout flow", + "d istance", + "ĠT erm", + "ad y", + "ĠProv ince", + "ĠCent re", + "ĠD FT", + "Ġs udden", + "Ġse iz", + "r at", + "rom o", + "ot echn", + "Ġhigh lights", + "Ġelectroly te", + "ĠAdv anced", + "all ow", + "p x", + "os ed", + "sub array", + "rac ks", + "P RO", + "ogen y", + "Ġpool ed", + "Ġd type", + "Ġop posed", + "ĠG rand", + "Ġdesign ing", + "b el", + "it ability", + "Ġminim ization", + "Ġdram atically", + "Ġso y", + "ag ents", + "ĠMet al", + "ĠM V", + "rib ute", + "D D", + "it an", + "Ġspeed s", + "Ġmar ried", + "Ġevalu ations", + "ĠKing dom", + "Ġcl ay", + "ĠTiss ue", + "left arrow", + "Ġcompens ation", + "ch ild", + "p ool", + "up arrow", + "ĠDom ain", + "spec ies", + "Ġmeth ane", + "ĠE GFR", + "Ġpar ser", + "h ave", + "Ġneg lected", + "f unc", + "aps ed", + "Ġs ays", + "ad ata", + "bin om", + "C ase", + "Ġre porter", + "S n", + "Ġmaxim ize", + "Ġbif urc", + "ĠCN S", + "ĠO lymp", + "Ġdecl are", + "Ġenc oder", + "Ġab elian", + "Ġsingular ities", + "Ġe ch", + "Î ¨", + "Ġpro to", + "Ġph ag", + "Ġpoly g", + "Ġb ott", + "Ġadi pose", + "u ing", + "j k", + "uch y", + "ĠStud ent", + "Ġnan ow", + "Ġth ym", + "E d", + "E nd", + "Ġtransform s", + "ĠP CA", + "k ern", + "reg n", + "Ġcom ment", + "ĠL L", + "ell es", + "Ġeng agement", + "ĠP eter", + "IS PR", + "ĠCh annel", + "in y", + "Ġbund les", + "A ld", + "Ġpublic ations", + "T G", + "st ra", + "Ġf ear", + "Ġre tic", + "ple ments", + "Ġcor pus", + "ĠCl uster", + "ĠR ate", + "Ġsimpl est", + "ac ic", + "rb rack", + "Ġb low", + "Ġcomp ress", + "ĠD ark", + "Ġpsy chiatric", + "ĠCon versely", + "Ġo wing", + "Ġabs or", + "ĠH P", + "Ġcr ude", + "equ al", + "ĠAr ray", + "ĠRel ative", + "Ġcomb ustion", + "R ed", + "k t", + "Ġm A", + "Ġt ex", + "por ters", + "Ġdiffere d", + "Ġaud io", + "z on", + "od i", + "Ġmac roscopic", + "ac in", + "Ġz eros", + "Ġfore ign", + "Ġd uct", + "b ow", + "w orth", + "ĠRo ad", + "re y", + "ace ous", + "Ġbl ast", + "Ġgran ul", + "Ġw ing", + "Ġannot ated", + "ĠF ull", + "Ġinflu encing", + "v y", + "iaz ol", + "Ġp itch", + "Ġre habilitation", + "ĠPri or", + "com it", + "math tt", + "di a", + "ĠI on", + "Ġab use", + "Ġharves ted", + "Ġepid emic", + "Ġfil ament", + "Ġnucle ation", + "ĠKnow ledge", + "rin os", + "Ġb ent", + "Ġsqu ared", + "Ġhippocamp al", + "ĠT G", + "AN T", + "mod ified", + "ari o", + "ĠF ace", + "Ġgrow s", + "Ġfa ults", + "v irus", + "Ġpartition ing", + "air s", + "Ġhe aring", + "Ġcon gen", + "Ġ rip", + "ĠColl abor", + "Ġinterview s", + "Ġh uge", + "Ġbreak down", + "Ġmonth ly", + "ĠCON CLUS", + "E ach", + "D iff", + "Ġrel ay", + "ĠM use", + "oscop y", + "Ġre new", + "g b", + "Ġb rid", + "Ġoutl ined", + "or ig", + "e at", + "ĠWith out", + "Ġsp or", + "ĠT N", + "ĠJ o", + "ĠA U", + "N ot", + "Ġret in", + "ĠAn gel", + "Ġtri ed", + "ey ond", + "j e", + "ĠRuss ian", + "ĠUn fortunately", + "ĠMean while", + "ograph s", + "Ġacc ounting", + "ĠA β", + "m b", + "Ġdop amine", + "ĠBrief ly", + "ĠF requency", + "Mat rix", + "ĠJose ph", + "Ġexper ts", + "Ġdro ps", + "ĠRE SULTS", + "Ġrect angular", + "ath ione", + "cent er", + "ĠLe ft", + "in form", + "k ins", + "Ġm il", + "ĠM ah", + "Ġmed ial", + "ĠComp any", + "Ġpass age", + "Ġlead er", + "Ġscreen ed", + "er i", + "pos ites", + "r arily", + "Ġph one", + "ie tic", + "Ġexpect ations", + "ĠPar ticle", + "ĠM ountain", + "Ġinter leukin", + "Ġfif th", + "Ġv ast", + "Ġlog ical", + "Ġt err", + "Ġcre ates", + "Ġfinit ely", + "Ġsw im", + "Ġsupernat ant", + "opath ological", + "ĠUl tra", + "ĠT y", + "Ġgra nd", + "Ġconstit ute", + "olog ist", + "ĠBro ad", + "aw are", + "Ġvic inity", + "ag ulation", + "uns igned", + "ĠS ize", + "ĠC ognitive", + "Ġsusp ected", + "Ġu pl", + "Ġauto immune", + "ĠS K", + "C B", + "Ġsl ices", + "ĠCh i", + "Ġobserv ables", + "Ġhippocamp us", + "so ver", + "Ġfund ing", + "Ġcon formation", + "ĠQ uestion", + "ĠS qu", + "ĠW ill", + "Ġsc attered", + "ir ty", + "Ġpl aus", + "cor relation", + "Ġventi lation", + "ĠGen es", + "Ġben ign", + "Ġheter o", + "St atus", + "ang led", + "Ġb ootstrap", + "Ġvacc ines", + "Ġmicro organisms", + "Ġvis its", + "Ġtheorem s", + "d rop", + "ĠT A", + "Ġcycl ing", + "Ġspectrom eter", + "Ġground water", + "Ġnanot ubes", + "Ġjo ints", + "ĠE ll", + "Ġcons ult", + "Ġwindow s", + "Ġdis ability", + "Ġgain s", + "Ġdis charg", + "Ġhe ated", + "Ġa fore", + "ary ing", + "inc re", + "Ġagg ressive", + "Ġhe mod", + "ari um", + "ĠIn st", + "v m", + "Ġdro plet", + "p tive", + "vious ly", + "Ġst arch", + "Ġd f", + "os yl", + "Ġdon ors", + "ĠUn like", + "Ġalkal ine", + "Ġintellig ence", + "a a", + "Ġaccept ance", + "Ġsl iding", + "aps es", + "ĠD iss", + "ist an", + "a uc", + "Ġb ins", + "Ġmod ulate", + "Ġman age", + "out s", + "Ġs enes", + "Ġdifferenti ate", + "Ġcoun ted", + "AS K", + "Ġantib acterial", + "Ġent ered", + "Ġdis advant", + "ĠSalmon ella", + "Ġis otopic", + "Ġanno unced", + "ĠBo ard", + "Ġrest oration", + "Ġalle vi", + "Ġprogram me", + "Ġalb umin", + "Ġcatal og", + "est ine", + "Ġdifferent ly", + "Ġm olar", + "rö dinger", + "ĠE vent", + "minist ration", + "ĠSer um", + "RO M", + "k w", + "b ot", + "Ġj ets", + "ĠDo uble", + "el er", + "Ġinf usion", + "Ġconsum ed", + "ĠI ron", + "ĠProcess es", + "Ġad mits", + "Ġj uris", + "ĠPer iod", + "Ġremod eling", + "alle y", + "Ġenabl ing", + "Ġback ward", + "ĠM id", + "bre vi", + "Ġclass ify", + "Ġcr ypt", + "Ġhel ix", + "ĠJ iang", + "Ġh oney", + "ges tion", + "x c", + "Ġcoinc ides", + "ĠD N", + "Ġap optotic", + "Ġinst all", + "ĠR ever", + "ĠDop pler", + "ic ago", + "er als", + "Ġp ie", + "ĠM ars", + "ĠStaphyl ococcus", + "Ġnot ing", + "Ġgener a", + "ĠI o", + "Ġh ope", + "Ġpres erve", + "MA X", + "yn chron", + "Ġr up", + "Ġcompr ising", + "ĠW ay", + "Ġvi olation", + "Q R", + "Ġreflect ing", + "Ġregular ity", + "ĠSi O", + "ĠJ un", + "Ġcommun ications", + "r ating", + "Ġfam iliar", + "Ġinstant aneous", + "Ġcor tic", + "Ġapparent ly", + "X X", + "Ġexcit ations", + "ĠA ward", + "N um", + "ĠU N", + "Ġqu bit", + "ĠAc tion", + "ĠF ried", + "Ġelim inated", + "Ġasp ir", + "h ler", + "Ġdec oding", + "un ov", + "Ġanalog ue", + "ul monary", + "Ġge ographic", + "Ġs ort", + "ĠCR C", + "Ald rich", + "Ġk Da", + "ĠN D", + "Ġset tle", + "ex ists", + "Ġstat istic", + "ĠB ow", + "ĠC G", + "Ġorgan izations", + "ĠM obile", + "Ġinv ent", + "Ġincorpor ate", + "ĠF ib", + "ord an", + "Ġcolle agues", + "ĠSt ation", + "Ġs en", + "Ġenc aps", + "ĠR H", + "rel im", + "Ġcarbon ate", + "ĠN ether", + "m em", + "EE E", + "Ġafore mentioned", + "Ġp ent", + "ĠSign al", + "Ġsusp ended", + "Col or", + "Ġsp ins", + "Ġpropor tions", + "ult y", + "Ġen rolled", + "ĠT EM", + "ĠRecep tor", + "Ġpre valent", + "l arge", + "v s", + "Ġtrunc ated", + "Ġâĭ ħ", + "l m", + "an il", + "Ġann ih", + "ĠGalax y", + "er as", + "Ġep igenetic", + "Ġto oth", + "Ġcondens ation", + "ĠT ensor", + "Ġin organic", + "ym ers", + "u f", + "an ese", + "are t", + "Ġar ithmetic", + "â Ĩ", + "Ġt rying", + "Ġimplement ing", + "x d", + "Ġill umination", + "el a", + "Ġdefic its", + "Ġsp ots", + "Ġdoes n", + "Ġrest ing", + "tra ined", + "Ġeros ion", + "Ġgran ular", + "Ġsc ar", + "Ġpol len", + "l ie", + "Ġcon vers", + "Ġdisturb ances", + "ĠG od", + "Ġen larg", + "ĠL ate", + "yl ase", + "Ġfac ts", + "ent y", + "ĠStre et", + "sequ ence", + "Ġven ous", + "ĠC heck", + "ag g", + "Ġabsorb ed", + "Ġcom mit", + "set s", + "Ġdest roy", + "Ġbow el", + "Ġfin ished", + "ĠF eed", + "Ġdop ed", + "ĠAl b", + "ĠMit ochond", + "Ġtheore tically", + "R I", + "Ġmet eor", + "ĠM G", + "Ġn ation", + "ĠBas in", + "n ik", + "Ġdep ths", + "ĠMechan ism", + "Ġmotif s", + "ĠH ay", + "Ġmo tivated", + "ĠC opy", + "ĠE astern", + "Ġpers istence", + "Ġra ys", + "F B", + "and em", + "l ayers", + "ey er", + "ĠStre pt", + "Ġregist ration", + "ĠAnt arctic", + "C V", + "ĠP ap", + "ĠSp e", + "Ġsplic ing", + "per formance", + "Ġseman tics", + "Ġloc om", + "oblast oma", + "Ġm oney", + "Ġtrans parent", + "Ġh r", + "ĠInter actions", + "Ġs ap", + "Ġbi ases", + "Ġte eth", + "yn olds", + "omet hyl", + "Ġm V", + "Ġsole ly", + "Ġor ange", + "bl ast", + "ATION S", + "c all", + "opo ietic", + "s ided", + "ĠF ox", + "ĠV ideo", + "Ġinsp ection", + "Ġb uck", + "hes ize", + "p resent", + "ĠAnti b", + "Ġh am", + "al am", + "ĠP G", + "ĠA E", + "Ġj oin", + "Ġmon ocytes", + "es tiv", + "Ġrandom ised", + "Ġtransl ocation", + "Ġincorpor ating", + "Ġprolif er", + "Ġod ds", + "IT H", + "Ġr an", + "Ġinstruc tion", + "Ġresol ve", + "Ġf t", + "ĠHe ad", + "Ġre agent", + "Ġad mitted", + "h uman", + "pos ure", + "ĠCh a", + "ĠF r", + "Ġbroad cast", + "Ġnutri ents", + "n ob", + "Ġnot able", + "ĠI GF", + "ĠC learly", + "Ġquark s", + "Ġe ukary", + "ĠAd d", + "it osan", + "Ġinter active", + "it ting", + "ĠComput ational", + "Ġdiss olution", + "ist ribution", + "pro duct", + "ĠA BC", + "olim its", + "bi ased", + "Ġtrap ped", + "P K", + "ĠH PLC", + "roph ot", + "z es", + "our se", + "ĠH ot", + "Ġrec ipro", + "n olimits", + "ell o", + "Ġassess ments", + "EN TS", + "Ġalter ation", + "t w", + "Ġcha otic", + "ĠL oc", + "Ġcat tle", + "R ay", + "Ġform ally", + "le ave", + "text style", + "Ġvent ral", + "ĠWilli ams", + "ĠPe ople", + "ix ing", + "ĠThe rapy", + "Ġi ii", + "ĠD T", + "Ġb ic", + "Ġsp heres", + "Ġvis c", + "Ġestablish ment", + "Ġdescrip tions", + "ĠA verage", + "Ġto ur", + "ĠInf ection", + "ĠL icense", + "Ġprep are", + "H s", + "f inite", + "ri um", + "ore g", + "ent ry", + "Ġdis ks", + "Ġelong ation", + "c pu", + "ĠChar les", + "FIG URE", + "st on", + "ĠObserv ations", + "A dd", + "ĠT ask", + "at omy", + "ig ration", + "ĠD atabase", + "ĠTex as", + "Ġph yt", + "ll er", + "con jug", + "onal d", + "Ġheav ily", + "Ġsp le", + "Ġass ist", + "ĠC p", + "Ġhapp en", + "u v", + "ĠUn iverse", + "ĠG PS", + "W E", + "X i", + "Ġadminist r", + "str ong", + "Ġmagn itudes", + "Ġsimpl ify", + "Ġele gans", + "es h", + "ĠB ody", + "ĠNether lands", + "à ¯", + "omet ers", + "B o", + "F M", + "ĠN iger", + "pl us", + "inst ance", + "Ġdist ress", + "Or gan", + "C as", + "Ġsym plectic", + "Ġbreak s", + "Ñ Ĥ", + "Ġferm ion", + "em poral", + "Ġs omatic", + "e vent", + "ne ut", + "lamm ation", + "ĠL ibrary", + "Ġmulti plic", + "ĠIn str", + "et hel", + "ur ys", + "Ġhelp ed", + "Ġcol lege", + "Ġcar tilage", + "Ġr pm", + "w estern", + "res is", + "Ġlob e", + "Q L", + "In put", + "Ġemph asis", + "b est", + "Ġtot ally", + "ĠMET HOD", + "ĠF a", + "ĠRed uction", + "ici ous", + "Ġimplant ation", + "pot ential", + "prob lem", + "Ġobtain s", + "ur ons", + "Ġconstruct ing", + "ĠMus ic", + "Ġcan cell", + "Ġnew s", + "ĠCh apter", + "Ġlab elled", + "Ġz ebrafish", + "ĠSol id", + "Ġglut amate", + "ĉĉ ĉĉĉ", + "Ġch apter", + "ĠPres ident", + "M in", + "Ġat rial", + "c p", + "f i", + "f inal", + "Ġto k", + "Ġeffect or", + "Ġsp ine", + "Ġidenti ties", + "isc o", + "ol is", + "ĠC le", + "Ġinvari ants", + "P ath", + "ĠG on", + "fact ory", + "Ġex ogenous", + "ĠMAP K", + "Ġansw ers", + "Ġget ting", + "R s", + "I H", + "ĠDef ine", + "ĠConvolution al", + "Ġgeomet rical", + "ĠIn put", + "Ġ à", + "Ġatten uated", + "Ġradical s", + "ĠAcad emy", + "ã ĥ", + "ich let", + "Ġtor us", + "ĠThe oretical", + "ĠT D", + "Ġan tiv", + "on ge", + "Ġintra venous", + "Ġhyp oth", + "Ġwaste water", + "ĠF lo", + "Ġpor osity", + "Ġp all", + "ac i", + "Ġrecord ings", + "Ġe ating", + "ĠD W", + "un ting", + "ĠD im", + "Ġemit ted", + "ĠJ oint", + "of ib", + "Ġearthqu ake", + "Ġm unic", + "Ġreduc tions", + "Ġcon junction", + "ĠL ocation", + "Ġestabl ishing", + "ĠMat hematical", + "ĠS olution", + "bu ffer", + "ar in", + "ile y", + "ĠCom mission", + "ĠG ABA", + "ĠMuse um", + "Ġver b", + "lec ules", + "inf ection", + "Ġins ect", + "is er", + "Ġprov ision", + "Ġagre ed", + "Ġaff ord", + "the ory", + "know ledge", + "Pro tein", + "Ġk ernels", + "Ġd erm", + "Ġw ish", + "Ġv ox", + "S cale", + "h u", + "Ġcounter parts", + "ĠR oss", + "Ġun p", + "ĠOn line", + "Ġtrans porter", + "G raph", + "Ġ uter", + "Ġmin ute", + "Ġautom orphism", + "il tr", + "ĠResp ons", + "ĠS ym", + "Ġfactor ization", + "s em", + "Ġmedi ates", + "Ġun expected", + "Ġorgan ism", + "Ġattem pted", + "ar an", + "ven ue", + "ethel ess", + "Ġno ticed", + "ĠInvestig ation", + "Ġcare g", + "Ġgroup ed", + "or bit", + "Ġshort est", + "Ġbroad er", + "ĠM IM", + "ris es", + "vel oper", + "ĠH i", + "Ġk Hz", + "Ġbe ads", + "Ġph yto", + "ĠDo es", + "Ġmamm als", + "Ġref ined", + "vol ume", + "S er", + "Ġresis tivity", + "Ġter restrial", + "Ġa xi", + "if luor", + "Ġ £", + "Ġv ice", + "ĠK el", + "V M", + "ĠT own", + "ad m", + "pl ates", + "Ġhol omorphic", + "ĠR ib", + "ĠS B", + "ĠTem poral", + "s rc", + "Ġupd ates", + "Ġsee k", + "en dix", + "ore tic", + "war z", + "Ġro utes", + "Ġstand ing", + "Ġà ģ", + "Ġclass ic", + "Ġp ale", + "lec tions", + "Ġclass ifiers", + "Ġpath ophys", + "Ġm ounted", + "Ġdesign ated", + "Ġv ideos", + "Ġinc oming", + "Ġguarant ees", + "Ġparas ites", + "ĠB acillus", + "f our", + "ĠâĪ ¨", + "Ġcommut ative", + "stack rel", + "ĠBan ach", + "Ġde aling", + "em porary", + "M ulti", + "ot omy", + "re ting", + "Ġn ond", + "ĠCon ference", + "tz mann", + "Ġphosphor us", + "Ġchemical s", + "Ġdis par", + "deg ree", + "Ġarbit rarily", + "rocy te", + "Ġpar abolic", + "Ġdimension less", + "Ġo sm", + "Ġphon on", + "ti ary", + "ĠS ect", + "ophys ical", + "ĠM apping", + "b is", + "ĠCommun ication", + "Ġmim ic", + "Ġregul ators", + "Ġneutroph ils", + "f n", + "ĠImport antly", + "Ġm ere", + "Ġconfir ms", + "ag ram", + "Ġatt end", + "ung al", + "ĠGroup s", + "Ġz o", + "Ġm outh", + "Ġste ep", + "Ġprevent ed", + "Ġdep ressive", + "ac ies", + "ĠL S", + "Ġnit ric", + "Ġvisual ized", + "Ġtranscript ome", + "Ġga it", + "erc ury", + "Ġsh ot", + "ĠV en", + "Ġex chang", + "Ġint ention", + "ĠT ang", + "Ġfav our", + "ve olar", + "Ġper mission", + "Ġhabit ats", + "Ġma ize", + "inc t", + "Ġtele vision", + "ryst als", + "ĠRad i", + "Ġflav on", + "Ġcan n", + "i ota", + "ĠO T", + "p ic", + "R ad", + "ti tial", + "ĠOr th", + "st ellar", + "ĠK ine", + "Ġnavig ation", + "f ast", + "ĠCR ISPR", + "Ġkinem atic", + "Ġsearch ing", + "Ġmic rom", + "Ġinst alled", + "ĠTai wan", + "il a", + "r f", + "ri age", + "pl inary", + "Ġe cho", + "ra v", + "ĠL es", + "cre ate", + "Ġubiqu it", + "Ġprecurs ors", + "K E", + "Ġdiv ide", + "Ġln c", + "ĠCon struction", + "an ic", + "es tim", + "is ters", + "Ġfe et", + "ari ant", + "ĠSch w", + "Ġexcl ude", + "Ġvol can", + "ĠOver view", + "Ġy r", + "ol k", + "Ġ ©", + "ĠF E", + "Ġsper mat", + "Ġcapac itance", + "ĠSch rödinger", + "ĠG E", + "Ġcalibr ated", + "S EM", + "Ġlat tices", + "pl ier", + "Ar g", + "ĠN T", + "ĠEnh anced", + "Ġb rom", + "Ġmulti p", + "Ġcer tified", + "Ġis lands", + "Ġcy st", + "Ġal titude", + "ed ef", + "Ġconst rain", + "Ġsatisf actory", + "Ġspecial ized", + "Ġj unctions", + "Ġcoron avirus", + "ud ge", + "ex c", + "Ġal t", + "ĠB acterial", + "Ġse asons", + "ĠL M", + "Ġhist ogram", + "Ġsol vents", + "a verage", + "Ġcard inal", + "ch rom", + "py thon", + "d ered", + "en ia", + "ĠG H", + "ĠEs s", + "__ __", + "ĠP ak", + "s ized", + "ĠH g", + "Ġel if", + "ĠSchem atic", + "Ġcytoplas m", + "ĠFor t", + "an ia", + "Ġcare ful", + "ĠD ual", + "Ġtransl ated", + "Ġn asal", + "In v", + "Ġda ughter", + "Ġemphas ize", + "mod ules", + "Ġl ives", + "Ġhom otopy", + "Ġb ot", + "Ġdis ordered", + "mat o", + "S econd", + "Ġclaim ed", + "add le", + "Ġinterf acial", + "Ġvisc ous", + "Ġdest ination", + "ĠPl anck", + "Ġabsorb ance", + "Ġvol atile", + "Ġst orm", + "Ġcar boxyl", + "ĠB ank", + "ĠP ack", + "Ġscaff old", + "te br", + "ip ot", + "Ġtum ours", + "ĠG ol", + "Ġelectroph oresis", + "Ġreal ize", + "Ġconstitu ents", + "S ol", + "ĠE very", + "Ġmedi ate", + "Ġcoinc ide", + "Ġexplo it", + "Ġmon oton", + "me asure", + "Ġsup plied", + "rac ellular", + "Ġfer ro", + "Ġpur s", + "eren tially", + "tr ast", + "ĠR B", + "Ġdiss em", + "as y", + "Ġrel ating", + "n ull", + "u ates", + "const ant", + "ĠContinu ous", + "Ġgeomet ries", + "r ust", + "ĠS TR", + "cl uster", + "Ġprogen itor", + "ĠC SF", + "ĠY am", + "ĠRe ynolds", + "ĠM Y", + "ĠK O", + "ĠW alk", + "ari able", + "ind er", + "ĠR ight", + "ĠAl gebra", + "ĠW ik", + "Ġin activation", + "t mp", + "ac cess", + "ĠL ater", + "Ġmicrobi ome", + "Ġgeodes ic", + "Ġre jection", + "us es", + "Ġhard ness", + "Ġhydro dynamic", + "Ġvan ish", + "Ġpoll ut", + "amy cin", + "ĠÏ Ń", + "ip itation", + "Ġaug mented", + "ĠT T", + "av al", + "Ġenc ode", + "Ġtox in", + "et o", + "igh bor", + "add r", + "Ġdam aged", + "o i", + "Ġtrans duction", + "Ġinter acts", + "ÃŃ a", + "ĠC all", + "ri ends", + "ĠMon itoring", + "ĠVari ation", + "Ġôı ¼", + "Ġd ich", + "Ġsp ars", + "al ign", + "Ġan atomical", + "Ġcentrifug ed", + "ur ally", + "ĠZ r", + "ĠCar l", + "Rec all", + "Ġopin ion", + "Ġ era", + "Ġdrain age", + "Ġmicro array", + "st atus", + "um ental", + "Ġcomp rises", + "press ure", + "Ġprac tition", + "m ac", + "Ġcon gr", + "urn al", + "ĠA PI", + "ĠL R", + "Ġtransf ection", + "Ġsl opes", + "ĠC ode", + "Ġph il", + "b ool", + "W s", + "Ġâ Ļ", + "Ġassoci ate", + "otox icity", + "ra de", + "ĠM iller", + "ĠÏ ª", + "Ġshor ten", + "Ġaddition ally", + "ĠEff ective", + "Ġsuper vised", + "Ġel abor", + "ĠC ellular", + "Ġt ell", + "ĠR C", + "s ave", + "im id", + "Ġrating s", + "ĠT aking", + "Ġappro val", + "Ġpenal ty", + "K K", + "con text", + "ak s", + "pec ific", + "Ġtem por", + "Ġup regulation", + "V AL", + "Ġenc odes", + "in in", + "Ġnot es", + "ĠFore st", + "Ġcombinator ial", + "ympt otic", + "Ġsqu amous", + "ĠAs h", + "our n", + "Ġmyel oid", + "el ines", + "B io", + "Ġbre ed", + "ĠR ub", + "uz z", + "Ġsingle t", + "en na", + "Ġcri tically", + "d ig", + "dis ci", + "Ġdrop ped", + "Ġlip oprotein", + "ĠE t", + "Ġno v", + "op hen", + "Ġanc ient", + "B ase", + "Ġsmooth ing", + "iti ves", + "p ine", + "Ġsol ver", + "per m", + "ĠH ome", + "Ġaz im", + "l Vert", + "Ġtransport ation", + "Ġde x", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠ", + "opath ic", + "ex perim", + "âĢ¢ âĢ¢", + "perf usion", + "Ġdo i", + "ĠL act", + "Ġhepat ocellular", + "Ġmism atch", + "Ġaden ocarcinoma", + "ĠP ain", + "Ġsp r", + "Ġconf inement", + "Ġexceed s", + "Ġhas h", + "ĠCompar ing", + "ĠS ensor", + "Ġf iring", + "k es", + "v ir", + "ine a", + "aff ected", + "Ġmod elled", + "Ġe ther", + "Ġsu ffer", + "â̲ â̲", + "о Ð", + "ĠB ir", + "Ä ģ", + "Ġsec reted", + "Ġcat heter", + "Ġy outh", + "ex pl", + "ĠD ar", + "ĠW HO", + "Ġfound ation", + "Ġhyd raulic", + "ĠCa rol", + "SS ION", + "Ġá ¹", + "f eld", + "av or", + "Ġpass es", + "vis iae", + "Ġapplic ability", + "Ġn ested", + "F l", + "ĠC atal", + "Ġmicro environment", + "lab els", + "Ġcrystall ization", + "In fo", + "Ġposition ing", + "Ġtriang les", + "Ġtr yp", + "ĠTrans ition", + "Ġset t", + "Ġneuro t", + "M on", + "Ġdro plets", + "ĠA RT", + "Ġcor ne", + "Ġmulti plicity", + "Ġec centric", + "Ġ iv", + "ĠM atter", + "lear ning", + "elect ro", + "ĠWe yl", + "Ġdec ide", + "ĠW r", + "ĠH ierarch", + "Ġap ical", + "Ġfail ures", + "Ġdiges tion", + "MI C", + "Ġge ographical", + "ĠEle ment", + "ĠTh ough", + "Ġch ron", + "lim ited", + "ĠDI SC", + "ĠArchitect ure", + "Ġvibr ational", + "ĠVari ous", + "Ġdynam ically", + "ak ed", + "Ġconven ience", + "ĠIs ra", + "ĠMD A", + "i tic", + "A u", + "Ġass istance", + "ven tional", + "mid t", + "os por", + "F ollowing", + "Ġinf erior", + "Ġn ickel", + "ra ine", + "p aren", + "Ġtit anium", + "F ield", + "Ġh oc", + "ĠCa uchy", + "ĠMc C", + "ĠSc reen", + "Ġneg lect", + "class es", + "ĠI F", + "Ġstrat ified", + "ens es", + "ĠPl ate", + "oz oic", + "Ġinstit utions", + "ĠTh ose", + "Ġgener ations", + "trans form", + "Ġpar titions", + "Rx iv", + "ent h", + "Ġs tic", + "ol ith", + "ĠF em", + "Ġag ar", + "be am", + "Ġprot ons", + "L U", + "Ġwork load", + "Ġmin erals", + "Ġm t", + "ll a", + "ĠPh armac", + "Ġconver ter", + "ĠMechan ical", + "Ġflav or", + "Ġphosph atase", + "Ġsum s", + "PC s", + "Ġiso forms", + "ig roup", + "py r", + "fe atures", + "Ġper c", + "Ġcomple teness", + "Ġfore sts", + "Ġdiv iding", + "ĠL ipschitz", + "period ic", + "Ġrec ycl", + "ĠN ag", + "Ġtw in", + "epti des", + "Ġco hor", + "Ġsearc hes", + "e ated", + "H g", + "ĠP U", + "ĠT ree", + "all ic", + "P F", + "Ġapp endix", + "ĠC ov", + "Ġcheck ing", + "Ġback bone", + "Ther mo", + "Ġactiv ating", + "ĠV ictor", + "Ġcri tic", + "ĠL em", + "group s", + "RE G", + "ĠO cc", + "SC C", + "ĠX RD", + "ĠVal ues", + "Ġsub type", + "Ġstret ching", + "OR M", + "s ome", + "Ġfl ip", + "Ġphen olic", + "Ġk illed", + "Ġsequ enced", + "usc ular", + "ab in", + "Ġquad r", + "Ġtransl ational", + "Ġsol ids", + "di rect", + "Ġprom otion", + "Ġcohor ts", + "ĠCl imate", + "ĠO ld", + "ĠS ir", + "g ue", + "str ate", + "ĠP oss", + "Ġrece ives", + "ĠVal idation", + "uc tive", + "Ġcere visiae", + "G u", + "is is", + "ce il", + "ĠPear son", + "ĠP relim", + "ĠG ran", + "CS F", + "Ġster ile", + "oflu orescence", + "b ad", + "Ġcol ored", + "comp ass", + "equ ation", + "j an", + "Ġcondition ing", + "Ġvo ice", + "Ġmen ing", + "Ġgrant ed", + "Ġrenormal ization", + "ĠLim it", + "th i", + "Ġa perture", + "Ġdos age", + "di rected", + "ĠBre ast", + "oc ular", + "b earing", + "s al", + "asc ul", + "uper vised", + "Ġmonol ayer", + "Ġmembers hip", + "ĠW ireless", + "sh ow", + "ĠMed ia", + "ĠV L", + "ess el", + "Ġdec oder", + "ĠM F", + "ĠCom position", + "ĠCl ark", + "P oint", + "ĠN ano", + "ĠD eg", + "N L", + "ĠB ox", + "Ġexpl oring", + "m olecular", + "O ther", + "ĠDiab etes", + "he ight", + "Ġkin ases", + "Ġadjust ing", + "Ġsp orts", + "off s", + "ĠI EEE", + "Ġt il", + "ĠInt ra", + "Ġplan ets", + "ĠEpid em", + "Ġto mato", + "Ġscaff olds", + "ĠMet abol", + "ĠGe ometry", + "im etry", + "ĠT en", + "th read", + "o hex", + "Ġpro poses", + "pr im", + "ĠPar ty", + "Ġquar ter", + "ĠSh i", + "Ġab err", + "ĠIn tr", + "Ġdirect or", + "aff e", + "ĠS us", + "ens ors", + "E le", + "Ġpol es", + "Ad ditional", + "Ġby pass", + "caten in", + "Ġunder taken", + "im ation", + "op or", + "Ġpres erving", + "Ġmultiple x", + "ĠRepresent ative", + "s is", + "ĠA G", + "ach y", + "Ġfr uits", + "Ġreconstr uct", + "ens en", + "Ġstrong est", + "Ġsc av", + "ĠChen g", + "ĠCor on", + "ĠObs ervation", + "ĠA ch", + "ĠGe org", + "ĠSV M", + "ĠC hern", + "Ġrevers al", + "v ia", + "im p", + "Ġdeploy ment", + "ĠH ad", + "Ġcircumst ances", + "ob i", + "Ġcur ved", + "Ind uced", + "ĠPos itive", + "im b", + "ĠPar is", + "ĠS tein", + "ic z", + "ĠC ath", + "Ġdraw ing", + "t ory", + "Ġcontin ental", + "Ġquantit atively", + "ac erb", + "Ġnorm s", + "ĠB E", + "S everal", + "do or", + "Ġplate au", + "G al", + "Ġc ivil", + "ĠF ix", + "L AB", + "oc cal", + "Ġsor ted", + "ĠâĢ Ŀ", + "Ġed iting", + "ĠChris tian", + "Ġclar ify", + "Ġwavegu ide", + "b ell", + "Ġded uced", + "od ec", + "utri tion", + "Ġcomp ressive", + "ĠE U", + "ĠReg ression", + "Ġrank ed", + "Ġestim ators", + "Ġab ilities", + "Ġbelief s", + "th ree", + "Ġâĩ Ĵ", + "rolog y", + "Ġaut onomous", + "ĠS z", + "sc hem", + "ĠAL T", + "ĠPattern s", + "Ġex on", + "Ġlif estyle", + "f ill", + "ĠC AR", + "ĠDom ains", + "Ġpa id", + "Ġt ab", + "ĠCo hen", + "air y", + "Ġshe ep", + "Ġse aw", + "ĠK ong", + "g as", + "Ġres erved", + "Ġres il", + "Ġob l", + "car box", + "ĠGover nment", + "up per", + "ract ing", + "Ġg angl", + "ĠR V", + "Ġbron ch", + "Method s", + "ĠL iver", + "Ġgu ess", + "cha romy", + "IC E", + "Ġcongen ital", + "Ġk a", + "Ġsp anning", + "ĠRec omm", + "e a", + "Ġcon vention", + "Ġshe ets", + "Ġtherm o", + "Ġqualit atively", + "Ġox ides", + "Ġcongr u", + "ĠJ er", + "Ġpres ervation", + "ĠB T", + "ĠD MSO", + "Ġcom plication", + "Ġsurviv ors", + "Ġreduc t", + "Ġdes cent", + "Ġsuc rose", + "ĠCour t", + "Ġmetabol ite", + "ĠM ath", + "ĠSec urity", + "ĠNot ably", + "ĠSt em", + "Ġdwar f", + "b c", + "Ġre vis", + "ĠK l", + "ĠG h", + "Ġman ager", + "Ġinvest ment", + "Ġmo tility", + "E m", + "ĠM r", + "as ic", + "ĠB os", + "Ġinsp ired", + "plac ian", + "Ġe ase", + "Ġtors ion", + "ĠDir ichlet", + "Ġsple en", + "ag ation", + "on ate", + "ĠT rial", + "Ġturn over", + "Ġselec tively", + "ĠÍ Ĵ", + "ian o", + "Ġnon trivial", + "i asis", + "Ñ ģ", + "ĠGu o", + "Ġaddress es", + "Ġuniqu eness", + "Ġwith draw", + "ri z", + "Ġcomputation ally", + "Ġperson ality", + "A X", + "went y", + "Ġgover n", + "ber ts", + "Ġrob ots", + "Ġread y", + "Ġdi ets", + "l it", + "M y", + "ĠRe ve", + "ĠL os", + "inf rared", + "Ġint ram", + "l ated", + "pl ankton", + "ĠG rant", + "pi per", + "Ġanten nas", + "Ġb ol", + "f p", + "ĠV it", + "Com par", + "ok en", + "Ġke ys", + "ĠCl ub", + "in ery", + "ĠF oot", + "Ġwarm ing", + "m ond", + "Ġm iles", + "Ġspe aking", + "ĠI v", + "Ġconform ational", + "ĠO k", + "Ġun ified", + "Ġassemb led", + "Ġinver ted", + "Ġf elt", + "correspond ing", + "ĠE CM", + "ĠN SC", + "Ġind oor", + "g ov", + "Ġantagon ist", + "unc hed", + "ĠJ ava", + "ĠComb ined", + "tiv ities", + "Ġaltern ating", + "ã Ĥ", + "ĠDiagn osis", + "Ġdistinc tion", + "le igh", + "ĠT ogether", + "Ġparticip ating", + "Ġgl omer", + "oc he", + "Ġcopy right", + "ĠG TP", + "ĠV ar", + "Ġammon ium", + "Ġfacilit ates", + "Ġperf usion", + "ĠL B", + "f ull", + "Ġre ti", + "ifer ase", + "Ġimmunos up", + "ĠIm plementation", + "Ġpo res", + "ĠB B", + "ĠB ud", + "ĠV O", + "ĠV o", + "Ġphysic ian", + "ĠA UC", + "Ġcertain ly", + "μ m", + "ĠK ol", + "Ġw rap", + "m iddle", + "Ġsil encing", + "Ġfresh water", + "ig an", + "are a", + "A I", + "Ġmicro tub", + "Ġarrang ed", + "struc tive", + "ĠReg ular", + "ĠF ile", + "al ks", + "Ġpl ain", + "Ġinte grable", + "ĠM embrane", + "ist ors", + "Ġaqu atic", + "Ġwork flow", + "ĠG er", + "ul ant", + "Ġactiv ates", + "T erm", + "ĠUp on", + "ĠP ut", + "V ar", + "ĠO D", + "hal f", + "Ġul cer", + "ĠB O", + "ĠG y", + "ren ces", + "Ġpur ity", + "Ġarri ve", + "ĠSign ificant", + "ĠM AC", + "ĠOther wise", + "o ured", + "Ġt an", + "ĠR L", + "ĠQ TL", + "Ġammon ia", + "v mode", + "Ġmagn esium", + "Ġac knowled", + "Ġaltern atives", + "id ents", + "r Vert", + "ĠCom plete", + "ĠB one", + "y er", + "ĠB ab", + "Ġe ut", + "Ġno vo", + "disci plinary", + "Ġsevere ly", + "uk i", + "ĠP N", + "leave vmode", + "cl ip", + "ĠSy nd", + "ĠMIM O", + "ade qu", + "ĠArc tic", + "ly cer", + "RE T", + "ens ed", + "co ated", + "V P", + "Ġl akes", + "Ġch urch", + "Ġhom ologous", + "Ġoxid ase", + "ĠA ud", + "Ġincre ment", + "Ġneut rinos", + "ar bon", + "T YPE", + "iz umab", + "ut able", + "Ġimp lying", + "ĠMo tion", + "Ġâī ĥ", + "Ġp ages", + "Ġplaus ible", + "ĠN L", + "Ġis otop", + "ĠH yd", + "A tt", + "lat tice", + "sh ore", + "Ġsuc ceed", + "Ġsup posed", + "ĠTrans mission", + "D imensional", + "ingu istic", + "Ġcont ours", + "Ġcon comit", + "Ġagre es", + "ĠD ani", + "qu ar", + "Ġsh ield", + "Ġo zone", + "ĠT et", + "lb rack", + "Ġw at", + "Ġcyt ochrome", + "ta iled", + "p ix", + "Ġco ex", + "ĠVi ew", + "od ef", + "ĠW ild", + "ĠL E", + "h op", + "Ġpoint ing", + "unc ture", + "Ġec ology", + "Ġb ab", + "re a", + "eg o", + "Ġviol ence", + "Ġt RNA", + "ĠR N", + "p ent", + "ore l", + "ĠPar allel", + "Ġdri ves", + "nob reak", + "Ġh olog", + "Ġprob able", + "Ġent ering", + "Ġs ink", + "Ġsw elling", + "pro ducing", + "âĨĴ âĪŀ", + "ĠSaf ety", + "Ġanaly se", + "ser ies", + "Ġdri vers", + "K S", + "ĠR MS", + "Ġgene tics", + "ĠF red", + "Ġsub m", + "Ġscienti sts", + "ĠF D", + "ĠSol utions", + "ĠF ab", + "Ġen compass", + "commut ative", + "Ġadi abatic", + "but yl", + "PE G", + "Ġα β", + "ĠSt an", + "Ġclust ered", + "Ġhold ing", + "ĠB eck", + "ĠY an", + "Ġast er", + "Ġecon om", + "Ġign ored", + "u ro", + "yl es", + "ubb les", + "Ġf ate", + "Ġper ceptions", + "Ġl in", + "é n", + "Ġact u", + "Ġar sen", + "Ġb a", + "ep och", + "ĠS tim", + "Ġmedic ations", + "EC s", + "ĠMin istry", + "ĠPubl isher", + "Ġdep ri", + "Ġob struction", + "ĠmRNA s", + "Ġbro ther", + "Ġcros sover", + "ĠT urb", + "t ation", + "Ġt ank", + "ĠM em", + "Ġint estine", + "Ġmicrogl ia", + "ĠMax well", + "Ġjuris dic", + "Ġphen yl", + "hy per", + "um s", + "ĠH IF", + "ĠS hen", + "Ġcheck point", + "ĠBrown ian", + "Ġâĭ Ĩ", + "ĠSt rain", + "ĠExt raction", + "Ġbatter ies", + "ĠP le", + "ĠCon ditions", + "Ġincons istent", + "ĠH ost", + "yp ical", + "Ġc rops", + "al g", + "ĠF I", + "ant a", + "Ġfound ed", + "Ġmark s", + "dist ribution", + "ĠÎ ¹", + "Ġh ors", + "Ġsn ap", + "W M", + "Ġmanifest ations", + "em pl", + "Ġprov ing", + "le ading", + "ĠA CE", + "ĠL ED", + "ch annels", + "Ġl ift", + "F unction", + "in ase", + "super vised", + "ĠU ser", + "Ġphys iology", + "Ġlink ing", + "p ressed", + "Ġ iff", + "ĠJ im", + "Ġglut athione", + "ĠT I", + "Ġan e", + "en osis", + "Ġcollec tions", + "Ġgenetic ally", + "ĠFil ter", + "ĠCh icago", + "ĠServ ices", + "Ġsuper symmetric", + "Ġstri king", + "Ġir rig", + "oc occal", + "Ġfib res", + "Ġecos ystems", + "um ing", + "f ly", + "Ġlung s", + "Ġcovari ates", + "Ġlay out", + "ĠR aj", + "Ġsumm ation", + "abl ed", + "Ġfre ely", + "Ġre vised", + "Ġcut s", + "ĠIntegr ated", + "Ġph armaceutical", + "Ġrespir ation", + "ĠB ill", + "Ġest rogen", + "ra int", + "Ġpercent ages", + "ĠP f", + "ĠG F", + "methyl ene", + "Ġorig ins", + "tr im", + "mat ch", + "it ney", + "ĠY e", + "Ġalloc ated", + "manif old", + "ĠT ris", + "ĠL ys", + "Ġcomp ressed", + "ore r", + "Ġhim self", + "Ġqu in", + "ĠAss embly", + "sing le", + "tem poral", + "Ġs oph", + "Ġepidem iological", + "Ġknock out", + "Ġcomp ares", + "ĠSens itivity", + "Ġgir ls", + "ĠV alley", + "al id", + "ĠSchem e", + "ĠCO MP", + "Ġrefrac tive", + "ĠOff ice", + "Ġlat est", + "Ġp rices", + "car boxyl", + "Ġecon omy", + "Ġbo oks", + "ĠD D", + "Ġne oplas", + "app ings", + "Ġfol ding", + "moment um", + "pot ent", + "Ġpref ix", + "ĠRiemann ian", + "ĠER K", + "ĠPath way", + "Ġlar val", + "ol or", + "Ġat titude", + "geq slant", + "Ġg ates", + "Ġagon ist", + "ĠïĢ ¨", + "ĠM CF", + "ost atic", + "m icro", + "Ġdo ubl", + "ĠPar ameter", + "Ġequival ently", + "Ġs rc", + "M ost", + "ĉ ĠĠĠ", + "Ġrhe umat", + "ĠH um", + "reg ion", + "Ġwind s", + "Ġquad rup", + "cal es", + "ulf ide", + "bal anced", + "U nder", + "gener ated", + "oplas mic", + "Ġweight ing", + "ĠN ov", + "vel oc", + "util s", + "ĠA CT", + "Ġvulner able", + "d c", + "Ġstrom al", + "Ġex acerb", + "H V", + "Ġperfect ly", + "t xt", + "di rection", + "og on", + "Ġb im", + "ĠM arg", + "it ons", + "Ġterm ination", + "ed a", + "Ġpre treatment", + "Ġimportant ly", + "Ġd uc", + "Ġartif acts", + "St ud", + "ot ensin", + "rel and", + "ah n", + "Ġdeploy ed", + "ĠE F", + "ens ing", + "ĠC ard", + "ĠJ ordan", + "ap unov", + "Ġanest hesia", + "Ġatheros clerosis", + "in ner", + "struct ural", + "ĠAs p", + "through put", + "ur ities", + "Ġin set", + "with out", + "Ġac quire", + "Ġcomb ines", + "ĠSh ar", + "M ASK", + "ĠL iter", + "Ġcons cious", + "isc ell", + "cons istent", + "y st", + "Ġfil aments", + "ĠAl ice", + "ĠG round", + "Ġm TOR", + "vers al", + "Ġline ages", + "par ticles", + "a roscopic", + "ĠPro ced", + "Ġorient ations", + "ĠM ouse", + "Ġaccording ly", + "Ġsuppress or", + "Ġdestr uction", + "O V", + "ĠProtein s", + "PE CT", + "Ġc up", + "Ġmon omer", + "plement al", + "Ġneutroph il", + "Ġer up", + "Ġt ac", + "Ġasympt omatic", + "ĠEm bed", + "ĠRad iation", + "ĠG ame", + "Ġneed le", + "Ġre use", + "ĠD utch", + "Ġjuven ile", + "Ġmoment a", + "ĠB ose", + "Ġde veloper", + "Ġresidual s", + "Å ¡", + "Ġc ognition", + "ĠReg ional", + "Y ou", + "ĠCon cent", + "oc in", + "ĠPar tial", + "Ġcomplet es", + "ĠSing h", + "ĠEx c", + "ĠIs olation", + "ĠStruct ures", + "Ġinter mitt", + "Ex ception", + "Ġanaly tically", + "Ġelectric ity", + "â ĭ", + "Ä į", + "Ġprote ome", + "Ġ ic", + "k al", + "inu x", + "ĠB eyond", + "Ġim plied", + "AS H", + "Ġcl one", + "ĠRuss ia", + "ĠH od", + "tebr ates", + "Ġpro xy", + "hold er", + "el ve", + "Ġval ley", + "ut ely", + "Ġj obs", + "rup tion", + "ro ids", + "ĠWh y", + "ep ing", + "ĠY et", + "Ġp yl", + "Ġb ra", + "il ization", + "et ers", + "Ġad ver", + "Ġo ve", + "k ernel", + "s amples", + "ordin ate", + "ĠAssum ing", + "Ġcontamin ated", + "Ġb ipolar", + "Ġl ac", + "Ġl uc", + "Ġcentrifug ation", + "B oth", + "Ġ nd", + "Ġt ib", + "B efore", + "ĠImmun e", + "Ġas h", + "Ġcondition ed", + "ĠR ank", + "N OS", + "Ġnanopar ticle", + "Ġdepend encies", + "Ġhouse holds", + "ag ers", + "Ġspect rophot", + "Ġb ile", + "ĠH ans", + "ĠAcknowledg ements", + "r atio", + "ĠSecond ary", + "Ġdown regulated", + "f ixed", + "O bs", + "ĠH L", + "Ġs ends", + "ting s", + "Ġf i", + "ĠPa per", + "Ġultra violet", + "ĠB all", + "Ġdr astic", + "ail ure", + "o il", + "ex change", + "ĠD an", + "ĠAut o", + "Ġarch ae", + "ĠCol lection", + "Ġantiv iral", + "ĠC hemistry", + "Ġf err", + "cho ice", + "v ac", + "ol ipid", + "Ġd anger", + "ĠL ittle", + "Ġde hyd", + "Ġoccas ion", + "oprop yl", + "ab e", + "Ġinterfer on", + "Ġex port", + "on itrile", + "p d", + "ĠCon text", + "ru z", + "ĠD ys", + "Ġassemb l", + "Ġoil s", + "Im age", + "row ing", + "Ġane urys", + "Ġliqu ids", + "Ġac tively", + "Ġev apor", + "ĠP resent", + "Ġconstit utive", + "ĠS ite", + "Ġsc ript", + "Ġrepe ats", + "ĠS IR", + "ĠFil m", + "ĠSant a", + "ĠRepresent ation", + "ĠA ma", + "ord on", + "ĠMo lecule", + "Ġgover ning", + "ĠSo il", + "V er", + "Ġphot onic", + "tif y", + "ĠLew is", + "at hered", + "Ġcategor ical", + "iscell aneous", + "up date", + "Ġdefic it", + "Ġadj uvant", + "ĠHen ry", + "G roup", + "ist ency", + "ag raph", + "ĠImpro ving", + "E l", + "Ġfl ame", + "rog ate", + "om orph", + "Ġqu bits", + "Ġillustr ation", + "ĠFlor ida", + "ĠD G", + "big cup", + "Ġprov ince", + "egrad ation", + "ĠLand au", + "Ġgr ating", + "Ġins ects", + "Ġd raft", + "ĠH b", + "Ġs s", + "ĠR as", + "Ġmuc osa", + "Ġhydrox yl", + "Ġmod est", + "Ġconfir ming", + "ĠGalax ies", + "G aussian", + "ĠRet rie", + "Ġrest ored", + "m emory", + "Ġreinfor ced", + "r ific", + "Ġass isted", + "Ġaffili ations", + "R C", + "duc er", + "ĠInt ellig", + "ĠA SD", + "mod ium", + "Ġo mitted", + "ok ers", + "Ġgu ided", + "Ġgraph ical", + "ĠQ ual", + "D ue", + "Ġn emat", + "vari able", + "Ġsenes cence", + "Ġpip e", + "Ġsustain able", + "Ġteac her", + "Ġth ing", + "ĠGP U", + "T B", + "Ġre form", + "Ġref lex", + "Ġindic ative", + "ab out", + "Ġop i", + "eff ect", + "Ġdispers ed", + "k h", + "it helial", + "ĠT reg", + "i pl", + "ĠAut omatic", + "Ġn itro", + "com plete", + "Ġbos ons", + "Ġp ac", + "Ġavoid ing", + "is l", + "pl asty", + "respons ive", + "d est", + "ĠB rad", + "ĠDec ision", + "ĠDisc overy", + "Ġchick en", + "m us", + "ĠW ITH", + "Ġt ric", + "Ġqu artz", + "onstr uction", + "ĠField s", + "Ġass im", + "opro t", + "Ġguarant eed", + "f at", + "ic ts", + "Ġch ol", + "id o", + "ĠK L", + "Ġch itosan", + "ĠN d", + "ĠO scill", + "Ġevol ve", + "c u", + "Ġm ast", + "Ġam ph", + "tor ch", + "V is", + "enti ty", + "ĠAd am", + "Ġdev oted", + "Ġeth ical", + "Ġprem ature", + "Ġconsum er", + "Ġrecurs ive", + "Ġglu on", + "Ġmoder ately", + "Ġmod alities", + "Ġcan al", + "for ce", + "ĠCh lor", + "sl ash", + "st en", + "Ġcommerc ially", + "ong s", + "Ġstim ulate", + "atin um", + "ĠR ail", + "Ġconv ective", + "Ġarter ies", + "in v", + "ĠW ol", + "ĠL ung", + "let es", + "raph y", + "ĠH I", + "Ġgraph ite", + "Ġhous ing", + "e ach", + "Ġcal or", + "acet amide", + "roc hemical", + "Ġhand s", + "Ġelucid ate", + "ĠCh and", + "ro ad", + "nov a", + "ĠLine age", + "Ġr am", + "Ġf ight", + "Ġrecommend ation", + "Ġamong st", + "Ġswit ches", + "ber ry", + "Ġthere in", + "al gebras", + "ĠT aken", + "az z", + "Ġf urn", + "Ġam el", + "Ġteac hers", + "ar n", + "Ġavoid ed", + "Ġaver ages", + "am er", + "ĠCon dition", + "Ġdis location", + "ir con", + "Ġadoles cent", + "Ġt ur", + "en v", + "Ġz e", + "D L", + "load ing", + "ic idal", + "c ategory", + "ĠD B", + "Ġmuc osal", + "ĠR G", + "Ġtaxon omic", + "Ġmut agen", + "ĠSt age", + "n ecess", + "ĠP erm", + "Ġoc clusion", + "Ġexplo ited", + "Ġana erobic", + "ul ed", + "Ġwant ed", + "ĠComb ining", + "Ġsub cutaneous", + "Rec omm", + "Ġdiscuss es", + "Ġcounter part", + "ĠF B", + "Ġadsorb ed", + "d on", + "M any", + "ĠSwed en", + "ĠAnd rew", + "enh anced", + "Ġdoc tor", + "ĠKore an", + "ĠS AR", + "Ġm ating", + "at uration", + "ĠL atin", + "Ġsor ting", + "Ġsk ip", + "O s", + "Ġw ife", + "Ġcom mittee", + "l vert", + "ĠA CC", + "ĠCom m", + "Ġsub tle", + "ĠSur vival", + "b ecause", + "Ġfe at", + "ĠPort ug", + "AR Y", + "ĠI SB", + "it ron", + "Ġs ectors", + "Ġadj oint", + "ĠAlex ander", + "Ġimp urity", + "ĠMar ine", + "l act", + "Ġtrap ping", + "Ġgeneral ize", + "fil ter", + "Ġpolar ity", + "Al so", + "Ġstabil ized", + "ĠVir gin", + "Ġst ores", + "P AGE", + "Ġdraw back", + "Ġâİ ª", + "j et", + "Ġsubstit uted", + "L INE", + "Ġoutper forms", + "Ġterm ed", + "Ġweek ly", + "Ġpoly c", + "Ġf used", + "Ġfer romagnetic", + "l r", + "ell ites", + "ĠT urn", + "ĠC ulture", + "pr ise", + "Å Ĥ", + "om position", + "elf are", + "ĠGo ogle", + "o arth", + "Ġ ë", + "Ġm ist", + "ĠMat hematics", + "S ET", + "Ġepoch s", + "Ġcont ras", + "ish ment", + "ĠFirst ly", + "Ġdecl ared", + "a ur", + "ĠP ed", + "Ġreplic ate", + "Ġel igible", + "Ġconc aten", + "Ġc ig", + "Ġtri plet", + "f ound", + "ĠC z", + "Ġaccompl ished", + "Ġgover ned", + "on uclear", + "ĠN Y", + "ĠEth iop", + "Ġin ject", + "Ġe osin", + "ann on", + "ol o", + "ĠM HC", + "Ġpre operative", + "Ġd ates", + "Ġs igma", + "L ong", + "ĠRes on", + "Ġsympt omatic", + "Ġvolunte ers", + "Ġco operation", + "Ġar r", + "Ġclon ed", + "Ġd ent", + "ĠS ob", + "Ġcath ode", + "ct x", + "Ġ encephal", + "Ġp iv", + "vi ve", + "um etric", + "ĠF F", + "Ġunde restim", + "Ġc oded", + "Ġanal ges", + "spect ral", + "Ġattrac ted", + "Ġtw enty", + "Ġin active", + "Ġvic tim", + "Ġhold er", + "ogen es", + "Ġsuff ering", + "re x", + "Ġpro phyl", + "ĠUnivers al", + "Ġden om", + "st olic", + "ans ion", + "SI ZE", + "ĠHC V", + "Ġtechn ological", + "CN N", + "en ching", + "Ġdeb ris", + "ĠBound ary", + "link ing", + "Ġstop ped", + "ĠD ie", + "ĠCos m", + "Ġturn ing", + "Ġgly coprotein", + "ĠK umar", + "Ġp g", + "ĠB Y", + "Ġr ising", + "ĠR OC", + "Des pite", + "ĠBo olean", + "il der", + "Ġexpon ents", + "in ters", + "print f", + "Ġl it", + "t rack", + "Ġf idelity", + "Ġsm oke", + "ot emporal", + "Ġad missible", + "ĠBol tzmann", + "T F", + "ol ite", + "li ament", + "Ġcalc ulus", + "iti zed", + "Ġdiver gent", + "Ġcolon ization", + "Ġconver gent", + "ĠH as", + "Ġconsum ers", + "Ġmy c", + "Ġcon tig", + "Ġepidem iology", + "é s", + "ĠAss oci", + "g iven", + "Ġwh ilst", + "ĠK ur", + "Ġreason ably", + "Ġaer obic", + "se par", + "Ġche cks", + "ĠSem antic", + "Ġserv ing", + "ĠAt mosp", + "Ġoxid ized", + "c oupled", + "Ġbio Rxiv", + "Ġtun ed", + "usp ended", + "Ġindirect ly", + "ĠC AD", + "ĠCurrent ly", + "Ġbehavi ours", + "ĠPP AR", + "r ors", + "ere b", + "Ġwid ths", + "di agonal", + "erv ice", + "Ġo le", + "me ans", + "IM E", + "ĠT racking", + "Ġac knowledge", + "ĠH on", + "ĠTechn iques", + "ĠOx id", + "bl ind", + "Ġdi ast", + "nam ed", + "asi tic", + "Ġprepar ations", + "ĠAr th", + "Ġpres erves", + "Ġf asc", + "Ġwave form", + "ĠC rystal", + "Ġunc om", + "Ġel ast", + "Ġfunction ally", + "H om", + "ĠCo ast", + "Ġop tic", + "ĠAltern atively", + "on yl", + "ĠL ig", + "al dehyde", + "Ġsim ulator", + "Ġdram atic", + "if era", + "Ġexhib iting", + "Ġbehaviour al", + "th ick", + "xt ure", + "Ġexec utive", + "Ġcondens ate", + "ĠOut comes", + "T ext", + "oin ted", + "ĠCopy right", + "Ġd c", + "od d", + "ĠD iversity", + "ch ip", + "ĠBu ilding", + "Ġpuls ed", + "har monic", + "Ġclinic ians", + "d p", + "Ġq PCR", + "mark s", + "Ġapprec i", + "ĠL aser", + "Ġsize of", + "y rene", + "Ġco operative", + "gener ative", + "ĠL ib", + "Ġdispers al", + "Ġevol ving", + "ĠSt atus", + "Ġsuper con", + "ĠM amm", + "Ġinters titial", + "isen berg", + "Ġâ ľ", + "Ġconf ocal", + "Ġmod ulates", + "h our", + "Ġper oxide", + "depend ence", + "Ġperturb ed", + "ill ation", + "Ġpl aque", + "ĠNe umann", + "Ġtrig gers", + "om ain", + "ĠAd ministration", + "ol ia", + "ĠM IC", + "osa ic", + "ĠG B", + "text normal", + "Ġdomin ance", + "ĠEx per", + "C AM", + "ĠAb out", + "ĠG arc", + "Ġsummar izes", + "A pp", + "charomy ces", + "tif icial", + "Ġgly cerol", + "ĠAssum ption", + "Ġt ect", + "ĠF W", + "Ġcot ton", + "gen eral", + "ĠF ern", + "P t", + "Ġwork er", + "Ġan ion", + "gram s", + "re q", + "Ġlo oks", + "Ġimplement ations", + "ĠCol umb", + "ag i", + "ĠAt tention", + "ĠTe am", + "on ing", + "on ential", + "tin y", + "ĠHigh ly", + "text up", + "Ġinver tible", + "oc ortic", + "In f", + "ĠOff icial", + "ĠMod elling", + "Ġincl usions", + "Ġbl ank", + "Ġs ight", + "ĠG amma", + "Ġlept on", + "Ġpneumonia e", + "Ġro tor", + "Ġeth nic", + "Ġre tain", + "v arying", + "ĠE B", + "Ġast rocytes", + "ĠN orm", + "Ġnan om", + "class ical", + "Ġsh adow", + "ĠRef erences", + "ĠF S", + "Ġnon negative", + "b ond", + "ĠC oh", + "Ġnum py", + "Ġo ct", + "sp an", + "rac ts", + "Ġnot ably", + "Ġsoph istic", + "P AR", + "Ġhorm ones", + "Ġtens ors", + "ĠÌ Ħ", + "ĠConst raints", + "Ġâ IJ", + "Ġtrans it", + "Ġrun time", + "aut hor", + "Ġprom pt", + "ĠS G", + "Ġg rate", + "ce mia", + "ĠLy apunov", + "con vex", + "Ġforecast ing", + "p ush", + "Ġjurisdic tional", + "à Ģ", + "Ġbiom edical", + "Ġepile psy", + "fe ature", + "wik i", + "Vi ew", + "Ġless er", + "Ġconjug ated", + "Ġwa iting", + "ĠW ord", + "I Z", + "Ġhydro xy", + "Ġdis p", + "Ġseed ed", + "fit ting", + "Ġstrat ification", + "Ġend point", + "Ġmedi ators", + "duc tive", + "Ġinj ections", + "ĠMicro bi", + "Ġins ert", + "ĠEm b", + "Ġstop ping", + "w elling", + "Ġirradi ated", + "Ġmetall icity", + "vin yl", + "Ġplasm ids", + "R ep", + "ĠDiff erenti", + "ĠSm art", + "ĠIdentif ier", + "ĠB F", + "rop ic", + "Ġkinem atics", + "Ġinoc ulated", + "C K", + "aus es", + "ĠReturn s", + "re ement", + "Ġantic ancer", + "Ġspecific ations", + "Ġadd s", + "Ġst ake", + "Ġwhe el", + "ü ller", + "ĠS on", + "Ġrup ture", + "Ġsol d", + "th an", + "Ġinter medi", + "ĠN ik", + "Ġt uple", + "est abl", + "Ġnor the", + "Ġsuppress es", + "Ġf et", + "Ġwas hing", + "Ġinter play", + "Ġregular ly", + "EX T", + "Ġemploy ees", + "y z", + "rup ted", + "et ts", + "ĠU AV", + "Ġdifferenti able", + "ing e", + "MD A", + "Ġh o", + "Ġt ags", + "Ġcomp atibility", + "Ġà ĥ", + "b us", + "ĠU C", + "Ġtok ens", + "Ġcl ients", + "Ġpres cription", + "ĠÌ Ī", + "ĠRe action", + "veloc ity", + "ĠN LR", + "ĠG ast", + "ĠPlas modium", + "ĠC ut", + "Ġn as", + "gra ined", + "Ġchrom osomal", + "Ġpossess es", + "Ġm ath", + "Ġe lected", + "plac ement", + "Ġcollect ing", + "Ġg els", + "ai re", + "Ġdeform ations", + "ra ise", + "Ġfl ank", + "sulf anyl", + "z ens", + "pri ate", + "Ġchlor ophyll", + "ab i", + "avail able", + "Ø §", + "Ġt ack", + "field s", + "Ġrich ness", + "Ġimpl ants", + "ob enz", + "id ential", + "Ġbill ion", + "ut or", + "ĠISB N", + "Ġins urance", + "N ET", + "Ġin adequ", + "Ġmerg ed", + "ĠR ange", + "Ġavoid ance", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠ", + "ric s", + "Ġexcl usive", + "L V", + "Ġï£ ²", + "Ġcategor ized", + "Ġultrason ic", + "ip e", + "ic ans", + "ĠA PP", + "Ġtra umatic", + "B a", + "ĠAss ay", + "ĠG rid", + "ĠClass ical", + "ĠD ES", + "Ġsoy bean", + "Ġtop ography", + "ĠCont roll", + "Ġemo tions", + "Ġcarbohyd rate", + "Ġcons ol", + "ox yl", + "Ġbifurc ation", + "Ġco il", + "f ind", + "Ġw itness", + "ĠL F", + "th reshold", + "Ġaddress ing", + "Ġsc rew", + "Ġact or", + "ĠW ell", + "Ġï£ °", + "ï ĺ", + "ĠD F", + "ĠCor poration", + "ĠMitochond rial", + "Ġk pc", + "und ers", + "Ġfib rin", + "ax el", + "Ġpol yt", + "Ġshap ed", + "re z", + "ste resis", + "ĠComp rehens", + "Ġï£ ³", + "d h", + "Ġsem ic", + "Ġm ot", + "ĠDav is", + "sk a", + "ĠL H", + "Ġexpans ions", + "ack s", + "Ġoptim izing", + "e ak", + "ĠQ i", + "m ul", + "og raft", + "Ġsu icide", + "cal ar", + "ĠSc ott", + "Ġth inking", + "Ġdirec tional", + "Ġsurfact ant", + "Ġdegrad ed", + "Ġregim en", + "it ative", + "ĠV ersion", + "ĠM aster", + "ĠSim ulations", + "NC BI", + "l ip", + "Ġre agents", + "Ġpost ed", + "os us", + "Ġlay ered", + "ĠSpect rum", + "ĠGraph s", + "bur st", + "Ġl ived", + "Ġelement al", + "Ġï£ »", + "ĠDisc rete", + "Ġexcl uding", + "Ġorigin ating", + "ĠG ames", + "continu ous", + "AT ED", + "Ġpy ram", + "lu ent", + "Ġtw isted", + "ĠN b", + "ox icity", + "Ġsc r", + "Ġf un", + "ĠSeg mentation", + "Ġphen ol", + "Ġmet ers", + "ĠE igen", + "ĠWe ak", + "Ġschem atic", + "r one", + "Ġphil os", + "ti tis", + "ĠI reland", + "Ġg y", + "ĠPT M", + "Ġpack ing", + "il inear", + "z eros", + "Ġubiqu itin", + "ĠPress ure", + "Ġinf iltr", + "EN S", + "val idation", + "Ġpr one", + "Ġout line", + "h s", + "reng th", + "Ġat tain", + "Ġt we", + "Ġt andem", + "C an", + "Ġlat itude", + "uit ary", + "Ġvolt ages", + "ĠGa o", + "Ġpharmac okine", + "Ġcontext ual", + "Ġx yl", + "els on", + "ĠMet abolic", + "od en", + "ti les", + "ff icking", + "Ġdistill ed", + "Ġal ph", + "Ġpie zo", + "g rowth", + "Ġb ore", + "Ġredund ant", + "Ġdemonstr ation", + "Ġi k", + "Ġround s", + "ĠS ri", + "fig uration", + "ĠRay leigh", + "L ine", + "ov ol", + "Ġobstac le", + "c n", + "Ġbio active", + "ĠO A", + "phys ical", + "at idyl", + "AC C", + "h ow", + "Ġresult ant", + "ĠH ubble", + "ĠV or", + "Ġens uring", + "Ġannot ations", + "ac yl", + "stit uted", + "ĠAm b", + "feed ing", + "Ġpresum ably", + "Ġblock ade", + "Ġs oc", + "ĠU rb", + "Ġmulti plied", + "Ġdiff e", + "Ġreflect ance", + "ĠKey words", + "ĠBay es", + "odef iciency", + "ĠB inding", + "in ely", + "ex cept", + "ĠUl tr", + "ĠBrazil ian", + "N umber", + "Ġmass less", + "ĠCons istent", + "Ġcr isis", + "og s", + "Ġres idence", + "Ġim per", + "f ts", + "Ġcapt ures", + "ĠSynd rome", + "Ġdimension ality", + "j un", + "Ġex haus", + "ĠMod ern", + "Ġperc enti", + "Le vel", + "ĠRespons es", + "Ġla unched", + "Ġre pos", + "ĠK am", + "at ility", + "Ġcaro tid", + "ro tic", + "ĠM and", + "U B", + "ĠM ixed", + "Ġindex es", + "Ġcis platin", + "ic an", + "ion ine", + "Ġh ab", + "ĠI ce", + "ĠG T", + "ĠAg g", + "ĠLD L", + "Ġvolcan ic", + "d B", + "ĠElect ric", + "Ġt mp", + "Ġgrid s", + "l iquid", + "p rom", + "ĠG AL", + "Ġp estic", + "Ġhel ium", + "Ġï£ ¹", + "ĠD ong", + "Ġmagn ification", + "k ip", + "ĠG rad", + "ĠWe i", + "ĠPD F", + "ĠGl uc", + "P ol", + "Ġtumor igen", + "yr in", + "Ġshel f", + "ad her", + "enti als", + "s n", + "Ġcultiv ars", + "Ġorbit als", + "ĠP EG", + "ĠAn ne", + "en o", + "Ġatt ended", + "oph ore", + "ish op", + "Ġf riends", + "pos able", + "Ġim pose", + "Ġend emic", + "Ġs ick", + "shif ts", + "ĠOut put", + "L M", + "ĠM iscellaneous", + "Ġthous ands", + "ĠD ataset", + "Ġperturb ative", + "op rec", + "Ġb ene", + "Ġre ef", + "Ġfoss il", + "Ġc ited", + "plic ates", + "Ġrel ates", + "ĠV II", + "Ġanti fer", + "Ġglass es", + "clos ure", + "Ġrub ber", + "Ġb ird", + "Ġsuper symmetry", + "Ġmes on", + "he ll", + "Ġpar ties", + "k ar", + "ĠH ur", + "ĠE A", + "ĠSt ars", + "oth ing", + "h ot", + "ill ar", + "AS P", + "he v", + "ï ĥ", + "a ques", + "Ġcoordin ated", + "ĠIs lands", + "en able", + "Si O", + "Ġexception al", + "C omb", + "ĠL ike", + "Ġbroad ly", + "ĠB ac", + "Ġn il", + "ipar tite", + "r ations", + "Ġre write", + "Ġsal ts", + "d imension", + "ĠVe hic", + "Ġhundred s", + "ĠU r", + "Ġend points", + "ĠMOD EL", + "ĠH BV", + "ĠVir tual", + "ĠCon fl", + "ĠPrac tice", + "ĠAF M", + "Ġadvers arial", + "Ġdi ameters", + "Ġtrans ported", + "RE M", + "ĠB art", + "Ġed ition", + "Ġturb ine", + "Ġmin us", + "otechn ology", + "I g", + "Ġbig ger", + "ab ul", + "Ġperoxid ase", + "wh ite", + "ĠS ed", + "di hydro", + "Ġseg regation", + "Ġreduct ase", + "Ġhor iz", + "Ġinf initely", + "avail ability", + "Ġactiv ator", + "Ġc ensus", + "press ing", + "Ġspir it", + "con ver", + "ĠQuantif ication", + "omer ase", + "Ġrel apse", + "ĠF inal", + "Ġover weight", + "a per", + "Ġformul ae", + "r r", + "Ġfem oral", + "Ġfo am", + "o tics", + "Ġprovid er", + "Ġinstr umental", + "Ġadv ice", + "Ġoccup ation", + "ass embly", + "bi as", + "ĠN OT", + "re stric", + "ĠProt ocol", + "ĠCandid a", + "ĠR hod", + "ard en", + "f under", + "os ens", + "Ġpar ams", + "f ront", + "Ġex erc", + "Ġgal actic", + "r vert", + "Ġim balance", + "Ġk illing", + "ĠGen omic", + "Ġ ip", + "Ġc ave", + "Ġf alc", + "ĠR M", + "Ġcar ries", + "gl obal", + "Ġc ube", + "Ġrig orous", + "Ġcomput es", + "Q P", + "Ġexpos ures", + "c over", + "ological ly", + "O per", + "Ġp ec", + "Ġin homogeneous", + "Ġser vers", + "alian a", + "n b", + "Ġexplain ing", + "Ġshr ink", + "Ġcom orbid", + "eth oxy", + "outhe ast", + "Ġco urses", + "ĠN M", + "ĠSh ape", + "Ġfl ies", + "ĠM ir", + "Ġpublic ly", + "Ġphot ometric", + "vers ible", + "ole v", + "Ġvulner ability", + "Ġc ations", + "Ġsee king", + "U TR", + "Ġdecom posed", + "Ġh us", + "Ġdisapp ear", + "Ġenc ounter", + "Ġtransform ing", + "Ġpolymer ic", + "Ġdiscre tization", + "otox ic", + "ĠI ter", + "ĠM ari", + "Ġun fold", + "ĠAd ult", + "ob acillus", + "met al", + "ber ger", + "rap hene", + "resp ective", + "Ġsur vive", + "ov ich", + "Ġprot ects", + "ĠR og", + "Ġimmun otherapy", + "ĠD SM", + "Ġanalog y", + "ĠP ER", + "ĠPy thon", + "h um", + "ĠAd j", + "ĠLik ewise", + "Ġï£ ®", + "Ġstom ach", + "Ġin it", + "Ġw ires", + "Ġingredi ents", + "Ġper ceptual", + "H and", + "B ack", + "Ġm ood", + "Ġde formed", + "ĠRe ad", + "Ġrh iz", + "ĠOrgan ism", + "ĠInd ones", + "ann ot", + "ict ory", + "Ġt ended", + "ĠS ound", + "ia x", + "S r", + "ĠT ab", + "ĠLa placian", + "ol uminescence", + "back slash", + "i ologic", + "Ġtyp ename", + "ĠY ear", + "D ependent", + "Ġsl ides", + "Ġsac rific", + "Ġconcomit ant", + "ops ies", + "Big g", + "pe ak", + "ĠApp lying", + "Ġcod on", + "ĠSim ultaneous", + "ti se", + "Ġter tiary", + "ĠP oll", + "Ġre vision", + "RA F", + "x mm", + "Ġsu ited", + "ĠRecomm end", + "ĠR y", + "Ġs ake", + "Ġstret ch", + "ĠSam pling", + "Ġtub ular", + "Ġpar k", + "Ġul timate", + "Ġl ands", + "ĠCr iter", + "ass ay", + "m or", + "Ġd ocking", + "Ġgrad ual", + "Ġed itor", + "Ġpol ice", + "aff in", + "ĠDe ath", + "Ġpromot ers", + "ass ic", + "Ġwr iter", + "ĠVol ume", + "is o", + "Ġdis ag", + "tok en", + "Ġster oid", + "N on", + "ĠMet hyl", + "A meric", + "d ue", + "ĠL ess", + "Ġdy st", + "ĠStat ement", + "ĠT wenty", + "Ġaccess ed", + "Ġblot ting", + "ĠCO PD", + "Ġste am", + "Ġdescrip tive", + "ĠV ery", + "Ġcapac ities", + "ĠPers onal", + "ac id", + "ä hler", + "estiv al", + "Con text", + "Ġa str", + "Anal ysis", + "Ġse pt", + "Ġpr inted", + "d ual", + "am an", + "ere r", + "Ġweak ness", + "ì Ŀ", + "ĠTrans lation", + "Ġpropag ating", + "ĠS ections", + "ac a", + "Ġconf usion", + "I K", + "Ġframework s", + "Ġsitu ated", + "Ġst ays", + "n odes", + "c hen", + "art ments", + "Ġfree zing", + "w s", + "net t", + "Ġcontroll ers", + "Ġsil ic", + "LA ST", + "f oot", + "ĠDISC U", + "R H", + "rid ine", + "ĠRe v", + "per g", + "py rim", + "fl ags", + "ĠGu ide", + "Ġspe aker", + "tis ol", + "re ll", + "ĠD EG", + "Ġf u", + "ĠG ut", + "Ġsh ar", + "Ġgro ss", + "Ġcross es", + "wa velength", + "ĠAp plied", + "ï ve", + "ĠH B", + "ĠEd ge", + "Ġiner tial", + "Ġv ocal", + "pro duction", + "pat hetic", + "Ġplan etary", + "Ġs ister", + "Ġminim a", + "Ġlong est", + "Ġfl ash", + "Ġperiod on", + "Ġepid ermal", + "Ġflo ating", + "G ET", + "ĠT ake", + "p df", + "ĠL iquid", + "Ġremark ably", + "S ign", + "Ġshell s", + "oglob ulin", + "qu ilibrium", + "ĠMo ore", + "ĠAd vers", + "ĠMyc obacterium", + "Inv itrogen", + "Ġth aliana", + "B Y", + "ĠB it", + "Ġt s", + "Ġsynchron ous", + "y x", + "Ġpropag ator", + "ĠIncre asing", + "ipar um", + "Ġfree ze", + "ĠSe lective", + "af e", + "Ġstre pt", + "ph antom", + "ĠGener ally", + "Ġaltern ate", + "ĠCon vergence", + "//////// ////////", + "eng ing", + "ĠRandom ized", + "de velop", + "pred ict", + "ress or", + "Ġmat hematics", + "f r", + "ĠComput ation", + "ĠMal ays", + "Ġbreath ing", + "Th rough", + "ĠS IM", + "Ġan ode", + "o ad", + "ĠAT CC", + "Ġconstitu ent", + "ĠMeas uring", + "Ġf MRI", + "Ġan emia", + "lies t", + "Ġhemisp here", + "Ġmaxim a", + "Ġtem porary", + "Ġd z", + "otox in", + "C ount", + "on ed", + "à º", + "Ġcollabor ative", + "Ġk b", + "Ġvers a", + "ĠSwed ish", + "ik a", + "Ġdial ysis", + "Ġper ovsk", + "Ġwill ing", + "ĠG reek", + "Out put", + "Ġsem igroup", + "Ġbott len", + "ĠGib bs", + "d ark", + "Ġrheumat oid", + "ur ring", + "mat ched", + "Ġsophistic ated", + "Ġcust omer", + "tetra hydro", + "X Y", + "b ug", + "Ġmor ning", + "ĠC VD", + "Ġm appings", + "ĠM SCs", + "ĠD H", + "Ġqu atern", + "he alth", + "Ä ±", + "Ġtem p", + "ĠJ ew", + "ĠI l", + "Ġvor tices", + "Ġser ine", + "ĠOx ygen", + "w eg", + "Ġexplan ations", + "P G", + "Ġc iti", + "Ġloc ality", + "== =", + "ĠTh om", + "Ġd airy", + "Bl ock", + "or dial", + "ak ov", + "Ġgli oma", + "Ġtrans action", + "Ġincre mental", + "anc he", + "R et", + "m agnetic", + "pyr rol", + "ĠP ic", + "Ġamel ior", + "oxid ant", + "rov iral", + "or atory", + "Ġs av", + "ĠSt ream", + "Ġsuper f", + "ĠIC U", + "Ġevid enced", + "Ġrepeated ly", + "Ġr ated", + "ĠP it", + "FA ULT", + "Ġh at", + "ĠCont ent", + "Ġiso form", + "V ER", + "Ġn odal", + "Ġschedul ed", + "Ġshould er", + "Ġt ap", + "Ġpor tal", + "Ġtra ps", + "ae v", + "ĠS OD", + "em atic", + "Ġen j", + "Ġretic ulum", + "ĠMin ister", + "ĠS el", + "Ġfall ing", + "ro st", + "N G", + "f d", + "n itro", + "ĠM ove", + "rel ativistic", + "eng es", + "ĠS ST", + "ĠIn v", + "Ġfin ish", + "ĠPol and", + "os econd", + "ĠB AL", + "oarth ritis", + "Ġop tics", + "ĠS ky", + "Ġadv oc", + "Ġhemorrh age", + "Ġmod ulating", + "n is", + "Ġmach inery", + "Ġupd ating", + "Ġcharacter izing", + "ish man", + "Ġtem plates", + "ĠLa place", + "ĠEn s", + "Rec ently", + "or us", + "ar ts", + "diff usion", + "ĠLevel s", + "ag a", + "ĠIn j", + "ĠL ayer", + "Ġrem n", + "Ġelastic ity", + "Ġmere ly", + "Ġf ission", + "eng ue", + "m ake", + "Ġmon op", + "Ġure a", + "ĠSim on", + "mi R", + "ĠSecond ly", + "ur ic", + "ĠVari able", + "il is", + "Ġmultiplic ative", + "ĠNo ise", + "Ġswit ched", + "Ġnic ot", + "Ġeffici encies", + "he ma", + "Ġapp ointed", + "gu ided", + "Ġwin ning", + "ĠMechan ics", + "Ġne o", + "ĠBR CA", + "ud i", + "Ġcontain er", + "sh op", + "Ġsugges tions", + "K B", + "Ġsubstit ute", + "O x", + "V C", + "Ġst one", + "ann a", + "ĠDep ression", + "Ġcont emporary", + "Ġoutl iers", + "qu et", + "ĠZ heng", + "Ġoc cl", + "Ġal veolar", + "exp ressing", + "Ġcom fort", + "Ġign ore", + "Am ong", + "ĠKle in", + "Ġrhyth m", + "Ġimm ers", + "Ġfa ith", + "bl ing", + "Ġaug mentation", + "ĠPre vention", + "Ġhe par", + "Ġnot ations", + "Ġhemat opoietic", + "perf ect", + "Ġsh ares", + "not in", + "Ġpict ures", + "ĠAcknowledg ments", + "Ġt ick", + "Ġun related", + "ĠTo ol", + "Ġm as", + "os ocial", + "g est", + "us hed", + "Ġphosphor ylated", + "Ġcer amic", + "c ool", + "or ylation", + "Ġdef icient", + "Ġrelax ed", + "ĠAnal yses", + "ec raft", + "Ġret ina", + "ĠIn ternal", + "Ġsp ite", + "Ġrecip ients", + "Ġsh ut", + "Ġeth ylene", + "ĠG ulf", + "Ġun affected", + "ĠRes ource", + "ĠN et", + "Ġperp et", + "Ġsl ab", + "re port", + "Ġμm ol", + "Ġid x", + "Ġsk ill", + "ĠInd uction", + "Ġmalign ancy", + "Ġc v", + "Ġdiff ering", + "Ġappropri ately", + "ij ing", + "Ġwar rant", + "r ally", + "Ġal gae", + "we ights", + "c asts", + "Ġoc ular", + "rac ycl", + "Ġdomin ates", + "Ġle uc", + "W here", + "ph on", + "Ġsocio economic", + "itzer land", + "Ġresil ience", + "Ġneighbour hood", + "Ġt one", + "psy ch", + "ĠOrgan ic", + "Ġg ather", + "Ġfalc iparum", + "Ġengine ered", + "ĠAv ail", + "inter ing", + "Ġclim atic", + "ĠEvolution ary", + "N MR", + "Ġre v", + "cent ral", + "ĠS in", + "Ġdecl ined", + "op ausal", + "Ġal arm", + "Right arrow", + "se x", + "Ġenerge tic", + "ï Ĥ", + "Ġdisc s", + "Ġol factory", + "ur ipot", + "spect rum", + "sp ot", + "Ġhem oglobin", + "M ark", + "c ov", + "ar boxyl", + "Ġindic ations", + "Ġsal mon", + "Ġsearc hed", + "Ġend ed", + "rolog ic", + "r floor", + "Ġau tism", + "Ġs elen", + "ĠH ung", + "ĠInf erence", + "Ġmamm ary", + "l floor", + "Ġser oton", + "Ġfund ed", + "ĠVi et", + "Ġri vers", + "ĠRe infor", + "ur g", + "Ġalb icans", + "ĠTherm o", + "ERR OR", + "Ġmut ually", + "Ġir r", + "ĠR at", + "Ġim g", + "Ġlymph ocyte", + "ĠRef s", + "ĠS parse", + "hold ers", + "F ree", + "RE D", + "ĠG auss", + "Ġcirc adian", + "ĠJ in", + "Ġconstit utes", + "Ġw ors", + "Ġfeature d", + "oc ent", + "le te", + "Ġont ology", + "Ġbil ayer", + "ĠCam bridge", + "Ġencryp tion", + "rot ron", + "et ti", + "ĠA er", + "Ġcou ples", + "ra il", + "Ġtw ist", + "Ġrid ge", + "G AN", + "id ers", + "SH IFT", + "Ġdiff us", + "Ġme ant", + "ĠSch warz", + "S b", + "Ġarc s", + "No tice", + "i y", + "Ġem erge", + "kw args", + "E ff", + "E nt", + "ion ization", + "ch oline", + "ust ries", + "ac her", + "s pl", + "pop ulation", + "f ol", + "Ġquestionnai res", + "Ġall ergic", + "w ich", + "ĠV acc", + "Ġat tained", + "ĠAn imals", + "am ics", + "ĠReg arding", + "ĠSem i", + "Ġgl ac", + "ĠEff icacy", + "Ġsynerg istic", + "IS H", + "Ġmaintain s", + "Ġsong s", + "ĠNeg ative", + "am oto", + "ĠMod ified", + "Ġsepar able", + "Ġbin aries", + "Ġaccess ibility", + "I ter", + "d in", + "ĠB inary", + "equ ilibrium", + "Ġc ue", + "m agn", + "Ġed ema", + "ï ¿½", + "Ġposition ed", + "Ġcharg ing", + "Ġun ivariate", + "he p", + "Ġcl ade", + "Ġcy steine", + "rac le", + "Ġresc ue", + "h abit", + "ĠDISCU SSION", + "Ġdepic ts", + "p ole", + "Ġst enosis", + "Ġv eter", + "pr inger", + "ĠP ow", + "Ġcovari ant", + "Ġmod ifying", + "Al gorithm", + "aver aged", + "al o", + "res on", + "Ġcharacter ised", + "Ġn i", + "Ġseem ed", + "ĠR om", + "sh ort", + "N V", + "Ġfer tility", + "ĠM emb", + "Ġl ying", + "Ġinstit ution", + "im ages", + "ĠB orel", + "fs ys", + "c ataly", + "Ġsepar ating", + "b iotic", + "m el", + "pg fsys", + "ĠJack son", + "Ġb ag", + "og rap", + "prop yl", + "ĠProgram ming", + "oc ratic", + "Ġp ion", + "ĠG radient", + "Ġsp he", + "Ġin line", + "Ġdom inate", + "Ġsuff ered", + "ĠDise ases", + "igen ous", + "w ill", + "Ġam in", + "adher in", + "ĠT ro", + "adj usted", + "E W", + "Ġde but", + "ne a", + "ĠD un", + "Ġd ictionary", + "oper atively", + "K A", + "be it", + "Ġperson nel", + "ĠÅ ½", + "re view", + "int o", + "ĠTok yo", + "Ġt rop", + "Ġvent ric", + "ĠMETHOD S", + "Ġim plication", + "ak is", + "ĠC MB", + "Ġtransmit ter", + "o ichi", + "ĠNiger ia", + "ĠK on", + "Ġbe ar", + "ĠK an", + "ĠPl ot", + "ĠS PSS", + "ĠBi ology", + "Ġbary on", + "Ġmicro RNA", + "Ġreproduc ibility", + "Ġlact ate", + "Ġpolyp hen", + "ĠM t", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "end it", + "Ġhydro thermal", + "Ġwe alth", + "Ġhad ron", + "Ġwhere by", + "ell um", + "ĠDiff usion", + "ĠOrig in", + "Ġnonlinear ity", + "Ġinform ative", + "Ġvis ited", + "Ġvirt ually", + "ĠT un", + "Ġres et", + "ĠElect rical", + "ĠG lu", + "ĠS AM", + "ĠI sing", + "ĠSt ra", + "ond er", + "Ġd ies", + "Ġrecipro cal", + "C heck", + "ĠGu idelines", + "hest er", + "Ġproblem atic", + "ĠAt omic", + "Ġconcentr ate", + "st eps", + "j son", + "Recomm ended", + "ĠScreen ing", + "Ġna ive", + "Ġpractition ers", + "Ġfast ing", + "Ġmechan istic", + "op tions", + "P tr", + "IT E", + "W ork", + "âĢ ĺ", + "raf ts", + "Ġun w", + "Ġannih ilation", + "ob jective", + "ĠD ynamical", + "ad ec", + "ĠL ith", + "Ġextract ing", + "Ġcor al", + "ĠSt able", + "Ġbackground s", + "omorphism s", + "ĠâĪ «", + "Ġgre w", + "In st", + "g els", + "Ġin hal", + "d am", + "he im", + "benz yl", + "Ġpel vic", + "Ġdi arr", + "Ġdi ode", + "Ġem pir", + "ĠAl f", + "ĠUn certain", + "ĠH Cl", + "Ġjoint ly", + "Ġde par", + "Ġmerg ing", + "Ġch i", + "ap t", + "Ġpl t", + "Ġid i", + "Ġper for", + "stit uting", + "p age", + "ar é", + "ind ices", + "put ation", + "diff erent", + "b urn", + "Ġsurround ed", + "ĠT L", + "unt ary", + "st rip", + "l an", + "Ġc ow", + "ĠS ab", + "ĠGa As", + "p f", + "Ġes ophageal", + "ĠAl t", + "Ġhospital ization", + "ĠApproxim ation", + "Organ ism", + "ĠF air", + "Ġtrac ing", + "Ġpref erentially", + "Ġlower ing", + "uli ar", + "ĠDer iv", + "Ġphyto plankton", + "omy c", + "T hat", + "ĠIsra el", + "Ġminim ized", + "Ġany thing", + "r ule", + "p ow", + "Ġfam ous", + "ĠAcc uracy", + "Ġphotoc atalytic", + "ĠNon etheless", + "Ġdivis or", + "v b", + "Ġcam eras", + "ĠW ales", + "ĠCont ributions", + "Ġdisplac ements", + "ĠT am", + "Ġvol umetric", + "ession al", + "Ġcompens ate", + "Ġa ce", + "tri angle", + "bu ff", + "Ġnames pace", + "Ġbound ing", + "ynchron ous", + "m d", + "Ġimag ery", + "it ated", + "Ġorigin ated", + "ĠBel g", + "ĠE CG", + "ex isting", + "ĠSt okes", + "sens itivity", + "tid ine", + "ĠW M", + "Ġmonot one", + "Ġproceed s", + "ĠClust ering", + "ĠIo T", + "ern ary", + "al amic", + "ĠCollabor ation", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠ", + "OL D", + "Î ĺ", + "ĠNan opar", + "ĠMul tiv", + "Ġc ystic", + "pi re", + "Ġoper ates", + "Ġmedi ating", + "Ġbene ath", + "ob e", + "g ate", + "Ġo ocytes", + "Ġmarg ins", + "ymmet ries", + "Ġrelig ious", + "ĠN it", + "Ġcut aneous", + "AN S", + "Ġdevelop s", + "as ia", + "ĠRo berts", + "a vier", + "Ġsim plic", + "Ġreveal ing", + "UN D", + "Ġte a", + "Ġl ysis", + "Ġaggreg ated", + "ĠR GB", + "Ġcor ro", + "Ġb ir", + "in ae", + "v d", + "Ġcour t", + "Ġcontrovers ial", + "Ġto w", + "Ġhy steresis", + "en berg", + "Ġent ers", + "p ng", + "ĠF lex", + "Assum e", + "ĠB ad", + "ĠSimilar ities", + "Ex perim", + "AT H", + "Ġ ut", + "ter ms", + "ĠM ol", + "Ġvis ually", + "Ġadop tion", + "Ġprint ing", + "Ġequ iv", + "ĠP ert", + "Ġper col", + "Ġsome one", + "abul ary", + "Ġle ver", + "ĠH aus", + "ic illin", + "it ar", + "Ġto urn", + "Al tern", + "Ex p", + "~~ ~~", + "ĠF o", + "Ġab ol", + "med ian", + "Ġroll ing", + "h m", + "Ġtel escope", + "ĠC av", + "Ġseed lings", + "in hib", + "Ġd in", + "Ġimp urities", + "Ġampl ifier", + "ĠK er", + "Ġdimin ished", + "P B", + "f ib", + "ro ck", + "ĠB in", + "Ġphotos ynthetic", + "ĠCr ypt", + "Ġpre term", + "Ġh its", + "Ġfract al", + "Ġdisc arded", + "Ġend ocrine", + "os hi", + "Ġmod ulo", + "w t", + "Ġqu enching", + "Ġsound s", + "ĠED TA", + "re active", + "Ġres ist", + "ang hai", + "Ġn arr", + "Ġiniti ate", + "ĠS aint", + "X R", + "Ge V", + "ĠInd ependent", + "Ġinj ective", + "up us", + "Ġl inguistic", + "Ġanalog ues", + "Ġdiss ection", + "Ġlas ers", + "di ab", + "ĠTe le", + "Ġc racks", + "Ġb rane", + "V O", + "ĠExt ended", + "Ġt ells", + "Ġremark s", + "ul ting", + "ĠB urn", + "d L", + "ress ible", + "ĠCh ap", + "Ġs q", + "Ġrepro duced", + "ĠB cl", + "Ġsw arm", + "opath ology", + "ch rotron", + "Ġm ine", + "Ġhad ronic", + "ĠLocal ization", + "ĠM otor", + "Ġvisual ize", + "Ġc ats", + "Ġbal ancing", + "ĠSc hed", + "Co A", + "Ġtherm odynamics", + "ĠDiagn ostic", + "Ġreli ef", + "Ġpos itivity", + "Ġh ub", + "ĠInf rared", + "S ur", + "om ed", + "Ġop tically", + "Ġv ascul", + "is ations", + "enc oder", + "Ġcopol ymer", + "Ġrest ore", + "Ġiner tia", + "ubic in", + "Ġeti ology", + "ĠSec ret", + "ĠC W", + "Con st", + "ĠBr it", + "ĠConst ant", + "ĠD IS", + "Ġdisc ipl", + "b ra", + "ĠO ral", + "ĠU L", + "Ġdel ine", + "Ġnucle on", + "Ġemploy ment", + "ĠR D", + "q q", + "ĠCarol ina", + "ĠG ab", + "Ġasser tion", + "CM C", + "r gb", + "F rame", + "ĠJ ust", + "Ġinoc ulation", + "cl uding", + "Ġoscill atory", + "Ġcanc el", + "ĠPo inc", + "por a", + "ĠJ ul", + "ru vate", + "Ġpoli tic", + "ur us", + "ĠAdv ances", + "ĠR oot", + "th ood", + "oxygen ase", + "ms g", + "Ġk V", + "Ġad mit", + "Ġrefrac tory", + "Ġclon ing", + "Ġf atal", + "plant ation", + "ĠG ir", + "Ġt es", + "ĠR ho", + "oh n", + "Ġinnov ation", + "Ġs ending", + "Ġc able", + "Ġnic he", + "Ġres erve", + "Ġat rophy", + "ath an", + "Ġà ij", + "iti zation", + "Ġf an", + "Ġb ubbles", + "ĠTheorem s", + "ĠSw itzerland", + "ĠHe isenberg", + "ĠRed uced", + "R a", + "Z r", + "ĠPoss ible", + "U psilon", + "ĠAg ric", + "el lect", + "nd s", + "math ds", + "at re", + "Ġfor aging", + "Ġup ward", + "id ene", + "Ġgl ands", + "f ed", + "uccess ful", + "ĠW olf", + "Ġuseful ness", + "op orous", + "Ġp unct", + "ard o", + "Ġsy stolic", + "ĠTarget ing", + "Ġill umin", + "Ġpig ment", + "Ġsim ulating", + "Ġpor tions", + "ĠPrinc iples", + "ĠHop f", + "l ipid", + "ĠL U", + "ub ation", + "ĠAr tificial", + "Ġpr ison", + "an ing", + "ĠG N", + "ĠStrateg ies", + "ĠP as", + "T a", + "ĠProb ability", + "or um", + "Ġs keleton", + "Ġcomp artments", + "R ead", + "Ġco ach", + "Ġmod ality", + "ĠReg ister", + "Ġj e", + "Ġhe ights", + "in yl", + "Ġsub spaces", + "ti p", + "Ġá ¸", + "ĠG I", + "Ch ar", + "ro genic", + "ret t", + "eu tics", + "Ġadhes ive", + "ĠP ier", + "Le ft", + "id ental", + "NA c", + "Ġconjug ation", + "or ov", + "id ge", + "im aging", + "ĠT W", + "Ġpres ident", + "ĠO ste", + "ass emb", + "Ġinter net", + "Ġde als", + "ĠG AP", + "Ġform ulate", + "ĠUp date", + "ĠRNA i", + "cl ero", + "Ġpermut ations", + "Ġisotop es", + "op ic", + "ĠQ U", + "rom es", + "ĠPol icy", + "ĠC reek", + "ĠWind ows", + "Ġm erge", + "Ġacc ident", + "Ġsuper position", + "Ġdeb ate", + "Ġdocument ation", + "Ġeigen vectors", + "s or", + "ĠPh oto", + "Ġdepos it", + "Ġgerm ination", + "Ġsub graph", + "ĠRec ords", + "Ġchem ically", + "ĠPredic ting", + "ĠK y", + "se lective", + "yn man", + "dis pers", + "Ġlum bar", + "Ġmus ical", + "in ates", + "Ġinher ited", + "j u", + "Ġtrac er", + "Ġend ing", + "Ġeng aged", + "hand ed", + "Ġproduc er", + "Ġent angled", + "ĠD elta", + "Ġpiec ewise", + "NA ME", + "st op", + "Ġmut ated", + "Ġre cess", + "Ġimmun o", + "c ancer", + "ĠAk t", + "it ers", + "ĠB MP", + "Ġcompan ion", + "Ġcommun icate", + "Ġh ollow", + "Ġp ad", + "Ġs ph", + "om od", + "Ġpar ton", + "Ġspontaneous ly", + "e ared", + "Ġrot ations", + "Ġcosm ology", + "Ġmore over", + "pr inc", + "Ġevery where", + "b rane", + "l ational", + "em e", + "Ġbeh ave", + "um en", + "ost on", + "ov es", + "Ġg ar", + "Ġad renal", + "ĠEstim ating", + "N b", + "Ġech ocardi", + "Ġemphas ized", + "Ġeng ines", + "Ġbrack ets", + "Ġlead ers", + "Ġdistinc tive", + "ĠL ymph", + "Ġex ert", + "Ġinnov ative", + "c oupling", + "ĠSign ific", + "she et", + "ĠC over", + "ĠC CD", + "ĠF all", + "stim ulated", + "Ġsuper oxide", + "Ġpollut ants", + "Ġby tes", + "ĠL ipid", + "Ġtra fficking", + "Ġlead ership", + "inform atics", + "Ġbiod iversity", + "ad or", + "Ġinter conn", + "Ġharmon ics", + "Ġseaw ater", + "ĠIll umina", + "necess ary", + "ĠAnt on", + "Ġprocess ors", + "typ ename", + "D et", + "pro ton", + "Ġsubt raction", + "Ġshif ting", + "Ġcust omers", + "K e", + "ĠO B", + "aton in", + "at ellite", + "ĠS US", + "ĠCol on", + "ĠTim es", + "T V", + "ĠM ink", + "ĠIntegr ation", + "Ġprof ound", + "IT C", + "Ġg ras", + "ĠNA SA", + "ĠAC K", + "radi ol", + "ĠM ale", + "ĠWork ing", + "tic ity", + "ilibri a", + "bound ary", + "ĠR I", + "ĠAl i", + "car di", + "ĠF GF", + "b ranes", + "Ġbe et", + "Ġmiss ed", + "S ource", + "ĠB ot", + "ie ve", + "Ġis other", + "ne ys", + "n l", + "or tion", + "Ġcool ed", + "M V", + "Ġo mit", + "Ġver bal", + "aret te", + "Ġconf erence", + "Ġtransform er", + "Ġre jected", + "Ġprogress ively", + "ĠTur key", + "Ġath letes", + "Ġan atomy", + "E Q", + "Ġdeterior ation", + "ĠDi etary", + "Ġcor n", + "Ġcaps ule", + "Ġvibr ations", + "Ġoccup ational", + "Ġex osomes", + "Ġre written", + "Ġlign in", + "Ġbi opsies", + "ĠAdvers arial", + "Ġm ercury", + "Ġpl atinum", + "Ġirre levant", + "Ġker atin", + "ĠE mission", + "Ġeukary otic", + "Ġinte g", + "Ġkn ot", + "Ġser a", + "Ġcav ities", + "ĠMed i", + "Ind eed", + "E u", + "Ġâ Ł", + "Ġsc enes", + "Ġlap aroscopic", + "Ġsen ior", + "ĠD istance", + "pred ic", + "Ġear liest", + "Ġor g", + "ĠTh or", + "b ury", + "obl asts", + "Ġp umping", + "target ed", + "Ġra p", + "ĠP il", + "Î ł", + "Ġneu rom", + "o ft", + "ost at", + "Ġp adding", + "Ġconflic ts", + "Ġst ems", + "ĠSac charomyces", + "eng ine", + "Ġalk yl", + "Ġt ill", + "ĠQu ad", + "g ood", + "ro x", + "ĠF uzzy", + "Ġrob otic", + "ĠDen ote", + "ĠN IR", + "ĠY uk", + "paren cy", + "Ġle gs", + "yl van", + "Ġtight ly", + "Ġdec or", + "ĠV P", + "ĠM un", + "at oms", + "ĠSil ver", + "Ġneurode generative", + "Ġrespond ed", + "Ġrec ons", + "G EN", + "ĠF ine", + "f c", + "Ġpar agraph", + "Ġint ens", + "Ġalong side", + "Ġb rand", + "mon ium", + "Ġp m", + "Ġsimple x", + "ĠPrelim inary", + "Ġdown regulation", + "Ġx y", + "ĠM ak", + "op ter", + "ush ing", + "ĠB og", + "ox ia", + "================ ================", + "com mon", + "ĠA SS", + "ĠHD L", + "alam us", + "Ġirrig ation", + "N M", + "Ġf ading", + "Ġprev entive", + "Ġreli ably", + "ĠEthiop ia", + "ot hesis", + "iz ability", + "O B", + "Ġtrig lycer", + "Ġgest ational", + "Ġb esides", + "ĠI ii", + "ĠZ one", + "Ġcop ing", + "Ġminor ity", + "Ġdepri vation", + "Ġhex agonal", + "chlor ophenyl", + "ĠóµĦ ¨", + "Ġg yr", + "Ġview ing", + "New ton", + "ĠHierarch ical", + "o L", + "ec es", + "Ġconcl udes", + "Ġfung us", + "Ġpyl ori", + "Ġobstac les", + "th iazol", + "conjug ated", + "r ass", + "Ġl ose", + "Ġfor th", + "ĠAll en", + "opl ast", + "ĠProt ection", + "Ġintermitt ent", + "Ġluc iferase", + "ĠM K", + "Ġga ug", + "ĠF an", + "Ġmod al", + "ĠEx ercise", + "sc attering", + "ĠSh im", + "Ġexc retion", + "Ġat ypical", + "Ġmalign ancies", + "angl ades", + "ĠSpect roscopy", + "Ġaden osine", + "l if", + "Ġnucle ic", + "Ġincl ination", + "ĠC ass", + "Ġeth n", + "Ġex empl", + "ĠD y", + "Ġl ambda", + "Ġj ac", + "ĠP RE", + "Ġrail way", + "Ġf le", + "Ġreflec tions", + "Ġnano structures", + "ti sts", + "pr ints", + "ĠC AT", + "Ġs ib", + "Ġchlor o", + "Ġrecip ient", + "op tic", + "Ġcoun ty", + "Ġnucle otides", + "Ġz ircon", + "Ġhors es", + "ĠM ental", + "in line", + "ĠNor way", + "The y", + "Ġmusc ular", + "ace tic", + "ĠJ u", + "Ġcommun ic", + "f iles", + "f illed", + "H B", + "Ġreg ulations", + "Ġaccum ulate", + "ĠPan el", + "C y", + "ö l", + "ĠPak istan", + "Ġthor acic", + "ĠM PI", + "por tion", + "Ġinduc tive", + "ĠCong ress", + "Ġfibrobl ast", + "cl ust", + "Ġcent res", + "ad el", + "Ġsubstit utions", + "Ġtrunc ation", + "r ification", + "ok a", + "F low", + "ĠRed uc", + "polar ized", + "ib ular", + "P e", + "ĠA ML", + "ĠAg ency", + "Ġt ilt", + "ubl ished", + "Ġdep olar", + "Ġbel t", + "Ġoptim izer", + "EL L", + "ĠHand book", + "ĠVirgin ia", + "s ense", + "ĠD ur", + "Ġpiezo electric", + "Ġaward ed", + "ail ing", + "P os", + "p ref", + "ĠSum mer", + "ed o", + "ĠI de", + "ĠB SA", + "Ġmon omers", + "Ġco agulation", + "Ġg am", + "Ġhom es", + "Ġhead s", + "adm ium", + "ĠO C", + "Ġoccup ancy", + "ĠEm pirical", + "ĠI i", + "Ġch ir", + "Ġdegener acy", + "Ġflow ers", + "Ġsuperconduc tivity", + "Ġin versely", + "op tical", + "w ere", + "ĠAs ymptotic", + "S ec", + "tit le", + "pos al", + "ĠPro gn", + "Ġpos es", + "ĠB orn", + "Ġcontinu ation", + "Ġcul tivated", + "enti ment", + "Ġman aging", + "Ġthromb osis", + "a ug", + "CN T", + "ure a", + "Ġsp ind", + "ĠWhere as", + "ĠPers on", + "Ġb ipartite", + "Ġres cal", + "Ġmark ets", + "ph an", + "per ties", + "Ġferm ionic", + "Ġmunic ip", + "Ġachie vable", + "t ab", + "Å į", + "ĠRel ation", + "T otal", + "x ia", + "Ġintellig ent", + "ĠU T", + "ĠD al", + "Ġmedic inal", + "Ġinadequ ate", + "i ently", + "ers en", + "Ġpre condition", + "Ġmethod ological", + "Ġcan opy", + "Ġbacter ium", + "col umn", + "C al", + "ĠDi ego", + "ĠS ak", + "ĠComprehens ive", + "Ġanti tumor", + "Ġflow er", + "ĠK han", + "Ġmet adata", + "Ġphot ore", + "ogen icity", + "Ġle ague", + "ol ating", + "Ġprom ise", + "ĠP ere", + "Ġper mits", + "Ġthread s", + "ĠD Cs", + "ĠCh am", + "raz ol", + "B ank", + "Ġwithdraw al", + "Ġapp end", + "ot helial", + "ĠMeas ures", + "Ġguid eline", + "Ġmitig ate", + "adj oint", + "Ġbrack et", + "P ad", + "M ills", + "Bu ffer", + "Ġc ass", + "h oc", + "manif olds", + "her ry", + "Ġfacilit ated", + "E vent", + "Ġ È", + "ĠC ruz", + "ĠB rand", + "Ġnecess ity", + "burg h", + "Ġme V", + "Ġc AMP", + "O ff", + "se lected", + "Ġeng age", + "Ġredund ancy", + "Ġnanocom posites", + "s olution", + "ons et", + "ĠEx posure", + "Ġrepe titive", + "à ł", + "ĠR AD", + "ĠTur k", + "Ġcorne al", + "Ġexplo iting", + "Ġob structive", + "gram ming", + "ĠM ED", + "Ġmat hem", + "Ġconduc tive", + "Ġphotos ynthesis", + "E instein", + "ĠP eng", + "M W", + "ĠSch midt", + "Ġrepe tition", + "identif ied", + "Ġinj ured", + "Ġdef ective", + "ĠP el", + "Ġcul tivation", + "Ġfirst ly", + "Ġanalyz er", + "Ġstain less", + "Ġjo ining", + "ĠOxid ative", + "Ġph age", + "Ġexp endit", + "Ġhom ogeneity", + "ip le", + "ov ic", + "Ġcross ed", + "ĠTr ust", + "ĠF ract", + "rophys iological", + "Ġbas ically", + "Ġco ales", + "Ġgra vit", + "ful ness", + "c ano", + "Ġcol itis", + "Ġcha os", + "carb ons", + "O nce", + "ĠTow ard", + "or f", + "top ic", + "ĠPl ay", + "ĠCor respond", + "ĠS leep", + "ticular ly", + "c umin", + "v dots", + "ĠR he", + "Ġult raf", + "Ġtimes cale", + "ĠDet ails", + "ang les", + "Ġsur rogate", + "ĠFlu id", + "c z", + "Ġinitial ization", + "ĠTel escope", + "r ases", + "ĠSt ock", + "ĠC ond", + "Ġimmun odeficiency", + "B el", + "os er", + "sh own", + "Ġk cal", + "Equ ation", + "prot ective", + "Ġcall ing", + "Ġanticip ated", + "Ġambig uity", + "ĠN ode", + "ĠG D", + "Ġin let", + "Ġbre ad", + "Ġexceed ed", + "Ġimmun ization", + "Ġpro hib", + "y tic", + "Ġbo ys", + "t u", + "Ġto wer", + "L ike", + "ĠAn omal", + "â Į", + "ĠSh ow", + "Ġim aged", + "Ġequ il", + "Ġrend ering", + "ob ility", + "Ġge ological", + "f riend", + "ö r", + "carbox amide", + "ovol ta", + "C urrent", + "ĠS ti", + "ĠM U", + "Ġval ued", + "Ġpo ison", + "Ġprac tically", + "Ġrequ ested", + "C ode", + "Ġbr ings", + "Ġdim ethyl", + "h yp", + "ce mic", + "V ol", + "qu anti", + "Ġex ha", + "Ġrespons ibility", + "ĠCont rolled", + "Ġf ur", + "Ġres emb", + "ĠK aw", + "Ġev oked", + "Ġuter ine", + "Ð »", + "Ġan onymous", + "ĠChall enges", + "Ġanch or", + "ĠAb d", + "D er", + "Ġtherm ally", + "ĠC AP", + "obl ot", + "ĠF ire", + "Ġdiagnos tics", + "Ġexec ute", + "al is", + "ron i", + "ĠHar ris", + "ĠGon z", + "Ġv ig", + "ĠProf essor", + "Ġinvent ory", + "int ensity", + "ĠNSC LC", + "Ġinterf ere", + "ysacchar ides", + "Ġreg ener", + "ĠAut hors", + "Ġtransl ate", + "ĠT ests", + "ĠL ove", + "ĠInd uced", + "enn is", + "ĠG EN", + "Ġolig onucle", + "Ġmet er", + "s atisf", + "hes ion", + "Ġtrans porters", + "B IT", + "ĠCon c", + "Ġgl auc", + "sc ores", + "Ġmerg er", + "G H", + "Ġst oichi", + "ĠX ia", + "eff ects", + "ĠExpl oring", + "dor ff", + "Ġcardinal ity", + "ĠK az", + "f alse", + "ĠH SP", + "Ġuns upervised", + "ingu ish", + "isc her", + "Ġrel ativity", + "on ormal", + "oot hed", + "ed ges", + "ĠI MP", + "Ġimp ulse", + "ĠColumb ia", + "Ġpartic ulate", + "ĠSupport ing", + "ĠSD SS", + "vol tage", + "ĠAma zon", + "Ġep oxy", + "C all", + "Big l", + "Ġme ets", + "Ġequ atorial", + "Ġneu ros", + "Ġper itoneal", + "des c", + "input s", + "Ġex terior", + "ac o", + "Ġme al", + "ĠDani el", + "Ġintu itive", + "Ġcoun s", + "dep ress", + "in is", + "ph ot", + "ĠA min", + "Ġreservoir s", + "ĠW hole", + "Ġca ud", + "Ġbos onic", + "Ġread ers", + "Ġcr im", + "Ġpathophys iology", + "arg o", + "the se", + "inc ome", + "Ġiss ued", + "Ġhepat ocytes", + "ĠC i", + "der iv", + "up ta", + "t uple", + "ĠCh an", + "Ġauthentic ation", + "yg d", + "Ġinf in", + "Ġaccel erate", + "ep tive", + "Ġhydro gel", + "ask a", + "ON E", + "Ġfed eral", + "ograph ics", + "Ġmu on", + "Ġsl ide", + "Ġellip tical", + "at ite", + "Ġc c", + "ET s", + "Ġclar ity", + "ocy cl", + "is al", + "rec tions", + "ay an", + "row eak", + "ĠS OC", + "od erm", + "t un", + "as m", + "ĠH ir", + "lik elihood", + "Ġad ul", + "t l", + "H igh", + "Ġal ters", + "plit ude", + "ĠRe lease", + "Ġharm ful", + "l ate", + "ound s", + "ĠFed eral", + "ĠEcon omic", + "Ġra bb", + "Ġaccommod ate", + "em ission", + "ĠB ah", + "c ox", + "ĠMod ulation", + "Ġconstruc tions", + "ign er", + "ĠUrb an", + "Ġw ake", + "Ġadvers ary", + "wik ipedia", + "Ġsu ite", + "w ick", + "exp ressed", + "ro d", + "K D", + "Ġcomput ers", + "ĠB anglades", + "Ġpers ist", + "Ġburn ing", + "Ġadministr ative", + "Ġpl ug", + "ĠRepresent ations", + "ĠSc attering", + "Ġendomet rial", + "Ġdescript ors", + "Ġcom mission", + "B ar", + "igh th", + "ĠMar sh", + "sam pling", + "Ġh ull", + "ic in", + "Pro b", + "Ġnur se", + "Ġsh am", + "ĠK err", + "Ġpref rontal", + "Ġfix ing", + "O K", + "Ġb old", + "Ġcor ollary", + "cf g", + "ĠOx ford", + "Ġbor on", + "R B", + "ĠC ab", + "Big r", + "ĠPred ict", + "Ġpec uliar", + "h idden", + "is a", + "id en", + "appro priate", + "or h", + "ellect ual", + "Ġseiz ures", + "ass er", + "til is", + "hand le", + "iax ial", + "s ym", + "Ġcarcin omas", + "se a", + "sp ired", + "Ġab rupt", + "t ests", + "Ġw elfare", + "ĠO il", + "ĠLo ad", + "FL AG", + "ut hal", + "Ġfac ing", + "Americ an", + "L AS", + "Ġir respective", + "Ġrout inely", + "w al", + "Ġsettle ment", + "ĠA qu", + "Ġelectron ics", + "Ġhand led", + "Ġbiological ly", + "sm ooth", + "ĠBel ongs", + "ti b", + "Ġtra v", + "p ressive", + "ourn als", + "Ð º", + "fil ename", + "Ġhel ical", + "Ġbacter i", + "Ġsat ellites", + "B H", + "ent ed", + "ĠFoot ball", + "Ġï£ ±", + "ĠH V", + "Ġtri p", + "ĠCK D", + "ran i", + "Ġclean ing", + "lim it", + "ĠT CP", + "Ġsc in", + "Ġsl udge", + "Ġsymbol ic", + "ĠSequ encing", + "ad al", + "ĠPhil ipp", + "IC S", + "Ġvag inal", + "Ġcommit ment", + "ĠA wards", + "tr ig", + "Ġgu itar", + "acet ate", + "Ġb et", + "Cl N", + "Ġagric ulture", + "Ġch ief", + "Ġem bol", + "bu ild", + "Ġtex ts", + "ĠCo oper", + "l ived", + "ĠDel ay", + "ĠM ode", + "y al", + "B N", + "Ġindex ed", + "ex pr", + "ER N", + "v ens", + "Ġpo inter", + "c v", + "ac on", + "t ance", + "ĠâĪ Ŀ", + "Ġlow ered", + "Ġmit otic", + "rh osis", + "ĠP age", + "ü r", + "im m", + "ĠThe rapeutic", + "Ġoste opor", + "Ġbil inear", + "ĠCath olic", + "ĠAltern ative", + "oxid ation", + "Ġiniti o", + "benz o", + "ĠA di", + "per son", + "per itoneal", + "ĉĉ Ġ", + "Ġatt raction", + "Ġdiarr hea", + "Ġre n", + "ĠI SO", + "im ir", + "Ġtermin ology", + "uk ey", + "Ġreson ator", + "Ġsubstit uting", + "Ġhar bor", + "pro vid", + "dec ay", + "ĠHD AC", + "ĠAnaly tical", + "Ġpost natal", + "Ġund es", + "Spec ific", + "d ichlor", + "AR I", + "t ot", + "Ġdig it", + "op ing", + "ĠZ inc", + "Ġle thal", + "Wh itney", + "F i", + "qu antum", + "ĠF ailure", + "Ġsol ves", + "ĠSp aces", + "ear man", + "Ġgo at", + "Ġsyn apses", + "Ġres uspended", + "Ġresid ent", + "Ġcomp ac", + "Ġcor tisol", + "Ġphot ometry", + "W P", + "se lect", + "Ġc ele", + "or ubicin", + "ĠMul tic", + "ĠJe an", + "Ġcl ip", + "Ġs a", + "oc o", + "ge ometric", + "Ġhel ic", + "Ġempir ically", + "Ġmicro fluid", + "id is", + "Ġaut ocor", + "W F", + "ĠRes pir", + "radi ation", + "Ġthem es", + "Ġt aste", + "ric ing", + "Ġexam inations", + "ĠSens ing", + "s ame", + "DE FAULT", + "Ġphyl ogeny", + "h ig", + "Ġplate lets", + "ĠHist or", + "ab a", + "Ġresid ential", + "Ġun bounded", + "and ing", + "hed ron", + "r ys", + "ĠC CR", + "Ġcon ce", + "Ġpar asitic", + "c b", + "ĠFe ynman", + "ĠKe pler", + "à ´", + "ĠG il", + "ĠMAT LAB", + "b en", + "sc ope", + "Ġdiscrim in", + "Ġjus tified", + "plas ma", + "ĠCho i", + "Ġro of", + "PC A", + "ĠT CR", + "Ġvox el", + "ĠW ard", + "Ġunc or", + "S tok", + "Ġsp ur", + "TR A", + "Ġdiagnos es", + "rophys ical", + "ategor ies", + "Ġove restim", + "Ġstream ing", + "ĠRec overy", + "Ġevery thing", + "LO W", + "G ener", + "Ġun biased", + "Ġvari ances", + "comp act", + "es pan", + "in j", + "Ġend oscopic", + "Ġide als", + "ĠR ice", + "ĠKa plan", + "Ġf ecal", + "fer red", + "ĠCy cle", + "Ġimplant ed", + "Ġw ine", + "P ET", + "Ġassign ments", + "Ġabs ol", + "X T", + "Ġswim ming", + "M N", + "ĠGe ometric", + "ĠHealth care", + "Ġpow ders", + "ĠG el", + "Ġdown ward", + "Ġexceed ing", + "ĠHE K", + "ly m", + "ĠB V", + "Ġvis co", + "i et", + "ĠCO X", + "ploy ment", + "ins ki", + "Ġout door", + "ĠLiter ature", + "ant ed", + "meth oxyphenyl", + "ĠMed ium", + "Ġd ia", + "ail and", + "vari ance", + "ĠEval uating", + "ox acin", + "Ġanti f", + "Ġpul p", + "Ġcorro bor", + "ĠO t", + "Ġrabb its", + "R u", + "Ġfunction als", + "â ĩ", + "Ġimm ersion", + "Ġcre atin", + "Ġq RT", + "Ġcondens ed", + "n r", + "ĠV A", + "h ad", + "Ġk ing", + "ob le", + "Ġexist ed", + "Ġthe sis", + "ubb ard", + "ap optotic", + "Ġflow ering", + "ĠAdap tation", + "ĠKal man", + "tr l", + "Ġm ent", + "ut ation", + "ĠCon v", + "Ġhist ories", + "Ġen anti", + "n ell", + "on ian", + "ĠF abric", + "Ġx x", + "Ġf ell", + "Ġcytos olic", + "Ġm ud", + "Ġsusp ensions", + "ĠMicro bial", + "meas ured", + "Ġdown load", + "Ġinv alid", + "Ġcapt uring", + "ĠH H", + "ĠG ray", + "ĠA Z", + "ĠN ash", + "vi ation", + "nai re", + "or tium", + "yn ch", + "amin ergic", + "Ġwa it", + "S chem", + "t race", + "ĠV ill", + "Ġpo ols", + "Ġhypox ic", + "x p", + "Ġsh aded", + "OR Y", + "t urn", + "inter acting", + "Ġdestroy ed", + "ak h", + "ĠCp G", + "dot ted", + "ĠTrans cript", + "plan ar", + "Ġpre clinical", + "ĠRe pro", + "ĠSur gery", + "Stok es", + "if def", + "Ġdiscrim inate", + "ĠG ross", + "Ġfl ags", + "i ety", + "umm y", + "Ġtransf ers", + "S G", + "ĠSc i", + "Ġhead er", + "ĠFund ing", + "Ġdet rim", + "Ġinst abilities", + "ĠPhyl ogenetic", + "ym ethyl", + "ĠAssess ing", + "RO C", + "els en", + "Equ al", + "Ġc as", + "Ġver tically", + "Ġvis ibility", + "ĠFT IR", + "sc rib", + "Ġbur sts", + "ĠDo ug", + "ĠFranc isco", + "ĠM SC", + "Ġpred is", + "establ ished", + "Ġfac ed", + "ĠW I", + "S l", + "Ġchar ts", + "orth y", + "izon tal", + "ial ysis", + "Ġtun able", + "Ġexplos ion", + "S w", + "T NF", + "Ġdiscontinu ous", + "ect ure", + "ci ences", + "mathbb m", + "lo ok", + "Ġt achy", + "Ġb row", + "obs erved", + "Ġana est", + "S al", + "q PCR", + "Ġse es", + "Ġspac ecraft", + "Ġsal es", + "ĠT rac", + "T em", + "iv est", + "ĠF c", + "ĠNew s", + "Ġharvest ing", + "ĠE G", + "p ad", + "Ġnanow ires", + "Ġpot ato", + "pl iers", + "on in", + "Ġw orm", + "s ue", + "ti e", + "Ġm asks", + "Ġth row", + "! !", + "be havi", + "Ġp ine", + "og y", + "TE ST", + "on to", + "Ġcreatin ine", + "ĠB oston", + "Ġch air", + "pl oys", + "ov en", + "Ġent rance", + "Ġc och", + "Ġdy es", + "T or", + "ĠPD E", + "unders et", + "atas ets", + "Ġt ernary", + "cho ose", + "f ive", + "chlor ide", + "on ium", + "Pro perty", + "Ġt u", + "Ġadequ ately", + "romy cin", + "Ġco oper", + "ï Ľľ", + "Ġpap ill", + "ĠStrept ococcus", + "ĠC Y", + "Ġgroup ing", + "Ġbi oc", + "ĠCardi ac", + "ĠBo ok", + "re ference", + "Ġconfirm ation", + "iver y", + "Ġwar ning", + "pret ation", + "Ġl ove", + "Ġoscill ators", + "s ed", + "ĠT X", + "il ent", + "ĠV as", + "Ġcl amp", + "Ġa head", + "ac s", + "Ġdeple ted", + "Ġmethod ologies", + "m ay", + "Ġc affe", + "Ġsequ entially", + "os acchar", + "Ġcompr ise", + "Ġc hel", + "Ġin acc", + "Ġtend on", + "S equ", + "ough t", + "ser ver", + "ĠPert urb", + "Ġter rain", + "cur ve", + "ĠAr gent", + "T ABLE", + "Ġimplicit ly", + "Ġenj oy", + "ĠS itter", + "Ġmic ron", + "ĠEv ans", + "ns ylvan", + "Ġlook ed", + "sp e", + "vol ving", + "ĠL STM", + "agne tism", + "ĠNot ch", + "ĠT al", + "ĠDEG s", + "lem an", + "Ġbo olean", + "Ġob ey", + "organ ization", + "se en", + "ĠEn c", + "sch ild", + "ĠOnt ario", + "Ele ment", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠ", + "m ouse", + "Ġpoly ethylene", + "Ġace tic", + "s ections", + "ur onal", + "ĠD ick", + "Ġk ill", + "Ġbroad ening", + "Ġfluor ide", + "Ġs aved", + "Ġde em", + "St ream", + "ac ed", + "ĠJ eff", + "Q A", + "Ġscal able", + "ĠF if", + "ĠMin i", + "Ġsuper gravity", + "Ġcoll oidal", + "L Y", + "O A", + "Ġper ic", + "Ġshort ly", + "Ġv ap", + "Ġspl its", + "m ove", + "Ġstim ulating", + "ĠBe ijing", + "Ġp yr", + "Ï Ń", + "Ġlex ical", + "âĢ ł", + "Å Ħ", + "itor ies", + "oler ance", + "Ġins ulator", + "ĠLe on", + "Ġpropag ate", + "ĠEle ments", + "y en", + "Mod ule", + "ĠWhe ther", + "Ġa ph", + "ĠLa ure", + "ĠMut ations", + "Ġhypert rophy", + "Ġocean ic", + "ograph ically", + "pati ents", + "ĠAngel es", + "Ġp he", + "Ġsqu ee", + "Ġcaro ten", + "f ine", + "Ġsk etch", + "Ġans atz", + "tit ution", + "ĠF us", + "ĠS ug", + "obacter ial", + "Ħ ĥ", + "Rel ated", + "Ġar tist", + "Ġac ryl", + "l ined", + "raf ted", + "ĠQ oS", + "ĠF eng", + "se arch", + "Ġnanot ube", + "ĠV M", + "ah l", + "Ġstr ide", + "ĠT ag", + "ĠL ar", + "Ġdes orption", + "d type", + "Ġb ug", + "Ġcareg ivers", + "ĠH un", + "ĠPrac tical", + "Ġob lig", + "re r", + "ĠK ang", + "ĠPro ducts", + "omet h", + "ĠHe La", + "Ġlabor atories", + "n atural", + "Ġf ul", + "Ġm old", + "ab ine", + "ĠS pring", + "Ġco bal", + "Ġhighlight ing", + "ĠPre f", + "cycl ic", + "ĠCONCLUS ION", + "ĠS ources", + "Ġap ex", + "par ser", + "ĠLog ic", + "Ġp ond", + "Ġto ld", + "ĠSh ap", + "perg illus", + "Ġsay ing", + "Ġmutagen esis", + "Ġmm Hg", + "ĠP AN", + "Ġsm okers", + "od ay", + "Ġhere in", + "CM V", + "ĠP W", + "Ġred shifts", + "ĠMin im", + "ym an", + "ull i", + "d ense", + "Ġarsen ic", + "ĠE MT", + "og aster", + "carboxyl ate", + "s ys", + "R o", + "an ch", + "ĠAl pha", + "ĠTechn ical", + "s v", + "Ġb ones", + "Ġaccept or", + "Ġnew born", + "pri vate", + "Ġnan or", + "ĠSw iss", + "a round", + "Ġsynt ax", + "ĠK ähler", + "Ġaer ial", + "ĠP ale", + "typ edef", + "names pace", + "Ġconfound ing", + "vi Äĩ", + "Ġret ard", + "Ġz eta", + "ĠT um", + "is ch", + "Ġsulf ide", + "ĠT ian", + "u y", + "Ġintu ition", + "Ġphosph olip", + "ĠS her", + "ric ts", + "-------------------------------- --------------------------------", + "ok ines", + "gluc ose", + "tol er", + "ifer ative", + "ĠFlu or", + "Ġencour age", + "Ġrespons ive", + "perturb ative", + "Ġs addle", + "l ers", + "nd ez", + "ĠZ ero", + "ĠDi et", + "Ġdeveloper s", + "S yn", + "Ġconf er", + "Ġorigin ate", + "rop ol", + "ha w", + "le tion", + "ms kip", + "Ġb er", + "Ġpe at", + "v ially", + "Ġgran ules", + "ĠÌ ĥ", + "Ġpl uripot", + "Ġassim ilation", + "Ġdenom inator", + "abil ization", + "ĠEpidem iology", + "MI N", + "eed s", + "ĠV R", + "E val", + "st ore", + "ĠBas eline", + "Ġc u", + "ĠSpect ra", + "Ġfraction ation", + "Ġplac ing", + "Ġbur ied", + "el eration", + "Ġalkal i", + "ĠI U", + "C alc", + "we ak", + "Ġmorphism s", + "Ġlig ase", + "Ġf s", + "Ġutil izes", + "Com put", + "à ¢", + "Ġs tig", + "rel ative", + "Ġimm ature", + "ĠF rac", + "ap i", + "Ġout patient", + "Ġachieve ment", + "Ġstack ing", + "Ġnod ules", + "IN D", + "ĠGP a", + "Ġpercol ation", + "m space", + "Ġbrain s", + "uff le", + "ent ropy", + "L ab", + "Ġstabil ize", + "ĠRic ci", + "ĠAn timicrobial", + "pers onal", + "Ġfarm s", + "ĠP in", + "Ġpor cine", + "Ġoccasion ally", + "w he", + "Ġundergo es", + "Ġregim ens", + "Ġbl ade", + "Ġlinear ized", + "Ġdec on", + "Ġpack ed", + "Ġf ishes", + "ĠM end", + "Ġapproach ing", + "Ġball s", + "Ġpro inflammatory", + "imer ic", + "ĠDirect or", + "Ġsol iton", + "Ġm osaic", + "vi et", + "Me an", + "ĠP ad", + "Ġtri plicate", + "sup ported", + "Ġcar t", + "<< <<", + "Ġrem ission", + "ase ous", + "astic ity", + "ĠM ik", + "ĠStrateg y", + "ram er", + "ĠPol ish", + "Ġent hal", + "Ġheter ozygous", + "ĠGra vity", + "A x", + "Ġorganization al", + "Ġmo vie", + "Ġexpl oratory", + "WL ED", + "Ġmo iety", + "dec re", + "ĠS till", + "Ġ ¡", + "Ġgreen house", + "Ġsupercon ductors", + "en um", + "el in", + "Ġoffer ing", + "st ad", + "ĠT rich", + "Ġre pl", + "Ġrecycl ing", + "ph or", + "Ġin elastic", + "ock ey", + "ĠâĢ Ļ", + "Ġsequ el", + "E B", + "ĠCh ile", + "Ġfibr illation", + "Ġdis ulfide", + "ob tained", + "ub in", + "Ĥ ¬", + "Ġfacilit ating", + "Ġhop ping", + "Ġmedi ator", + "Ġhyd ration", + "Ġspars ity", + "Ġs ati", + "Ġis othermal", + "Ġreturn ing", + "Ġtravel ing", + "Ġin g", + "Ġst ent", + "Ġcapac itor", + "Ġcomprom ise", + "ĠS ud", + "ĠV ision", + "Ġtop ologies", + "opol ysaccharide", + "ĠPro file", + "ĠR ing", + "Ġdiscrep ancies", + "D is", + "AR D", + "cc cc", + "Ġdirect ory", + "ĠCM OS", + "ow ed", + "ill o", + "ĠIns ights", + "ĠT ib", + "Ġab and", + "aro se", + "Or der", + "Ġ ¬", + "Ġintrac ranial", + "Ġintermedi ates", + "Ġhab its", + "Ġcar p", + "pro perty", + "IM AGE", + "ĠU k", + "Ġhydroph ilic", + "W id", + "Ġab iotic", + "Ġobser vers", + "Ġch or", + "ĠCons ervation", + "ĠEnh ance", + "ĠAutom ated", + "ĠGl ut", + "ir atory", + "Ġsp aw", + "ĠE fficiency", + "v ast", + "in iti", + "Ġop tional", + "ĠScal ing", + "if old", + "Ġmt DNA", + "ĠRec onstruction", + "Ġcount able", + "ĠGr ass", + "D en", + "ĠCh ain", + "en zyme", + "Ġwave forms", + "Ġpancre as", + "ĠDet ailed", + "cm d", + "Ġâİ ľ", + "Ġmagnet o", + "ĠFP GA", + "Ġabsol utely", + "Ġstim ulates", + "ach us", + "ĠAr n", + "m essage", + "ocomp atibility", + "H Cl", + "ĠF ish", + "Ġphenomen ological", + "Ġsaliv ary", + "ond o", + "Ġno tions", + "f ur", + "U CT", + "Ġw ww", + "ab et", + "ĠS ulf", + "F il", + "dom inated", + "ars er", + "Ġpack ages", + "Ġsplic e", + "F lo", + "NO WLED", + "x a", + "ĠY uan", + "Ġacet one", + "ĠVit amin", + "ĠÎ ŀ", + "Ġobs c", + "Ġcha per", + "Ġm ort", + "M AN", + "Ġsub tilis", + "Ġoptim ality", + "Ġcontinu ing", + "Ġdu plication", + "Ġmultip lying", + "Ġimmun ological", + "Ġcir rhosis", + "h ospital", + "ĠProb abilistic", + "Ġdele tions", + "Ġca ution", + "Ġow ner", + "ox orubicin", + "Ġla unch", + "Ġc ure", + "th us", + "ĠHerm itian", + "can onical", + "Ġimmun ore", + "form in", + "Ġbroad band", + "part um", + "op he", + "ĠB eta", + "ĠB I", + "Ġïĺ º", + "Ġj umps", + "Ġparad ox", + "um ped", + "Ġdoc tors", + "Ġhospital ized", + "Ġwas h", + "prec ision", + "Ġr uled", + "Ġdu plicate", + "ant e", + "Ġneuro trans", + "Ġïĥ §", + "Ġthem e", + "T aking", + "ĠPl ants", + "f ollowing", + "Ġage ing", + "Ġcon gestion", + "os arcoma", + "Ġrepos itory", + "ĠH ess", + "ĠC atalytic", + "ĠD V", + "IN K", + "pri v", + "ĠAn a", + "ĠS LE", + "ĠTh ailand", + "í ķ", + "Ġd uty", + "loc ations", + "ot er", + "Ġlys ine", + "Ġind ist", + "Ġagon ists", + "A ck", + "Ġminim ally", + "Ġet ching", + "ugg ing", + "c uda", + "nd ef", + "Ġref erring", + "Ġlys ates", + "Ġseroton in", + "crib ing", + "ĠInter face", + "d V", + "Ġd urations", + "Ġphot od", + "Ġd ating", + "Ġirre versible", + "os idase", + "ĠF ROM", + "with in", + "SN R", + "Ġarr hyth", + "ĠR atio", + "ĠTh in", + "cent ered", + "Ġsh ocks", + "ĠV ers", + "Ġnotice able", + "Ġf oci", + "Ġorth onormal", + "Ġâİ Ł", + "Ġlum inescence", + "ĠSUS Y", + "in ternal", + "ĠT our", + "Ġab brevi", + "ĠM AL", + "ver tex", + "Ġem ploys", + "IN S", + "Ġimmunohist ochemistry", + "Ġhepar in", + "Ġidi opathic", + "Ġimmobil ized", + "is he", + "ph th", + "th in", + "ĠSt orage", + "Ġperovsk ite", + "Pro t", + "ĠDepend ing", + "Ġbl ends", + "Ġpred ator", + "Ġdisplay ing", + "Ġvesic le", + "ĠK ra", + "Ġl ane", + "Ġmulti layer", + "Ġhom ozygous", + "cos h", + "Ġsuperf icial", + "Ġ il", + "ĠK R", + "ĠBr un", + "ĠE W", + "op a", + "ĠCart esian", + "ĠCy toplas", + "ĠPen nsylvan", + "b ands", + "Ġangi otensin", + "ĠLat tice", + "G I", + "j ee", + "Ġenlarg ed", + "en ius", + "ĠI a", + "ou x", + "Ġg ent", + "Ġcarbon yl", + "c hers", + "Ġhypot he", + "Ġmic rosp", + "Ġaff ective", + "Ġax ons", + "e i", + "ypt oph", + "ĠJ on", + "que ue", + "ĠG auge", + "men opausal", + "ĠD as", + "ĠEss ential", + "ĠF ault", + "ĠB il", + "Ġtest osterone", + "Ġcham bers", + "d ione", + "Ġelic ited", + "IG N", + "Ġantioxid ants", + "pop ulations", + "Ġov ary", + "Ġâ ĸ", + "Ġabst raction", + "Ġhydro carbons", + "Ġrec tal", + "Ġtrigger ing", + "Ġthorough ly", + "R un", + "acter ia", + "in formation", + "ĠB ed", + "Ġqu enc", + "Ġund ers", + "ĠScot land", + "Ġre volution", + "Ġpit uitary", + "Ġanthrop ogenic", + "f ocus", + "Ġmet han", + "Ġinf low", + "Ġdef lection", + "ĠC ape", + "Ġmulti dimensional", + "Ġarri ved", + "ĠS par", + "d v", + "Ġc ows", + "ĠB h", + "Ġj k", + "tol yl", + "Ġeigen states", + "Ġpre processing", + "ĠR ain", + "ä ¸", + "in z", + "Ġm n", + "RE E", + "atric k", + "D ev", + "Ġfulf illed", + "Ġar tic", + "Ġreal izations", + "ĠComp onent", + "ĠW S", + "Ġinf o", + "pr inted", + "at osis", + "c ache", + "an ov", + "ĠT g", + "cont ent", + "j unc", + "ĠCD K", + "Ġbeh aves", + "ĠK id", + "diff erence", + "ĠP s", + "ĠU g", + "Ġstruct urally", + "ereb ral", + "ĠSur ve", + "he al", + "on ite", + "Ġdele ted", + "iti m", + "St ar", + "ĠSpe ech", + "ĠA str", + "g radient", + "Ġf ellow", + "Ġsy ring", + "N B", + "ĠN B", + "Ġcre ep", + "Ġlog ging", + "Ġint en", + "scal ar", + "ĠAtmosp heric", + "Ġl upus", + "Ġiden tically", + "process ed", + "sign al", + "ĠClo str", + "anc ers", + "Ġd b", + "Ġsubs ystem", + "s itu", + "Ġferro electric", + "Ġï Ľľ", + "Ġo re", + "ĠR b", + "ĠMicro soft", + "ĠC och", + "ĠAc tin", + "Ġnerv es", + "Ġexper tise", + "o tive", + "ĠPoinc aré", + "ĠR ig", + "Ġpsych osocial", + "Ġprogen itors", + "ĠM yr", + "ĠH ug", + "Ġbi ogenesis", + "Ġincorpor ates", + "Ġnever theless", + "ĠDec l", + "obs erv", + "Ġmulti plier", + "Ġrespond ing", + "ho ff", + "Ġimp acted", + "Ġsynd romes", + "k el", + "ĠS ynt", + "ĠCon cer", + "ĠAmeric ans", + "Ġspac ed", + "um ption", + "ĠThom pson", + "ĠJacob ian", + "T ra", + "e volution", + "Ġdid n", + "Ġpercenti le", + "Ġl id", + "equ ivalent", + "Ġantic o", + "Ġmulti ply", + "Ġpen icillin", + "Ġrespons iveness", + "Ġrun off", + "al anine", + "squ ares", + "ĠIns ulin", + "re le", + "ĠL if", + "ĠMink owski", + "Ġbl end", + "ĠP and", + "Ġtw elve", + "Ġhybrid s", + "Ġb ass", + "inter action", + "ĠBanglades h", + "Ġop ens", + "ĠAr ts", + "Ġconc ave", + "Ġped est", + "Ġf ist", + "ĠAd ults", + "open ia", + "EN CE", + "ĠF usion", + "Ġmicro c", + "ĠSur gical", + "yl ate", + "Ġpack aging", + "OC K", + "Q C", + "T ri", + "sc an", + "Ġregard s", + "Ġdiscrim inant", + "Ġind ustries", + "ic us", + "ĠWalk er", + "Ġpe ers", + "sy nt", + "Ġhor se", + "Ġflow ing", + "ur red", + "ĠCR P", + "ĠCare er", + "iffiffiffiff iffiffiffiff", + "ĠM SE", + "han a", + "ĠMor tality", + "Ġtumorigen esis", + "ĠIs lam", + "Ġazim uthal", + "w en", + "Ġs ys", + "az in", + "ne ighbor", + "Con fig", + "the y", + "Ġs orption", + "Ġsp anned", + "Ġview point", + "M OD", + "Ġth rust", + "up lex", + "Ġhist ograms", + "Ġprogram med", + "Ġeth ics", + "ect able", + "represent ation", + "um ns", + "Ġstre et", + "ĠSob olev", + "Ġexc ision", + "ĠR ud", + "qui res", + "Ġown ed", + "Ġthous and", + "Ġantagon ists", + "U ST", + "Ġdrastic ally", + "ĠóµĦ ©", + "ĠD or", + "ĠM OS", + "p n", + "ĠDec re", + "D ep", + "Ġs intering", + "Ġpur ple", + "et hanol", + "Ġhydro carbon", + "ĠF O", + "left rightarrow", + "Ġimmun ofluorescence", + "ĠO M", + "Ġmat urity", + "Ġearthqu akes", + "Ġax on", + "Ġprob ed", + "OR D", + "ĠAD P", + "s g", + "om ere", + "Ġtrans cribed", + "M ar", + "ĠU til", + "ĠI A", + "Ġcomp iled", + "Ġsuper vision", + "ĠX en", + "ĠJ ur", + "com par", + "Ġhypert ensive", + "il ized", + "ra e", + "Con clusion", + "'' '", + "Do uble", + "ĠF as", + "Ġins ectic", + "ĠPre m", + "P ri", + "ĠCa o", + "ĠQuestion naire", + "Ġg athered", + "G W", + "ĠN V", + "ĠLact obacillus", + "Ġcycl in", + "Ġre ject", + "Ġsk ull", + "Ġa w", + "ĠC old", + "Ġmes ons", + "b d", + "Ġdetrim ental", + "ap ore", + "now led", + "ĠCX CL", + "Ġspik es", + "Ġt ent", + "ĠL ength", + "Ġdo or", + "Ġfl our", + "ustr ation", + "He alth", + "Ġtrans parency", + "Ġdisrup ted", + "H y", + "over l", + "ĠReinfor cement", + "cept ors", + "ĠK os", + "ret roviral", + "ĠIN T", + "ĠS or", + "Ġadop ting", + "Ġend oplasmic", + "Ġsu it", + "Ġopi oid", + "Ġintegr in", + "aw ay", + "Ġtail ored", + "ĠS oc", + "Ġqu ies", + "Ġhus band", + "Ġ umb", + "ĠC ai", + "ĠAs pergillus", + "ĠGa N", + "Ġdistingu ishing", + "Ġextrap olation", + "Ġc age", + "Ġscav enging", + "K F", + "T ree", + "ĠConfl ict", + "UN C", + "Ġmang anese", + "d ays", + "à Ł", + "ĠL ive", + "s d", + "ract or", + "Ġl ute", + "Ġdis similar", + "Ġ ib", + "ĠV eg", + "Ġoccur rences", + "Ġbin omial", + "Schem e", + "Ġt ape", + "ĠC ant", + "Ġelect rosp", + "C d", + "m ade", + "Ġse vent", + "sh ared", + "Ġaccess ion", + "or p", + "D ATA", + "le ted", + "V ari", + "Ġro se", + "tag ged", + "ĠA th", + "Ġed dy", + "est one", + "Ġes ters", + "Ġtyp ing", + "ĠStud ents", + "y i", + "ores istance", + "ino is", + "Ġgluc ocortic", + "i osis", + "Ġcor onal", + "Ġshe ath", + "ĠT rack", + "Ġequ ilibria", + "amm ing", + "Ġp ione", + "Ġsc iences", + "Ġsuppress ing", + "Ġdec o", + "if ndef", + "H is", + "Ġpel let", + "L inear", + "orb ent", + "Ġflat ten", + "Ġst raw", + "Ġal beit", + "ĠPredic tive", + "Ġg aze", + "Ġhydro ly", + "ut her", + "od ers", + "Ġfl ap", + "Ġsimplic ial", + "S ystem", + "Ġst ressed", + "Ġimmun oglobulin", + "il ia", + "Ġconsum ing", + "Ġà ©", + "gal act", + "Ġadul thood", + "Ġvor ticity", + "ycl ic", + "ovolta ic", + "ivest ock", + "Ġbed s", + "ĠPl anning", + "Ġparameter ized", + "Ġg host", + "maxim um", + "Ġsuper im", + "Ġphysic ochemical", + "g p", + "ong ue", + "Ġprim ordial", + "x ff", + "ins ula", + "M c", + "Ġminim izes", + "ĠGra vitational", + "os oma", + "ign ificant", + "Ġelucid ated", + "Ġsub surface", + "sign ificant", + "Ġrel atives", + "fer roni", + "trans f", + "Ġtail s", + "b eck", + "om agnetic", + "Ġun necessary", + "Ġmon omial", + "del ay", + "Ġst a", + "ĠS uz", + "Ġalter ing", + "LO G", + "ĠL ac", + "Ġr anks", + "h w", + "ĠN ep", + "Ġneu ropath", + "ĠComp e", + "G r", + "P ati", + "red uce", + "ĠMalays ia", + "cer al", + "Ġmicro bes", + "Ġlens ing", + "ĠCalc ium", + "ĠDeterm in", + "ĠCost a", + "Ġke eps", + "print ing", + "ĉĉĉĉ ĉĉ", + "ch in", + "ex posed", + "Ġperiod ically", + "Ġrend er", + "ĠCardi ovascular", + "ent in", + "Ġbio availability", + "Ġinterpret ations", + "ĠC U", + "Ġneg oti", + "Ġan tim", + "Ġdeem ed", + "Ġa e", + "Ġhal os", + "ĠMich igan", + "Ġoste oarthritis", + "di ag", + "ĠB eng", + "Ġmet agen", + "Ġparameter ization", + "di agn", + "ĠMat ching", + "Ġcatal ysis", + "ut s", + "Ġdissem ination", + "Ġout let", + "ĠMo on", + "ĠG ST", + "sp here", + "Ġresearc her", + "ambig uation", + "Ġra ises", + "Ġflavon oids", + "ĠMultiv ariate", + "Ġac cl", + "W I", + "Ġn u", + "Ġerg odic", + "un ique", + "atin ib", + "Ġresol utions", + "Ġhous es", + "D EC", + "ig hed", + "Ġsix th", + "Ġpolitic ian", + "ap ache", + "Ġsol ute", + "Ġaug ment", + "st ress", + "H IV", + "ĠS ets", + "Ġtrans istors", + "qu bit", + "am ines", + "Ġfarm ers", + "Ġn t", + "ĠLag range", + "Ġveget ables", + "Ġpre t", + "ĠS ynthetic", + "Ġcon es", + "Ġmedic ines", + "Ġgen omics", + "Ġexperi encing", + "ag land", + "Ġgen ital", + "ĠObserv atory", + "ĠS kin", + "ĠR osen", + "ĠBrit ain", + "gen ome", + "ĠEnt ropy", + "Ġr ac", + "G o", + "Ġw alks", + "cript or", + "ĠB aker", + "ok er", + "Ġprop ensity", + "Ġpopular ity", + "restric ted", + "ĠB ert", + "b efore", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠ", + "aut o", + "R ank", + "ĠR CT", + "Ġp ocket", + "ob ut", + "Ġbenz ene", + "ĠCN T", + "yptoph an", + "all is", + "ĠRes ources", + "ĠBer lin", + "Ġsch olar", + "gl ob", + "ĠSp eed", + "ĠX iao", + "big gl", + "AN CE", + "ĠPr ime", + "Ph ys", + "id ia", + "Ġmon oc", + "ĠCommun ications", + "ĠPrec ision", + "ĠPa uli", + "Ġinvestig ators", + "ĠLi ang", + "Ġmeteor ological", + "m og", + "re ens", + "ub ric", + "Ġrearrang ement", + "or ta", + "E lect", + "ĠT ukey", + "ĠM is", + "Ġepid erm", + "ĠACK NOWLED", + "w art", + "Ġexcit on", + "Ġassoci ative", + "st yrene", + "Ġl osing", + "ĠO d", + "p rep", + "ess ation", + "Ġattrib utable", + "ĠNa vier", + "an z", + "Ġcorrect ness", + "o ints", + "ĠR ather", + "Ġassemb lies", + "Ġbrid ges", + "OS S", + "M ET", + "Ġper m", + "Ġauthor ities", + "Ġiod ine", + "sh ire", + "inter val", + "epti d", + "Ġpot ency", + "Ġrenew able", + "v ard", + "Ġsur jective", + "Ġsubsequ ence", + "ĠE Vs", + "it ching", + "Ġgen otyping", + "ĠAcc urate", + "iop hene", + "G ly", + "pl ified", + "ĠDist inct", + "AC H", + "Ġspe akers", + "hol m", + "Ġpro s", + "ĠDev ice", + "m c", + "ĠD ense", + "ĠV a", + "r ison", + "Ġac yl", + "ĠPrinc ipal", + "ĠV iral", + "Ġcos ine", + "ĠRes idual", + "Ġeff lux", + "ĠSub jects", + "Ġrect angle", + "work ers", + "Ġrot ated", + "Ġb omb", + "ĠRes olution", + "ne ar", + "Ġ ®", + "Ġestabl ishes", + "am ed", + "Ġcompet ence", + "G lu", + "ĠD end", + "ĠH sp", + "ens ation", + "ĠLe ad", + "Ġlog ger", + "sin h", + "Ġint ellectual", + "form er", + "C e", + "Ġmon ocyte", + "ho res", + "Ġdiast olic", + "Ġlif espan", + "ĠSil va", + "ar um", + "Ġtrans ducer", + "Ġout going", + "ent ation", + "Ġabsorb ing", + "it age", + "Ġsynt hesize", + "Ġfe eling", + "as ian", + "Ġcer amics", + "i ph", + "Ġnon local", + "P art", + "Ġimmers ed", + "station ary", + "lect ing", + "Ġweld ing", + "Ġres embles", + "ĠK at", + "m aster", + "Ġinters ect", + "ĠO lig", + "ĠTre nds", + "ag h", + "ĠN av", + "ĠT u", + "Ġep ist", + "Ġclin ics", + "Ġrepresent atives", + "Ġgrate ful", + "G PIO", + "H H", + "Ġun ambig", + "t uning", + "Ġnew sp", + "coh ol", + "################ ################", + "%%%% %%%%", + "represent ed", + "oc ic", + "ĠF uk", + "ĠS und", + "has one", + "M ode", + "ol one", + "ĠS b", + "Th ree", + "L ink", + "ce phal", + "ĠK ap", + "Ġelim inating", + "Ġmelan ogaster", + "â Ł", + "ĠB MD", + "IS E", + "ĠBat tle", + "Ġshrink age", + "ĠSe ven", + "ĠGl ass", + "rom agn", + "Ġk l", + "ĠOb viously", + "pres erving", + "ĠPl atform", + "ĠÌ ĩ", + "om avirus", + "ĠE ight", + "Ġall erg", + "ĠNanopar ticles", + "ary l", + "Ġpri ors", + "pat tern", + "Ġlinear ity", + "Ġtr uly", + "Pro cess", + "Ġdesc ending", + "ĠVictor ia", + "c ond", + "ĠI CP", + "ores cent", + "Ġauthor ity", + "Ġm ock", + "igm oid", + "Ġcomorbid ities", + "sim ple", + "Ġbl o", + "ĠComput e", + "Ġgest ation", + "achus etts", + "Ġph antom", + "ĠEd ward", + "ĠF BS", + "fact ors", + "ĠEstim ates", + "c lear", + "W B", + "pro ducts", + "num py", + "b rief", + "Ġsh op", + "ĠPol i", + "ĠRespir atory", + "Ġsurprising ly", + "Ġnanocom posite", + "divid ual", + "Ġholog raphic", + "ygd ala", + "ro plasty", + "ot actic", + "ĠPennsylvan ia", + "ĠSc ore", + "Ob j", + "Ġst ories", + "Ġmaxim izing", + "Ġgel atin", + "r ites", + "ĠT au", + "Ġtryp sin", + "Ġ ith", + "Ġf aint", + "Ġprim ing", + "ew orthy", + "ĠIn verse", + "Ġkn ots", + "sh arp", + "Ġtrain s", + "Ġcred it", + "ĠBel ow", + "pix el", + "Ġspind le", + "ĠP ast", + "Ġenum erate", + "ol ateral", + "Ġatt ending", + "Ġquanti zed", + "Ġhapl otypes", + "enc l", + "Ġw aven", + "Ġfurther more", + "Ġchalleng ed", + "Ġmanufact ured", + "ipher al", + "Ġinfin ites", + "ĠR and", + "Ġst aging", + "ag an", + "Ġper ox", + "tr ifluor", + "ĠMc K", + "ĠF OX", + "ĠL ank", + "ĠLu o", + "ĠAn th", + "ibri o", + "y el", + "ĠJ i", + "ĠI O", + "ĠB ridge", + "ĠR ow", + "Ġcompens ated", + "ats u", + "Ġhypothe tical", + "Ġtermin als", + "Ġcobal t", + "m ers", + "ĠM ang", + "N I", + "ĠR ac", + "AL S", + "f en", + "ĠU b", + "Ġpred ation", + "c adherin", + "ĠSh anghai", + "Ġtri es", + "Ġsp ort", + "acryl ate", + "ĠAlgebra ic", + "ain ts", + "Ex pr", + "Ġand rogen", + "Ġw edge", + "dis p", + "Ġstir red", + "ĠA le", + "Ġc ock", + "F our", + "Ġsc anner", + "Ġplas mon", + "ĠG ender", + "ĠRec ord", + "ĠInj ury", + "obl astic", + "ĠFlu orescence", + "Ġanti depress", + "Ġdefin itive", + "Ġrep ression", + "ordin ates", + "Ġangi ography", + "ĠHel ical", + "Ġcancell ation", + "re lease", + "Ġrel ational", + "ĠAnd re", + "mo lecule", + "Ġshap ing", + "ĠDen mark", + "ĠAL S", + "ĠN W", + "over rightarrow", + "Ġcomb at", + "box es", + "sub ject", + "Ġnanos cale", + "Ġcan ine", + "Ġs aving", + "Ġstrateg ic", + "St at", + "ĠD ub", + "Ġper mitted", + "ĠTw itter", + "â Ķ", + "Ġmem ories", + "ĠBus iness", + "ad ays", + "Ġpool ing", + "ĠClust ers", + "im ide", + "oun ters", + "frac tion", + "ĠCl iff", + "C am", + "E ven", + "K Y", + "k it", + "ibr ated", + "Ġaccompan ying", + "an us", + "Ġbu oy", + "Ġprolifer ative", + "Ġpro c", + "Ġstabil izing", + "ĠNam ely", + "pos p", + "so on", + "Ġaberr ant", + "Ġinter stellar", + "Over all", + "ĠG n", + "ĠFeed back", + "Ġo racle", + "Ġpre natal", + "com mun", + "Ġoutbreak s", + "Ġfertil ization", + "ĠM AG", + "Ġsing er", + "ĠMic rowave", + "ĠPar liament", + "cast ing", + "Gen eral", + "al gorithm", + "Ġph rase", + "Ġa vian", + "ĠP LA", + "Ġhard ly", + "approxim ately", + "AR CH", + "Ġtrans c", + "Ġdec omp", + "cont in", + "ĠMil ky", + "Ġher pes", + "R ange", + "O FF", + "prising ly", + "l x", + "ĠAB A", + "Ġsh ore", + "Ġderiv ing", + "Ġpel lets", + "nowled g", + "I tem", + "strand ed", + "bu ilt", + "Gl c", + "qu ist", + "ĠSub strate", + "Ġtra ditionally", + "ĠM ount", + "ival ence", + "ax ation", + "Ġloc ate", + "Ġg un", + "Ġvoc abulary", + "ĠPol ym", + "Ġec t", + "Ġm ult", + "Ġsediment ary", + "Ġautocor relation", + "ĠS ympt", + "Ġterr itory", + "Ġexcit atory", + "Ġv ote", + "Ġhe red", + "ace a", + "ĠF ocus", + "am pling", + "ff ee", + "Ġprim es", + "ĠM aking", + "ir s", + "MP s", + "Ġl itter", + "amet hasone", + "Ġk J", + "Ġsecret ory", + "Ġcost ly", + "Ġpartners hip", + "ĠBacter ia", + "Ġperoxid ation", + "st roke", + "ĠS av", + "ĠB W", + "Ġconn ects", + "Ġam ine", + "r il", + "Ġbat tle", + "ĠN otes", + "ĠPro vid", + "ĠInstit utional", + "Ġpro pri", + "f an", + "Ġp un", + "rom b", + "v ities", + "ĠC AM", + "ĠI sh", + "ĠH N", + "ĠRec omb", + "sc he", + "Ġsyn chrotron", + "ri k", + "syn aptic", + "ĠGeorg ia", + "? ?", + "C Y", + "Ġcorrespond ed", + "kin ase", + "ĠI TS", + "Ġpropos als", + "Ġbi oge", + "ĠE SR", + "ĠW en", + "ĠJ a", + "ĠSe vere", + "ĠAd en", + "ĠC CL", + "Ġse at", + "ĠK re", + "Ġhelp ing", + "Ġn ets", + "ĠL ep", + "hed ra", + "opo ulos", + "ĠB ak", + "ans as", + "Ġref rig", + "Ġubiquit ous", + "Ġmat ters", + "Ġsil icate", + "ĠLast ly", + "ĠThe ories", + "Ġag arose", + "big gr", + "trans ition", + "ĠDec omposition", + "b romo", + "Ġstake holders", + "ĠE E", + "On ly", + "ĠKen ya", + "Ġarg on", + "ĠIdentif ying", + "Ġtourn ament", + "cl ock", + "ĠCF U", + "ĠBehavi oral", + "Ġp od", + "Ġtaxon omy", + "ĠPro duct", + "ĠAl ong", + "Ġfamil ial", + "Ġdescript or", + "v ated", + "ĠVari ables", + "t p", + "Ġgood s", + "ĠA ST", + "ĠAn is", + "Ġspin or", + "at tention", + "Ġbas ket", + "Str uct", + "Ġimmunohist ochemical", + "eng ers", + "C AT", + "Ġtang ential", + "C ap", + "ĠP air", + "Ġvisco elastic", + "ĠAd s", + "Ġglycos ylation", + "Ġd ur", + "ĠMin imum", + "Ġrig idity", + "st ats", + "till ation", + "ĠDisc rim", + "ĠLeg end", + "Pre vious", + "fil m", + "Ġalumin ium", + "M icro", + "in ia", + "eg el", + "ĠSub cellular", + "Ġbottlen eck", + "Ġsy ll", + "ic le", + "Ġshe af", + "che ll", + "ex ample", + "ĠSe lected", + "Ġpred ators", + "Ġre per", + "Ġstr ugg", + "ĠM aria", + "ly l", + "L F", + "Ġexerc ises", + "ob ium", + "IL ITY", + "cor rected", + "Ġbenchmark s", + "ĠT ol", + "Ġinter cept", + "ĠCalc ulation", + "ĠIndones ia", + "Ġgli oblastoma", + "K M", + "ĠSup plemental", + "Ġciti zens", + "ad ren", + "Ġmultim odal", + "Ġmosquito es", + "iv a", + "ĠFind ings", + "ĠP ub", + "ĠMac roph", + "Ack nowledg", + "Ġbas ins", + "ex act", + "Ġgra des", + "Ġf ir", + "ig a", + "ĠPol ynomial", + "ĠLong itudinal", + "Ġsemicon ductors", + "T op", + "ip tera", + "Ġlack s", + "ro graph", + "Ġselec ts", + "Ġswe et", + "Ġb ac", + "Ġdown loaded", + "ap onic", + "ij k", + "ot onic", + "normal ized", + "ĠVari ability", + "di vision", + "ĠSu pers", + "il ab", + "H uman", + "Ġlept in", + "Ġosm otic", + "Ġh ur", + "ĠSing apore", + "ĠO PT", + "ĠSo viet", + "lit axel", + "ret aceous", + "ĠOn c", + "ĠI X", + "ul as", + "u ent", + "Ġlymph oid", + "T c", + "Ġrational e", + "L ayer", + "os ities", + "Ġdes ire", + "ĠAnn ual", + "ub a", + "ĠCompound s", + "Ġantif ungal", + "Ġcation ic", + "it ems", + "acter ium", + "amil ies", + "Ġelong ated", + "ĠMass achusetts", + "ĠIr ish", + "ass o", + "az o", + "ĠBur k", + "rob enius", + "Ġis instance", + "b ion", + "Ġgre edy", + "Ġnicot ine", + "Ġretrie ve", + "Ġsym pathetic", + "que e", + "Ġfol i", + "Ġsp utter", + "Ġgra ding", + "determ ined", + "Ġab norm", + "Ġman agers", + "Ġtop ical", + "Ġimm ig", + "ĠD NN", + "g tr", + "Ġdet ections", + "ĠOb esity", + "s uc", + "ĠSc he", + "Ġtr unk", + "Ġto ugh", + "ĠB N", + "Ġr u", + "ox if", + "Ġaim ing", + "ĠExt racellular", + "Ġhapl otype", + "D u", + "ĠD ing", + "ĠD ol", + "Ġhum id", + "b rom", + "Ġoff line", + "Comb ining", + "Ġpuls ar", + "Ġpar i", + "part ate", + "im ated", + "Ġwaters hed", + "acryl amide", + "ex ec", + "ĠCom posite", + "Ġdispers ive", + "Ġt ons", + "rom etry", + "ĠJ ud", + "az a", + "Ġchick ens", + "reg ister", + "n z", + "U til", + "ĠV es", + "e V", + "ĠR ule", + "sub stituted", + "Con v", + "qu ery", + "M ac", + "ĠT ar", + "im plies", + "ĠR ates", + "Ġr ins", + "Ġtimes cales", + "ĠCz ech", + "S uch", + "res timate", + "ĠM b", + "ĠFu j", + "ĠI MD", + "c it", + "Ġra ising", + ".... ....", + "h ome", + "as ted", + "Ġoc ta", + "Ġc admium", + "Ġps ori", + "role um", + "ĠSt ellar", + "ĠKin ase", + "ĠG ard", + "ie u", + "ĠMo S", + "M G", + "ĠG SH", + "Ġhaz ards", + "Ġn ice", + "he ating", + "Ġreproduc ible", + "gen esis", + "ĠIg M", + "Ġbe at", + "onucle ase", + "entral ized", + "ĠL é", + "Ġd ol", + "Ġdeep ly", + "rac tive", + "Ġgl ial", + "i ella", + "Ġinitial ized", + "ĠMethod ology", + "Ġbent hic", + "om i", + "ĠAl ter", + "Or dered", + "ĠL IN", + "Ġun ilateral", + "Ġcortic oster", + "L EN", + "Ġdil ute", + "Ġmetall oprotein", + "ab eth", + "amp ion", + "Ġmor al", + "ĠSi C", + "Ġquadr ature", + "Ġsediment ation", + "et e", + "ĠF rag", + "Ġpeak ed", + "Ġmitig ation", + "Ġsol di", + "Ġdoub ly", + "Ġellip so", + "Ġlnc RNAs", + "Ġâİ ¢", + "ĠS ame", + "ĠS ustain", + "ĠCap acity", + "Ġs omat", + "Ġtrans istor", + "Ġassay ed", + "ĠN ur", + "to ols", + "S ing", + "Ġlig ament", + "ate ver", + "Ġper ce", + "hen ce", + "U X", + "s ent", + "EG G", + "th ird", + "end ers", + "the oretic", + "Ġre wards", + "ut o", + "Ġinstall ation", + "ĠKine tic", + "ĠIn nov", + "ĠSol ving", + "ĠS ymmetry", + "Ġr amp", + "Ġneu ropathy", + "omer ization", + "Ġcat ech", + "P red", + "ĠB oh", + "EM ENT", + "Ġarm y", + "ĠYuk awa", + "Ġalign ments", + "ĠDepend ence", + "Ġen v", + "e an", + "s r", + "Ġinterp reting", + "eloc ity", + "Ġpsych ology", + "Ġbiofil ms", + "Ġeccentric ity", + "l ot", + "analy tic", + "Ġperiod icity", + "n ings", + "ĠK ent", + "fl ag", + "Ġm p", + "ĠN ich", + "hi re", + "Ġfl are", + "Ġcit rate", + "Ġp aste", + "Ġdele te", + "zym es", + "orient ation", + "ĠH Y", + "Ġcomm ands", + "Ġstri ke", + "s ymbol", + "ĠM ind", + "Ġoptim isation", + "Ġosteopor osis", + "ĠInf lammation", + "ĠIntellig ence", + "e h", + "ut um", + "Ġv ec", + "ell ation", + "ĠBl och", + "ĠMajor ana", + "en or", + "ĠN gu", + "Ġde uter", + "oped ia", + "Ġ utter", + "Ġrib osome", + "Ġact ors", + "elect ronic", + "é e", + "Ġfeat uring", + "ag le", + "Ġper in", + "ĠC ivil", + "Ġpred efined", + "l ag", + "ĠJ AK", + "j amin", + "in dividual", + "on c", + "Ġf ishing", + "di tive", + "N orm", + "ĠSc anning", + "van ishing", + "Ġc essation", + "ĠH ole", + "rib utes", + "I E", + "ĠM pc", + "weg ian", + "M a", + "Ġrevis ited", + "ĠPl us", + "abil ized", + "Ġsc anned", + "ĠEx change", + "Ġbrom ide", + "L ife", + "ot roph", + "AD S", + "âĭ ħ", + "Ġoper ative", + "ĠB ERT", + "Ġpl ume", + "Ġpo orer", + "Ġtro ut", + "Ġmicrotub ule", + "Ġphosph atidyl", + "radi us", + "ĠMus cle", + "Ġcarcin ogenesis", + "Ġsee ing", + "ucle in", + "f ollow", + "Ġsup plements", + "ol ars", + "spec ially", + "Ġcomple ting", + "Ġna ïve", + "ĠÏ ©", + "clero tic", + "D isc", + "ĠF estival", + "Ġcl ick", + "cl usive", + "Ġcatal ogue", + "Ġap ps", + "ĠS ED", + "Ġstack ed", + "Ġtun e", + "ĠDM EM", + "Ġaeros ols", + "Ġg ear", + "ant ine", + "ĠSt one", + "Ġpos itives", + "tri ang", + "prob ability", + "Ġdec oupling", + "ĠÍ ĵ", + "ĠV in", + "Ġsurv ived", + "Ġre plicated", + "ut rient", + "Ġtemper ate", + "Ġens embles", + "Ġmultic enter", + "Ġg aseous", + "ide a", + "class ification", + "ĠOut come", + "cl onal", + "Ġdiscontinu ity", + "Ġadvantage ous", + "Ġdist ricts", + "ĠI BM", + "inguish able", + "Ġcar s", + "c ult", + "en riched", + "arg in", + "nov ae", + "stead y", + "Ġbu y", + "pir ation", + "Ġpartition ed", + "Ġin ability", + "p q", + "Ġb ull", + "od end", + "Ġass istant", + "Ġlum en", + "Ġconver ting", + "P Y", + "z ol", + "ut ors", + "ĠNLR P", + "app ly", + "ĠBon ferroni", + "L s", + "Ġt ips", + "ĠL N", + "rol ase", + "Ġadv is", + "ĠMet ast", + "Ġsaliv a", + "Ġin habit", + "Ġr im", + "de bug", + "An y", + "Ġfor b", + "Ġvers atile", + "ĠComp act", + "v oc", + "ĠI so", + "ĠJ us", + "b odies", + "AR M", + "ĠGW AS", + "he tized", + "Ġmicrofluid ic", + "Ġacet onitrile", + "Ġin hom", + "Ġparen ch", + "Ġins ensitive", + "Ġag ency", + "po or", + "ĠAn gi", + "Ġappro ached", + "Ġem ulsion", + "Ġvol untary", + "ut t", + "ĠRec urrent", + "ric ulum", + "à ª", + "Ġt all", + "ĠDep th", + "Ġf f", + "ĠInc idence", + "Ġmanifest ation", + "Ġcomprom ised", + "i aceae", + "ĠM IT", + "otrans fer", + "ĠW D", + "m ov", + "ĠMan ual", + "M edi", + "Ġinterfer ing", + "ĠJacob i", + "K T", + "Ġs arcoma", + "Ġkid neys", + "Ġod or", + "Ġt i", + "yd ay", + "alth ough", + "vis ible", + "Ġd engue", + "ĠC AL", + "str at", + "ĠVari ations", + "in ib", + "comp onents", + "ĠT ob", + "ĠAnti oxidant", + "Í Ķ", + "Ġk iller", + "Ġsubt racted", + "ĠE vents", + "Ġim plements", + "ĠG AN", + "Ġprophyl axis", + "Ġno zz", + "Ġsm oothed", + "Ġdecay ing", + "ĠIniti ally", + "Ġuncom mon", + "Ġconduc tor", + "ĠW OR", + "av ity", + "ĠX ie", + "ĠAc et", + "Ġin e", + "ĠBe am", + "opol ymer", + "ĠX ML", + "ĠW ide", + "Ñ ĥ", + "Ġe jection", + "B MI", + "t c", + "ue z", + "Ġcereb ellar", + "Ġcatch ment", + "cox on", + "ĠSh annon", + "Ġcentral ity", + "Ġsaf ely", + "pro be", + "ĠLabor atories", + "Ġn c", + "Ġsp her", + "Ġprob ing", + "ĠLe v", + "Ġa f", + "ĠM ig", + "ĠV ascular", + "Ġprogram mes", + "Ġcontamin ants", + "sequ ent", + "Ġbond ed", + "integr ation", + "b os", + "ĠF ew", + "ĠIll inois", + "S he", + "W C", + "ĠG PIO", + "o C", + "ĠM aternal", + "erc etin", + "ĠMass ive", + "Ġen orm", + "img ur", + "Ġb idirectional", + "ĠG raphene", + "ins ky", + "ĠObs erve", + "Ġst ops", + "b io", + "ĠL ines", + "ĠG ill", + "Ġeigen vector", + "Sp ace", + "ĠM ining", + "Ġmel atonin", + "ĠS ET", + "onse qu", + "os cale", + "ĠR aw", + "Ġreview ers", + "Ġnan ofib", + "t aking", + "amm ad", + "Ġrecurs ion", + "us al", + "Ġpos itron", + "ĠN IH", + "ĠIN TER", + "ĠDoc ument", + "Ġconstant ly", + "Ġunderg one", + "Ġelect roweak", + "Ġiter atively", + "fol io", + "Ġsub family", + "Ġâİ ¥", + "P age", + "f erm", + "av ir", + "Ġag encies", + "Ġpol ys", + "ĠSqu are", + "ym m", + "Ġhydro gels", + "al most", + "ar ter", + "Ġan kle", + "Ġr ises", + "Ġmed ull", + "g ated", + "Ġmon onuclear", + "Ġdiscuss ing", + "Ġprof essor", + "trans formed", + "Ġcol ours", + "rag g", + "emic on", + "Ġsymmet rical", + "Ġplac ental", + "Ġl i", + "Ġstud io", + "sequ ences", + "Ġt am", + "ĠL ap", + "ĠCriter ia", + "Ġhapp ened", + "Ġantifer romagnetic", + "ĠHaus dorff", + "ĠCONCLUS IONS", + "H ER", + "V R", + "ĠK or", + "ĠA PO", + "Ġprot ecting", + "ĠS OL", + "ĠB uck", + "ph ia", + "ĠMul tim", + "on ine", + "uls ions", + "Ġg p", + "benz amide", + "ĠNAD PH", + "ĠOh io", + "ĠM EG", + "CO VID", + "Ġdisplac ed", + "ĠAb b", + "Ġbran ched", + "ĠN avy", + "ĠN rf", + "ĠO DE", + "ach i", + "ĠTrans ient", + "Ġcircum ference", + "Ġbe es", + "ir ation", + "Ġfac ulty", + "IG HT", + "ĠMetabol ism", + "M K", + "ĠIn equ", + "ĠQual itative", + "P BS", + "ter minus", + "k ary", + "o vian", + "ĠT Hz", + "ĠRel iability", + "f uran", + "Ġcor ners", + "Ġattack er", + "Ġmar riage", + "oprec ipitation", + "ĠC ry", + "ĠâĬ Ļ", + "Ġevol ves", + "Ġb an", + "Ġdi urnal", + "oun ce", + "Ġover w", + "ĠH off", + "Ġextr insic", + "am ps", + "UL AR", + "op her", + "Ġlight ing", + "Ġarchitect ural", + "hes ive", + "Ġsav ings", + "Ġglauc oma", + "oz oa", + "ĠO ption", + "cont roll", + "eck er", + "Ġoste ocl", + "Ġglyc ine", + "anal yses", + "ĠAl d", + "ĠS yd", + "ĠC x", + "Ġscal ars", + "Ġknow ing", + "Ġrem ember", + "ĠEmb ry", + "T EM", + "ĠB ran", + "F ORM", + "Ġsurv iving", + "Ġglob ular", + "Ġincl usive", + "sc hed", + "UT ION", + "Ġquadrup ole", + "ĠH ubbard", + "Ġax onal", + "ĠCos mic", + "Ġsl ots", + "ĠProced ure", + "ag in", + "ĠLo op", + "are r", + "Ġbut ter", + "Ġhist opathological", + "f usion", + "AN OVA", + "Ġclos ing", + "ĠL ord", + "ĠB is", + "ĠR AM", + "ID E", + "Ġj ournals", + "Ġmon keys", + "Ġatten uates", + "Ġsegment ed", + "T OF", + "o tional", + "pol ymer", + "ĠSha h", + "A kt", + "W r", + "l ov", + "Ġpolym orphic", + "Ġarrang ements", + "U F", + "l on", + "Ġdep ressed", + "NA T", + "ĠOper ation", + "Î ¹", + "ĠR an", + "â IJ", + "Ġthere after", + "Ġmyel oma", + "j or", + "à ¥", + "ĠW inter", + "pt osis", + "D ir", + "ver ty", + "ĠF inn", + "Ġorth olog", + "Ġmonoton ically", + "Ġtect onic", + "ĠG BM", + "ĠA O", + "Ġgener ative", + "C learly", + "Ġt ile", + "ĠR NN", + "Ġground s", + "Ga As", + "Ġbe e", + "ĠB oy", + "ĠTranscription al", + "ur in", + "ot om", + "Ġsinus oidal", + "ĠA y", + "ĠCl inic", + "ut orial", + "ĠAD C", + "ER IAL", + "c ation", + "ĠAD HD", + "cycl ohex", + "ĠHaw ai", + "ast om", + "Ġmorph ologies", + "Ġrod ents", + "Ġscal ability", + "R OS", + "a emia", + "Ġdecom pose", + "Ġpiv otal", + "Ġdiffus ivity", + "Ġco valent", + "ĠK D", + "ataly st", + "Ġold est", + "Ġsu itability", + "Ġw ants", + "if ts", + "ĠDist ributions", + "ĠQue en", + "l ich", + "Ġpar se", + "ĠM HD", + "Ġrec re", + "Ġhydrox ide", + "e um", + "Ġle v", + "Ġrefer ral", + "plan es", + "ĠEg ypt", + "Ġl enti", + "Ġtrans actions", + "Ġexp ense", + "Ġcy sts", + "Ġabs cess", + "Ġmicro RNAs", + "eff ectiveness", + "ĠDifferenti ation", + "Ġcer tif", + "c ience", + "ĠRE L", + "Ġread out", + "ĠQu asi", + "Ġround ed", + "ot ti", + "e fficients", + "Ġsynchron ized", + "Ġsil ico", + "Ġfore casts", + "Ġd μ", + "Ġex otic", + "ĠO CT", + "x b", + "Ġas ynchronous", + "ne z", + "chi at", + "Ġha emat", + "Ġfulf ill", + "ĠM ix", + "ib li", + "f m", + "Ġj ava", + "sol uble", + "Ġincomp ressible", + "âĨ ij", + "CD M", + "Ġdil ation", + "L YP", + "as hes", + "ĠS ports", + "Ġfund ament", + "ĠSa udi", + "Ġen roll", + "ĠNa OH", + "Ġcrust al", + "ĠInstr uments", + "Ġïģ ¡", + "Res ult", + "Ġpref erential", + "Ġsug ars", + "Ġdim ers", + "ĠEmerg ing", + "è re", + "diab etic", + "Ġstrengthen ing", + "ep i", + "ĠM eg", + "ĠY our", + "ĠSet ting", + "le z", + "ĠB ou", + "Ġhist ology", + "Ġol ive", + "ĠDis orders", + "Ġdistor ted", + "Ġcompet e", + "c ens", + "ĠA e", + "ĠG G", + "Ġquantif ying", + "Ġa ur", + "ĠW right", + "Ġsuperconduc tor", + "ed s", + "st alk", + "con cent", + "ĠLim ited", + "Ġst yles", + "des ign", + "ĠE llip", + "PL A", + "mog orov", + "ĠR idge", + "Ġrandom ization", + "a ft", + "ic ially", + "ĠBi otechnology", + "Ġseiz ure", + "K I", + "AV E", + "re ceptor", + "Ġgram mar", + "Ġcr ime", + "n ection", + "in ces", + "ĠCom pton", + "Ġventric le", + "Ġred istribution", + "yn aptic", + "Par ameter", + "N ormal", + "P ack", + "erm ann", + "ul ants", + "de generate", + "ĠNewton ian", + "Ġancest ral", + "ph rag", + "Ġimp ression", + "Ġnormal ize", + "Ġambig uous", + "Ġingredi ent", + "ĠCl aim", + "Ġcle aved", + "ĠAppro aches", + "ĠS PECT", + "cs v", + "ĠReve als", + "ĠW aves", + "Ġdwar fs", + "ĠProg ress", + "Ġa orta", + "Ġn ig", + "ĠAd ams", + "ĠM üller", + "ĠY ellow", + "ĠC ord", + "ĠPh ill", + "ĠF ormal", + "bes gue", + "ter min", + "r n", + "b n", + "k ine", + "r it", + "q i", + "ĠRout e", + "en ol", + "ĠA SC", + "ĠP u", + "m ill", + "um er", + "Ġsuper nova", + "i ative", + "diff erenti", + "Ġto lu", + "op us", + "R M", + "Ġpo verty", + "ĠX X", + "ĠïĤ ¶", + "ult ry", + "Op tim", + "Ġgl acial", + "ĠDis pers", + "Ġdifferenti ating", + "á ndez", + "pro ject", + "ĠEl iz", + "scal ing", + "ĠT oll", + "Ġnon empty", + "Ġpredic ate", + "Ġgyr us", + "min ute", + "â ĸ", + "ĠH ind", + "ĠL iving", + "V S", + "pri or", + "ĠVer tical", + "ark s", + "ĠS FR", + "ĠViet nam", + "comp are", + ">> >", + "Ġb anks", + "Ġse ptic", + "ĠB if", + "ĠE PS", + "ĠInt el", + "ĠDis order", + "P N", + "ĠN ord", + "tiv eness", + "Ġdr illing", + "ĠSub ject", + "enari o", + "Ġr ms", + "ph ones", + "h ang", + "ĠTechn ique", + "Ġcl ot", + "Ġinters ections", + "Ġan ions", + "ab ove", + "Ġcl ause", + "Ġgen u", + "oz o", + "rh iz", + "Ġlob es", + "ĠB ian", + "Ġexer ted", + "ure th", + "rom a", + "ĠCh arge", + "ĠSyn chron", + "Ġcont ing", + "othe rapeutic", + "gtr sim", + "ĠReson ance", + "ĠF al", + "und le", + "Ġdrop out", + "ĠPers pective", + "OL OG", + "at ches", + "ĠSequ ences", + "Cons idering", + "Ġprosp ects", + "Ġal iqu", + "Ġstr ata", + "Ġanalog s", + "Ġencour aged", + "ĠP ulmonary", + "Ġch im", + "ĠC FT", + "un ar", + "iz z", + "end ocrine", + "ĠC RE", + "ĠSt roke", + "âĩ Ĵ", + "up uncture", + "trans lational", + "ĠGr iff", + "ĠS ter", + "erg ed", + "ph rine", + "Ġl ivestock", + "ĠH ash", + "Ġdos ing", + "Ġplas mas", + "ĠCompar isons", + "Ġencour aging", + "Ġcompar atively", + "Ġcharacter isation", + "Ġasc ending", + "ĠF ixed", + "Ġveget able", + "es pecially", + "ĠL ange", + "ĠC oding", + "Ġverteb rate", + "F W", + "ĠOR F", + "ĠT ub", + "le e", + "Ġtim ely", + "E p", + "ĠâĪĴ âĪŀ", + "Ġlip osomes", + "Ġextrem al", + "ropol itan", + "ĠC ay", + "ĠB iod", + "o ulli", + "D ri", + "ĠR ats", + "Ġcent roid", + "osp in", + "rosp inal", + "Ġsol itons", + "por tive", + "ĠMc G", + "B bb", + "Ġpar affin", + "lec tively", + "Ġmetast able", + "Ġdissip ative", + "Ġassembl ages", + "Ġcol onic", + "Ġs ized", + "Ġcr yp", + "process or", + "ç ão", + "Ġacknowled ged", + "ĠUncertain ty", + "ĠInd ustrial", + "Ġunc ont", + "Ġref ere", + "ĠN itrogen", + "Ġlif ting", + "Ġfor get", + "Ġfeel ings", + "Ġdig its", + "Ġstrat ig", + "yp es", + "Ġcomposition al", + "Ġsupernat ants", + "Ġconflic ting", + "Ġdisadvant age", + "adel phia", + "P d", + "ĠC oupling", + "Ġexpendit ure", + "ik i", + "des cribed", + "ĠRN ase", + "ĠCon vex", + "ĠB ax", + "ung sten", + "Ġbo iling", + "Ġbas ement", + "ocardi al", + "hist ory", + "int on", + "trim ethyl", + "Ġgraft ing", + "ĠHard y", + "ĠFem ale", + "ĠF ollow", + "ĠE ST", + "tis tic", + "O pen", + "Ġref lux", + "ele ments", + "Ġpol ysaccharide", + "dim s", + "ac ency", + "Ġbi ore", + "cap ac", + "Ġoverex pressed", + "e ither", + "Ġl aid", + "Ġinc ision", + "Ġass ets", + "inf lammation", + "Ġreconstruc tions", + "Ġglomer ular", + "Ġcon vey", + "ĠCX CR", + "or o", + "Ġclass ifying", + "Ġcop e", + "Ġp d", + "lin ic", + "Ġch ord", + "ĠAg ing", + "Ġpal m", + "Ġpermit tivity", + "ĠRever se", + "Ġoff shore", + "Ġdoub t", + "im oto", + "ĠCol omb", + "Ġrod ent", + "ĠElect rochemical", + "ĠImpro vement", + "ines cent", + "ĠTr iton", + "Ġtransf usion", + "Ġlocom otion", + "Ġdanger ous", + "Ġwe ighed", + "ĠH SV", + "t echn", + "ĠDi agram", + "Ġpari etal", + "s ix", + "Ġtit les", + "yl on", + "Ġheur istics", + "Ġj aponic", + "Ġtransl ations", + "Ġtit ers", + "Ġw orms", + "ĠD PP", + "Ġcytos keleton", + "Medi ated", + "ari ance", + "the l", + "à ħ", + "ĠInf lammatory", + "Ġoscill ating", + "Ġavoid s", + "Def ine", + "ĠOlymp ics", + "og el", + "Ġhe me", + "Ġmic rop", + "Ġthreat s", + "Q CD", + "X RD", + "ĠC oupled", + "Ġl m", + "ĠHel ic", + "Ġdischarg ed", + "Ġro oted", + "Ġallevi ate", + "Ġcaus ality", + "ĠC row", + "ĠM ack", + "ĠAir port", + "Ġchem okine", + "Ġl l", + "ĠN ar", + "omy ces", + "eth oxyphenyl", + "ĠD aily", + "ĠFin land", + "Ġh orn", + "ĠO rient", + "Ġion ized", + "ĠY ears", + "Ġquas ipar", + "Ġper cutaneous", + "Ph ase", + "Ġfore ground", + "ĠA NAL", + "Ġincre ments", + "st an", + "Ġspec ulate", + "T X", + "Ġp ile", + "Ġd ic", + "ip y", + "wind ow", + "neut ral", + "ĠAtl as", + "ĠM TT", + "ĠN y", + "ĠV III", + "ĠFil ms", + "sing ular", + "rem ove", + "L ength", + "ĠRec e", + "wa it", + "Ġpurch ase", + "ĠWik ipedia", + "ĠL ars", + "Ġsynt actic", + "Ġactu ator", + "ĠAK T", + "ĠB ry", + "ĠRes ult", + "ĠVari ational", + "Ġjudg ment", + "J ECT", + "xim ab", + "Ġtrac ed", + "Ġcardiomy opathy", + "W N", + "ĠRod rig", + "b t", + "Ġb id", + "ac le", + "am ura", + "Ġep ic", + "Ġp uzz", + "ĠS ox", + "Ġinflu x", + "ÃŃ n", + "ulos keletal", + "D im", + "ĠS CC", + "ĠR AS", + "m r", + "U I", + "Ġj un", + "ĠSp earman", + "Ġfair ness", + "et z", + "ĠP PI", + "in ance", + "en ko", + "Ġgal act", + "ö m", + "Ġex ceptions", + "ĠC retaceous", + "M Y", + "Res p", + "Ġp ep", + "ĠOr d", + "ST E", + "Ġhel icity", + "Ġoffic er", + "T arget", + "ĠNor wegian", + "Ġdehyd ration", + "ĠSIR T", + "ĠRob inson", + "ĠBen chmark", + "v iral", + "Re al", + "Ġd oxorubicin", + "Ġestim ations", + "ĠCa uc", + "Ġaddi tives", + "m odes", + "ĠH end", + "Ġacceler ating", + "ĠG ordon", + "ĠMagn et", + "Ġgon ad", + "Ġpyro lysis", + "coh olic", + "ĠPK C", + "S AR", + "Ġw inding", + "ter ious", + "ĠMountain s", + "ĠS ymbol", + "ĠMat the", + "ĠSh in", + "S cript", + "r ug", + "Ġm W", + "ĠI SM", + "ĠN g", + "Ġapp oint", + "ĠA IDS", + "Ġpor ts", + "diff erential", + "ĠJ es", + "ĠN eed", + "Ġlens es", + "ĠAMP K", + "à ¤", + "le af", + "ĠB ron", + "Ġprof it", + "L ocal", + "ĠEx amination", + "ĠCh ief", + "Ġopin ions", + "ĠR ound", + "form ations", + "Ġcol linear", + "Ġdig ested", + "lass ical", + "erv ative", + "Ġce phal", + "Ġdisadvant ages", + "Ġïĥ ·", + "Ġsubt racting", + "Ġwe igh", + "B ound", + "D G", + "Ġinflu ential", + "Ġtox ins", + "ĠBen jamin", + "ĠNum bers", + "c rystal", + "Ġst ocks", + "ĠB our", + "ĠComp eting", + "Ġac qu", + "t RNA", + "ĠSep aration", + "Ġtag ged", + "Ġcon ject", + "ĠPr ince", + "Ġgra zing", + "Ġrele ases", + "ĠChall enge", + "ATP ase", + "Ġe mail", + "ins ically", + "ĠReg ulatory", + "M essage", + "Ġsl it", + "Ġpolyg on", + "Ġdoubl ing", + "Ġrece ivers", + "Ġtrack ed", + "Ġengine er", + "st ained", + "ĠD anish", + "sh ock", + "ĠM az", + "Ġco ugh", + "ĠImmun ohist", + "C onsequ", + "arm acy", + "Ġchem o", + "ĠM H", + "Ġemerg es", + "Ġanne aled", + "Ġhypot hesize", + "ĠTyp ically", + "ĠB ang", + "ĠP uls", + "Ġgir l", + "Ġherb iv", + "ĠAN N", + "Ġse ism", + "ĠCy tok", + "ĠThrough out", + "Ġadapt ations", + "l ang", + "Ġcl onal", + "um ulation", + "ĠUn iform", + "Ġh i", + "op ent", + "Ġbut ton", + "ten e", + "Ġprote asome", + "b red", + "ĠN elson", + "racycl ine", + "ĠD Y", + "Ġimmun oblot", + "pro l", + "Ġp ic", + "Ġcomp ilation", + "ĠDev ices", + "eterm ined", + "ĠFranc is", + "not ation", + "wr iting", + "ter ase", + "ĠSte phen", + "am el", + "ĠCh u", + "al one", + "Ġexha ust", + "re levant", + "ĠStr at", + "Ġparametri zation", + "ĠB ull", + "ĠRem ote", + "incre asing", + "Ġd d", + "âĢ °", + "yroid ism", + "il in", + "ĠH ip", + "IC A", + "ĠAp optosis", + "Ġmach ining", + "LD L", + "Ġg em", + "ĠF FT", + "ĠGu ang", + "Ġorigin ates", + "d at", + "c one", + "ĠAd oles", + "uc ci", + "av oid", + "ul pt", + "ur ium", + "Ġliter acy", + "Rec ent", + "av g", + "Ġinv ited", + "ĠPe ak", + "ĠEnter obacter", + "Ġaneurys m", + "ĠMor ris", + "ti da", + "ĠS ER", + "ĠMic hel", + "ĠI BD", + "ĠN G", + "Ġscar ce", + "we b", + "Ġexpress es", + "Ġsc hema", + "Ġless ons", + "Ġarg inine", + "Ġphot ographs", + "ĠNe urons", + "ĠATP ase", + "Ġf iller", + "rap ped", + "Ġrandom ness", + "Ġve ins", + "Ġwound s", + "ĠA part", + "Ġr acial", + "Ġnot eworthy", + "Ġremov es", + "Ġgangl ion", + "Ġlamin ar", + "ĠS SR", + "Ġpol ysaccharides", + "Ġbu f", + "Ġendot helium", + "ĠC AS", + "ĠGol gi", + "Ġinher itance", + "is ite", + "CO MP", + "Ġp t", + "Ġmes hes", + "Ġtherap eutics", + "O ST", + "olin ergic", + "U G", + "squ ared", + "Ġdeg rade", + "u um", + "Ġret rosp", + "L oc", + "ĠJ NK", + "O ptions", + "Ġins ulating", + "Ġspec ifies", + "Ġo ven", + "y y", + "ĠCon ver", + "Ġdisapp eared", + "ĠProgn ostic", + "ĠNgu yen", + "Ġperipher y", + "b ank", + "Ġim id", + "Ġassign ing", + "ĠM ess", + "prop an", + "i oma", + "oly b", + "Ġepit ope", + "Ġemit ting", + "D IR", + "yn c", + "Ġimpair ments", + "ĠMic roscopy", + "ĠFW HM", + "g ray", + "Ġf ing", + "uc ial", + "plement ed", + "e as", + "est amp", + "Ġcre st", + "ĠM os", + "Ġneut rons", + "Ġbro th", + "Ġhead ache", + "onge vity", + "Ġre ass", + "ĠP SF", + "ĠB uch", + "vis or", + "Ġden oting", + "in teger", + "ou in", + "eff icacy", + "Ġglut amine", + "Ġpick ed", + "ĠCamp bell", + "ĠK ernel", + "Ġsh ips", + "l t", + "ond yl", + "Ġcre di", + "Ġpepti d", + "ĠEst abl", + "b ons", + "Ġag gl", + "US E", + "sup p", + "ups ilon", + "character ized", + "ishe ries", + "M ay", + "AR C", + "Ġro ads", + "Ġdepar ture", + "ĠMA X", + "ĠT RA", + "im od", + "ĠAl ber", + "Ġterm inated", + "öl der", + "S calar", + "h ash", + "ĠM SS", + "Ġsmooth ness", + "Ġres emble", + "ĠEff ectiveness", + "r x", + "ĠE ye", + "Ġfa ecal", + "à ¾", + "ĠClostr idium", + "ach ine", + "ĠBD NF", + "Ġc ab", + "ĠW ong", + "ĠDoug las", + "Ġre perfusion", + "ĠX i", + "Ġconf used", + "ĠPhil adelphia", + "Ġap ple", + "Ġi le", + "Ġfav ored", + "Ġpl aques", + "Ġtri vially", + "ĠTyp ical", + "Ġcentral ized", + "ĠFace book", + "Ġnorthe ast", + "Ġnorm ality", + "ĠT b", + "Ġap t", + "Ġfac et", + "ĠRen al", + "cl k", + "Ġlig ation", + "iff erenti", + "Ġput ting", + "Ġintr ig", + "w alled", + "E t", + "ĠC ow", + "ĠN ations", + "Ġcamp us", + "ĠKine tics", + "ĠMex ican", + "ER K", + "Ġlat itudes", + "ĠR oll", + "ĠQ D", + "adap tive", + "Ġquenc hed", + "Ġf ram", + "Q i", + "Ġt ongue", + "ed es", + "Ġasc orb", + "ĠGluc ose", + "our i", + "Ġdef eated", + "ophil us", + "ral ateral", + "x rightarrow", + "ĠJ up", + "ax es", + "eg er", + "MI T", + "ĠM ember", + "ĠN u", + "Ġtransl oc", + "ĠFlu x", + "ĠColor ado", + "Ġre lying", + "at rol", + "Ġcontras ts", + "cent age", + "Ġleuk ocyte", + "Ġcoinc idence", + "Ġcontrac tions", + "og a", + "AN N", + "ĠAbs orption", + "Ret urn", + "rep rene", + "ba um", + "tra umatic", + "inc ial", + "Ġaut ophag", + "Ġalgorithm ic", + "rim p", + "Ġdiv ides", + "ĠR ose", + "ĠE ric", + "Ġadd iction", + "pl ification", + "Ġdiff usive", + "ĠVehic le", + "en erate", + "ti sing", + "Ġstar vation", + "abs orption", + "ĠA ra", + "Ġgra v", + "ĠSub unit", + "Ġam ide", + "Ġenh ancer", + "Ġmer id", + "erm ost", + "Ġal gal", + "ĠQue ens", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠ", + "Ġjud ge", + "ĠGreen land", + "b race", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "Ġhyper gly", + "Ġemerg ent", + "F isher", + "ĠL as", + "Ġsex es", + "S ep", + "Ġph rases", + "ĠSequ ential", + "ink i", + "Ġaxi oms", + "stud y", + "Ġt iny", + "Ġc d", + "cataly zed", + "as aki", + "ĠW R", + "ĠMin imal", + "Ġsub cellular", + "Ġphosph o", + "ES I", + "Ġv ow", + "Ġsup plies", + "oper and", + "F ix", + "an ian", + "wr iter", + "âĪ ¶", + "Ġwin ner", + "ĠP ID", + "ĠLe besgue", + "Ġsimpl ification", + "ĠRelationship s", + "Ġautom ata", + "ĠCont ribution", + "Ġhered itary", + "err in", + "ĠB LAST", + "ae a", + "yle th", + "ĠT c", + "ade h", + "adj uvant", + "W ave", + "c ounter", + "ĠG upta", + "ĠG hana", + "C ho", + "Ġour selves", + "Ġeven ly", + "lym ph", + "Ġcereb ellum", + "Ġcopol ymers", + "mod ular", + "Ġhard er", + "Ġp lease", + "ĠP SD", + "Ġlim bs", + "Ġexplo itation", + "ir y", + "Ġperiodon tal", + "AT CH", + "Ġmal icious", + "ĠSl ov", + "H Y", + "Consequ ently", + "ore n", + "ĠP are", + "ag ine", + "ĠRO I", + "ĠWh ich", + "ĠN ative", + "am en", + "resh ape", + "opl ankton", + "Ġartif act", + "Ġrh in", + "g pu", + "Ġund et", + "Ġspor adic", + "Ġor ally", + "Ġstep wise", + "ĠCoh ort", + "Ġr hod", + "c yt", + "Ġi err", + "Ġmot ors", + "ĠIg E", + "calc ulated", + "ĠChampionship s", + "p el", + "ĠF err", + "Ġis ometric", + "n utrition", + "Ġuns aturated", + "Ġd oll", + "ĠR MSE", + "Ġsol itary", + "approxim ation", + "Ġreper to", + "s ight", + "Ġc ranial", + "il ical", + "ĠO st", + "o ul", + "Ġd g", + "ĠPro ceed", + "Ġmill ing", + "s z", + "Ġmineral ization", + "Ġcig arette", + "Ġp orph", + "Ġsp ons", + "ĠGre ece", + "ip ore", + "ac cept", + "ĠPT SD", + "Å «", + "Ġc ipher", + "Ġfunctional ized", + "P oly", + "Ġab d", + "fl ight", + "ĠSyd ney", + "Ġdis aster", + "ĠH aving", + "Ġdies el", + "ĠG reg", + "Ġsp ans", + "ĠSe asonal", + "ST EM", + "i err", + "ĠI B", + "Ġle mm", + "an um", + "ĠB ottom", + "Ġse al", + "bo ost", + "Ġleg end", + "b ing", + "ab is", + "Ġch itin", + "Ġmaxim ally", + "Ġimmunosup pressive", + "âĪĴ âĪĴ", + "Ġabol ished", + "ig e", + "Ġes ophag", + "Ġlas ted", + "Ġcarbohyd rates", + "Ġch ips", + "ĠFern and", + "f ar", + "ĠPo ints", + "cal ation", + "ĠReg ions", + "CH K", + "ver atrol", + "tr uth", + "Ġst range", + "Int erest", + "s ho", + "ĠInd uc", + "Ġmig raine", + "ĠV ac", + "op hores", + "Ġerr one", + "scripts ize", + "ĠNeut ron", + "Ġindist inguishable", + "ist ine", + "Ġhel per", + "spec ified", + "Ġju ice", + "ox al", + "ĠJ ung", + "Ġmag azine", + "Ġtele phone", + "ĠPh yt", + "Ġ um", + "ĠAvail ability", + "ĠT ropical", + "ĠC ases", + "Ġdesc end", + "H ar", + "âĪ Ĺ", + "ĠâĨ ĵ", + "K s", + "Ġ ê", + "ol uble", + "Ġch ampionship", + "ĠMove ment", + "ĠX Y", + "kappa B", + "year s", + "m emb", + "qu ine", + "Ġlet ting", + "Ġbig gest", + "Ġc ards", + "Ġbi otin", + "ĠA ur", + "mod al", + "Ġvacc inated", + "Ġtransl ates", + "ĠP AC", + "ll i", + "re onine", + "Ġcur cumin", + "ĠCon struct", + "Ġconv inc", + "ĠN at", + "Ġam ygdala", + "Ġprot r", + "ĠSing ular", + "ĠCont act", + "k ind", + "ĠD aw", + "og roup", + "ĠK Cl", + "Ġhy gi", + "eren ced", + "Ġsurvey ed", + "ĠM ull", + "est hetic", + "Ġms g", + "ĠRe quire", + "Ġdistor tions", + "Cont rol", + "B ERT", + "Ġaut onomic", + "Ġhorm onal", + "Ġstri ps", + "Ġt rophic", + "if ting", + "op od", + "ĠSp ontaneous", + "Ġlog s", + "O PT", + "ĠM ot", + "ĠG mb", + "ah aran", + "ĠP OL", + "Ġvis ceral", + "bl ocks", + "Ġsit ting", + "Ġs ine", + "Ġonc ogenic", + "ERR Q", + "quin one", + "Ġsmart phone", + "ĠTan z", + "lact am", + "ĠSignific ance", + "Ġe u", + "ĠI SS", + "ĠTr ig", + "ĠM aj", + "ting ale", + "Ġdil at", + "enn es", + "ĠBelg ium", + "le v", + "ĠCon tr", + "ĠGal ois", + "ĠComb ination", + "ĠTh i", + "ĠAust ria", + "P rom", + "Ġelic it", + "bi osis", + "Ġlymph atic", + "ĠMur ray", + "ĠX PS", + "Ġcon g", + "sc reen", + "ti de", + "am oyl", + "ĠMc D", + "Ġreti red", + "m ixed", + "EL D", + "ĠM aps", + "ĠV E", + "cess ion", + "num er", + "id ated", + "ĠB ishop", + "Ġneon ates", + "Ġlands l", + "ĠFrac tional", + "Ġspec ifying", + "ĠJ r", + "Ġnanow ire", + "Ġconsult ation", + "l anguage", + "Ġp ricing", + "ĠLimit ations", + "ĠP ediatric", + "ĠD imension", + "Ġprepar ing", + "L ag", + "seg ment", + "Ġsp end", + "at he", + "Ġwe ap", + "ĠJ os", + "tex tit", + "output s", + "ord ering", + "Ġplac enta", + "ation ally", + "ĠK un", + "Ġout standing", + "Ġthickness es", + "ĠCh IP", + "de oxy", + "ĠZ o", + "ĠDevelop ing", + "Ġstring ent", + "i ency", + "per se", + "Ġp end", + "ĠDevelopment al", + "Ġex tern", + "Ġinver ter", + "ĠD API", + "lec tivity", + "Ġtable ts", + "Ġprog ester", + "Ġïģ Ń", + "Ġansw ered", + "ent ary", + "OR S", + "Ġd ir", + "Ġdele terious", + "Ġdop aminergic", + "R andom", + "dis s", + "Ġmonol ayers", + "Ġinteg rand", + "ĠComp onents", + "ĠP erc", + "ag it", + "AR N", + "es ophageal", + "iv an", + "ne ider", + "ĠStar ting", + "P ORT", + "y ellow", + "Ġreg isters", + "pair s", + "Ġethn icity", + "Ġb oy", + "au ti", + "Ġchrom ium", + "P OS", + "v ature", + "ay ashi", + "Ġin appropriate", + "ĠS NA", + "D omain", + "ĠP rice", + "Ġmac ular", + "Ġover load", + "ĠUn ified", + "Ġatt ach", + "ĠScot tish", + "m aps", + "ag l", + "em i", + "Ġse am", + "ĠAnal og", + "d ated", + "u o", + "Ġpl ated", + "Ġass et", + "Ġsc reens", + "Ġspur ious", + "B esides", + "Ġbas elines", + "head s", + "Ġco at", + "ĠRem oval", + "Ġinfinites imal", + "ĠTrans formation", + "Ġcomm ens", + "Flo at", + "A UC", + "ĠL ay", + "Ġint ron", + "ĠDet ecting", + "ĠHere in", + "ĠAssoci ations", + "Ġprogester one", + "B acteria", + "Ġs entiment", + "ĠPhen omen", + "m atter", + "Ġcylind ers", + "Ġtolu ene", + "Ġspati otemporal", + "Ġland ing", + "ĠCoron avirus", + "ĠBer ry", + "ĠB ragg", + "Ġreg istry", + "Ġenthal py", + "tic a", + "raz ine", + "Ġc argo", + "ot ation", + "Ġcontrad icts", + "Ġpestic ides", + "ĠF ischer", + "Ġmechan ically", + "ĠInter fer", + "ĠC yp", + "ĠK as", + "Ġmet res", + "Ġanti retroviral", + "Ġtra vers", + "se lection", + "ĠW A", + "Ġdouble t", + "m eta", + "EN TR", + "son ic", + "Ġmark ing", + "ĠO verex", + "Ġpy ruvate", + "Ġextr usion", + "Ġin gestion", + "Ġcoc aine", + "ĠF ellow", + "CN Ts", + "B G", + "ĠMorph ological", + "Ġdef ence", + "ĠY osh", + "mit ter", + "rystall ization", + "STR ACT", + "Ġinflamm asome", + "ĠG d", + "Ġsh aft", + "Ġerup tion", + "ĠOx ide", + "if olds", + "ĠG am", + "ĠG ap", + "com mand", + "ĠIg A", + "Ġshorten ing", + "assemb led", + "is opropyl", + "Ġal umina", + "ĠAT M", + "Ġc t", + "Ġspin ning", + "ĠPet sc", + "pref ix", + "Ġperpet uity", + "P RE", + "Ġfr uct", + "G Hz", + "el ike", + "en yl", + "Ġwhere in", + "U K", + "vis ual", + "lipid emia", + "re duction", + "an in", + "ol as", + "Ġam plic", + "ĠS AT", + "Ġmod ulator", + "for th", + "r l", + "Ġcre w", + "Ġi P", + "Ġx i", + "AD D", + "ĠAlex and", + "const rained", + "r atory", + "Ġk W", + "ĠMD R", + "Ġlnc RNA", + "M ill", + "ĠMg O", + "circ uit", + "Ġpersonal ized", + "ĠOper ator", + "st ock", + "ĠP SA", + "ens able", + "Ġle an", + "y ield", + "Ġop acity", + "ĠComm ons", + "Ġsum med", + "uck er", + "ec ke", + "ep ithelial", + "Ġas king", + "ues e", + "ĠFl av", + "Ġl actic", + "Ġl ubric", + "Ġis n", + "reg ions", + "sup port", + "Bel ow", + "ĠN om", + "Ġhy al", + "ik h", + "b an", + "ĠB G", + "rom eter", + "ind ic", + "oph aryngeal", + "IT ION", + "ĠProp agation", + "ĠPl ace", + "ĠCirc uit", + "ĠCO L", + "G reen", + "I r", + "l av", + "Ġd S", + "ĠM oment", + "Ġinduc ible", + "Ġdischarg es", + "hab di", + "ĠExper ience", + "Ġs g", + "Ġout ward", + "Ġport able", + "ĠOper ators", + "A v", + "ĠD Q", + "ost atin", + "Ġeosin ophil", + "Ġstri atum", + "ĠCons ensus", + "Ġim perfect", + "NO T", + "ĠDem ocratic", + "; ;", + "B ody", + "di i", + "H o", + "ĠRail way", + "ĠUg anda", + "Ġunp aired", + "friend ly", + "Ġrepro gramming", + "Altern ative", + "R G", + "im et", + "ene z", + "ĠHyp othesis", + "Ġt on", + "ĠCom bin", + "ĠDel ivery", + "L ast", + "Ġown ers", + "raz ole", + "ĠK ob", + "Ġform ats", + "Ġpoly clonal", + "Ġidentif ier", + "IL L", + "Ġsurge on", + "Ġpost p", + "ĠGener ative", + "ĠM all", + "ab c", + "ĠH az", + "Ġsmooth ly", + "Ġcrystall ographic", + "ĠF DA", + "Ġcoex istence", + "ion ized", + "Ġcomp iler", + "ĠAr ter", + "Ġappear ances", + "amilton ian", + "Ġencaps ulated", + "ati a", + "w i", + "re b", + "Ġwa fer", + "ub s", + "ĠU E", + "ĠGS K", + "Ġv iv", + "Ġflood ing", + "ĠG yr", + "Ġst ably", + "Ġdis locations", + "Ġes cap", + "ĠPhys iological", + "tid al", + "ym e", + "ĠMax im", + "iter ator", + "ord ant", + "Ġatten tional", + "Ġcataly zed", + "ĠTr yp", + "P IN", + "ĠCor relations", + "Ġhyd rological", + "Ġn ose", + "ex port", + "Ġde xt", + "ĠBen ef", + "ĠBios ystems", + "ĠP ars", + "Ġread ings", + "Ġinstrument ation", + "ĠI Q", + "R IC", + "Ġgra fts", + "over s", + "ĠMed ic", + "Ġmon od", + "Ġuniform ity", + "ĠAT LAS", + "Ġmask ed", + "R i", + "ĠPhys ic", + "Ġim posing", + "ĠPar ad", + "ime tic", + "Ġdemand ing", + "un ks", + "Ġfol ds", + "ĠAn c", + "Ġvol atility", + "Ġbring ing", + "ac il", + "ĠN MDA", + "re duced", + "ti i", + "Ġnorth west", + "ĠB essel", + "ven tions", + "Ġconsol idation", + "Me ier", + "Ġmicro f", + "Ġqual ified", + "Ġins ignificant", + "ĠMorph ology", + "Ġpoint wise", + "Ġlear ns", + "Ġgu ard", + "CH ECK", + "phon on", + "ĠEnhance ment", + "Ġz onal", + "ER G", + "St art", + "Ġhistor ic", + "ĠP ure", + "ĠGmb H", + "g lu", + "Ġpattern ing", + "Ġstic k", + "umin osity", + "D ataset", + "Ġover ride", + "ĠSte el", + "Ġfu els", + "m echanical", + "Ġaut ologous", + "Ġdepart ments", + "ĠB lo", + "Ġim ported", + "Ġrestric tive", + "e igen", + "ĠR ome", + "ĠÌ Ĭ", + "Ġepit opes", + "Ġlab elling", + "Ġown ership", + "ĠE specially", + "Ġco ffee", + "ĠGR B", + "H ead", + "ĠV ent", + "es are", + "ĠPar ticles", + "UN CTION", + "j j", + "u ents", + "el ic", + "ĠT at", + "ĠF le", + "Ġg ating", + "Ġref uge", + "Ad ditionally", + "Ġrh s", + "Ġmay be", + "ĠF ang", + "Ġad vent", + "otransfer ase", + "sh ould", + "Ġprote omic", + "Ġleg itim", + "PER IM", + "ĠG iant", + "Ġgraph ics", + "onom ical", + "sc atter", + "Ġsugges tive", + "pl ots", + "Ġmulti drug", + "Ġabsor ber", + "X S", + "cons uming", + "Ġsustain ability", + "op re", + "f ix", + "Ġvol cano", + "ĠTyp es", + "ĠCre ate", + "Ġcho oses", + "Ġstir ring", + "Ġsurge ons", + "d S", + "Ġcharacter izes", + "Ġadjust ments", + "text tt", + "et ra", + "Ġclass ifications", + "sp ots", + "ĠâĻ ¯", + "ere x", + "de hyd", + "ĠBr ig", + "ĠSuper conduc", + "Ġgran ts", + "ĠC en", + "ĠY in", + "ĠRe actions", + "des cription", + "trans cription", + "import ant", + "Ġhemod ynamic", + "ĠY i", + "ĠGold en", + "k k", + "al b", + "Ġro oms", + "Ġseg reg", + "Ġsumm ing", + "Ġsuccess ion", + "Ġfollic ular", + "Ġtack le", + "D own", + "Ġevalu ates", + "atic a", + "ann ual", + "ĠAl bert", + "Ġt al", + "orb ital", + "f ted", + "vari ables", + "Ġwet land", + "outhe astern", + "M EM", + "ĠBr ill", + "ĠS odium", + "ĠAlex a", + "um ed", + "BU G", + "ar ine", + "Ġre venue", + "habdi tis", + "Ġdiss ol", + "am plitude", + "Ġar tists", + "Ġnormal ised", + "Ġfluct uating", + "Ġas par", + "ĠF i", + "ol ates", + "isp anic", + "Ġacet ylation", + "ĠConcent ration", + "Ġth ro", + "sh ots", + "Ġnarr ative", + "ĠWa als", + "am monium", + "ure au", + "-------- ----", + "Ġresearc hes", + "Ġbab y", + "Ġshar ply", + "Ù Ħ", + "ĠC el", + "C X", + "um inal", + "Ġgerm line", + "ĠTransform er", + "p seud", + "H G", + "K a", + "ĠS MC", + "ĠN utrition", + "Ġb arc", + "ĠW rite", + "Ġprote ases", + "Ġswe ep", + "ĠKol mogorov", + "m orph", + "in ducible", + "Ġexc iting", + "le in", + "ĠH ass", + "Ġproduc tive", + "mes h", + "ĠC MS", + "Ġhe avier", + "Ġmeet ings", + "ĠCop per", + "Ġvirt ue", + "as ant", + "ĠD EN", + "Ġinherent ly", + "ri o", + "Ġhous ed", + "Ġintra operative", + "Ġc rown", + "con ditions", + "AN G", + "YS IS", + "im an", + "Ġnm ol", + "ĠRetrie val", + "al gae", + "Ġk appa", + "de ep", + "in ence", + "ĠC arcinoma", + "Ġchromat ographic", + "Ġas cribed", + "Ġle verage", + "ĠK K", + "omy el", + "p et", + "ĠN J", + "com m", + "Ġann ually", + "g ran", + "Ġa val", + "ĠN ish", + "Ġev ac", + "Ġmulti f", + "Ġfund s", + "enn y", + "ĠM ong", + "ĠEx ception", + "path s", + "ym en", + "h pp", + "Ġrestric ting", + "s aturated", + "â Ļ", + "Ġlear ners", + "ĠLank a", + "in ities", + "ĠG DP", + "Ġspec iation", + "Ġens ured", + "Ġneutral izing", + "Ġball oon", + "Compar ison", + "ĠCal ibration", + "ĠInflu enza", + "Ġvap our", + "X A", + "t racking", + "ĠI CD", + "fluor o", + "ĠDam age", + "Ġp ra", + "Ġcon ceived", + "ĠCosm ological", + "Ġlo ose", + "inos itol", + "ĠCliff ord", + "ow a", + "Ġoffset s", + "doc ument", + "Ġenorm ous", + "Ġphoto electron", + "rec ord", + "estic ular", + "Ġvoc als", + "Ġconscious ness", + "Ġtre m", + "Ġlandsc apes", + "ĠFund amental", + "teb rate", + "Ġverteb ral", + "Ġregener ative", + "Ġtro posp", + "In tegr", + "Ġassoci ates", + "ov ed", + "uss ed", + "aw s", + "ĠS ide", + "Ġinter connected", + "Ġsuper family", + "ĠCo ok", + "load er", + "Ġpy thon", + "ĠC ounter", + "bo oks", + "Ġïģ ²", + "bre aking", + "g y", + "Ġcar box", + "Ġed ited", + "otyp ed", + "Ġdu oden", + "an ne", + "Ġan astom", + "gin ate", + "ĠBios ciences", + "ra ge", + "ĠCh iral", + "Ġsimpl ifies", + "Ġtes tis", + "str öm", + "ial s", + "Ġmic elles", + "cor rect", + "ĠGene tics", + "al ong", + "R em", + "res istance", + "Ġdr ink", + "orb ed", + "ĠT reat", + "ĠS ho", + "sh ows", + "é r", + "Ġmim ics", + "occ up", + "ec lam", + "ON G", + "Ġmark eting", + "ĠF inding", + "Ġendomet ri", + "âĶ Ģ", + "st rained", + "ĠM uch", + "Ġex ons", + "ĠH il", + "T D", + "ĠW W", + "ĠV ic", + "end a", + "Ġfact ory", + "ĠHep G", + "ĠSt atic", + "blast oma", + "w d", + "ra isal", + "ĠB asis", + "In s", + "ĠUn supervised", + "el o", + "ose lective", + "Ġaccompl ish", + "ĠP rospective", + "Ġuncor related", + "ĠG ate", + "icy cl", + "Ġur gent", + "ĠPath ways", + "Ġobl ique", + "ĠIndividual s", + "Ġiniti ative", + "Ġcat ast", + "j ections", + "Ġaut osomal", + "ĠPhil ip", + "Ġcomprehens ion", + "m M", + "p ain", + "Ġmicro M", + "Ġenc ounters", + "g oto", + "Ġl adder", + "Ġoccup y", + "ĠSur faces", + "D oc", + "ug by", + "Ġexam ines", + "os ynthesis", + "ĠK EGG", + "gl ass", + "sl ice", + "prop agation", + "str y", + "Ġillustr ating", + "im i", + "Ġsp ores", + "Ġast rophysical", + "Ġen closed", + "Ġinf erences", + "Ġbi jection", + "Ġever yday", + "Ġaltern atively", + "re action", + "ian ts", + "cont act", + "Ġg ing", + "ĠBi as", + "Ġautom aton", + "back ground", + "Ġneighbour ing", + "Ġdet ects", + "por ate", + "ĠShar ma", + "H ydro", + "Ġs acc", + "ĠF iber", + "ĠCh lam", + "Ġbuff ers", + "App lying", + "l ceil", + "em ph", + "ĠG SE", + "met ry", + "Ġimmun ost", + "ĠHistor ical", + "ĠD rag", + "Ġtransplant ed", + "Ġf rail", + "Ġanth ocyan", + "in te", + "ĠB hat", + "ĠO g", + "Ġste ering", + "benz ene", + "******************************** ********************************", + "Ġsynt het", + "A ct", + "Ġc in", + "Ġher bal", + "Ġd yn", + "Ġhyper plasia", + "head er", + "Ġcalc ulates", + "ĠDiff erence", + "Ġb ats", + "duc tivity", + "Ġconform ations", + "c ity", + "Ġsepar ates", + "ĠCD C", + "ĠPr ism", + "ĠBehavi our", + "ĠKel ly", + "ĠS ey", + "Ġà ł", + "LE X", + "g kin", + "st rom", + "Ġv om", + "ĠW in", + "ĠW igner", + "Ġcont ralateral", + "ĠMin or", + "Ġstere o", + "ĠApproxim ately", + "L ED", + "s ay", + "ĠJ S", + "Ġalcoh ols", + "Ġs an", + "Ġhard ening", + "IF N", + "Ġretrosp ectively", + "Ġgeneral ised", + "Ġtib ial", + "ĠWe ek", + "Ġar yl", + "ĠPen insula", + "Ġdeterm inations", + "Ġphot ovoltaic", + "Ġsugges tion", + "J ac", + "ĠV itro", + "Ġcycl o", + "Ġfibro us", + "dis ambiguation", + "pro gram", + "Ġgu est", + "ĠD ust", + "r ceil", + "Ġpow ered", + "Ġcardiomy ocytes", + "he at", + "yl ic", + "Ġpresent ations", + "Ġtransmit ting", + "W D", + "add ed", + "In itial", + "D el", + "ĠV elocity", + "Ġmo le", + "Ġo val", + "Ġpl ankton", + "the ir", + "ĠQ ED", + "vol utions", + "Ġmand atory", + "Ġrep ulsive", + "ĉ ĠĠ", + "Ġpost ulated", + "ĠCor tex", + "ĠCar b", + "CHK ERRQ", + "Ġoverl ay", + "ĠF arm", + "enor habditis", + "Ġpos ed", + "Ġinst anti", + "Z T", + "ĠVisual ization", + "ĠGAP DH", + "lec om", + "och ron", + "ĠB j", + "ĠT rib", + "Ġby te", + "Ġsuperim posed", + "Ġund i", + "Ġacceler ator", + "cri ptions", + "ĠSm ooth", + "Ġz ip", + "nes ota", + "ĠE FF", + "ĠC ole", + "ĠB ru", + "re nd", + "ut z", + "Ġdiagn ose", + "b asis", + "di amond", + "ĠIn n", + "ĠMed ian", + "Ġmarg inally", + "Ġlemm as", + "rect omy", + "Ġdial ogue", + "ĠB rid", + "Ġ å", + "ox ane", + "ar is", + "Ġmunicip ality", + "Ġproduc ers", + "Reg arding", + "ĠF V", + "ide al", + "exp onential", + "L abel", + "ĠF robenius", + "Ġe ll", + "ĠL TE", + "Ġlip ase", + "r p", + "Ġd m", + "ot ri", + "cl oud", + "ĠAg ent", + "M SCs", + "os om", + "hyd ropy", + "ne urons", + "Ġsol vable", + "duc ting", + "Ġrend ered", + "Ġattract or", + "Ġb rac", + "à ģ", + "Ġhost ed", + "ĠO ct", + "Ġgu iding", + "Ġdiges tive", + "j s", + "Ġint ent", + "flu x", + "Ġbios ynthetic", + "Ġe lections", + "ĠWil coxon", + "Ġspectrophot ometer", + "Ġimpair s", + "Ġabd omen", + "k b", + "ĠW ho", + "ASS ERT", + "Ġel uted", + "Ġmaxim ization", + "Ġcollect or", + "ĠPrevious ly", + "a q", + "am bo", + "ĠO z", + "C ur", + "Ġcaffe ine", + "M ass", + "p al", + "pi ece", + "ou ville", + "ĠM eyer", + "ut a", + "ch an", + "ĠK S", + "om otor", + "ĠG PR", + "Ġev al", + "ĠCo operative", + "ogly can", + "Ġnozz le", + "ĠS hel", + "Ġinter change", + "Ġunderg rad", + "Ġexplan atory", + "Ġphag ocytosis", + "Ġc tx", + "hes s", + "Ġunivers ality", + "ĠK illing", + "ons in", + "Ġlast ing", + "ĠIm m", + "Ġconc ordance", + "y ma", + "Ġaut umn", + "Ġbar ley", + "Ġconsequ ent", + "is i", + "Ġconjug ates", + "Ġta ught", + "Ġcovari ate", + "Ġadoles cence", + "Ġvill ages", + "Ġeigen functions", + "Ġtempor ally", + "ĠMin nesota", + "y rate", + "ies is", + "def inite", + "Ġalph abet", + "ĠY un", + "ĠM AR", + "Ġse aled", + "ron ectin", + "ĠSep ar", + "n x", + "CA A", + "Ġrece ption", + "uck y", + "ĠPT EN", + "ĠM organ", + "Ġdi odes", + "Ġmet formin", + "Ġsynt hes", + "ĠPar ticip", + "ĠJer sey", + "Ġamph ib", + "c hel", + "Ġl amp", + "ĠH els", + "ĠF N", + "Ġexc av", + "is econd", + "int ro", + "Ġnon commutative", + "Ġsubs ystems", + "sum m", + "Ġcontrast ing", + "ĠSil icon", + "ĠPar tition", + "Glc NAc", + "Ġdisc ern", + "ĠBound s", + "ĠR ah", + "Ġapproxim ating", + "ĠHyper t", + "ĠD il", + "Ġcompact ness", + "Ġca ught", + "ĠImpro ve", + "ĠTor onto", + "ĠBiom ark", + "ĠB ag", + "ĠIn vent", + "Ġelabor ate", + "ĠM ott", + "AB C", + "ĠGra ham", + "Ġpo ultry", + "ĠCon jecture", + "ĠAl gebras", + "ĠN LO", + "ap sing", + "path y", + "ĠEliz abeth", + "ĠT it", + "ĠS CI", + "ant on", + "Ġv oting", + "math rel", + "ĠF ord", + "ig ibility", + "Ġall ergy", + "ac oustic", + "ĠD yn", + "ĠD SC", + "ĠG RO", + "ĠTh irty", + "Ġanalys ing", + "ĠEm pire", + "f ire", + "Ġpath ologic", + "Ġpat ent", + "Ġhe ard", + "ĠF ront", + "isc onsin", + "hy pert", + "uz umab", + "ĠMut ation", + "Ġb iliary", + "Ġsuper fluid", + "ĠW C", + "ust om", + "ĠAc tivities", + "Ġpolyp eptide", + "he ets", + "Ġb orders", + "ear ly", + "Ġorth ogon", + "Ġbul ge", + "ï £", + "Ġcon ical", + "ĠL ept", + "Ġelectroly tes", + "Ġ «", + "reg ulating", + "Ġviol ated", + "â ĺ", + "AL T", + "ĠWork s", + "ĠHep at", + "ur gical", + "ob ar", + "ĠRe active", + "poss ibly", + "ĠAds orption", + "ĠR io", + "ano ic", + "ĠâĨ ij", + "Ġintrig uing", + "Ġo m", + "her tz", + "ĠApproxim ate", + "ĠP arent", + "Ġco in", + "exp and", + "Ð ²", + "Ġnon parametric", + "ex tern", + "ae us", + "gly cerol", + "Ġc p", + "Ġbat ches", + "Ġnanom aterials", + "U se", + "ĠV ivo", + "R h", + "Ġt iles", + "Ġdep ict", + "Ġsouth west", + "ĠCas imir", + "lay ered", + "ĠLe af", + "f em", + "b ered", + "Ġsub algebra", + "Ġdet achment", + "ĠLe uk", + "ol us", + "ĠR ick", + "Ġab ortion", + "Ġclar ified", + "Ġgangl ia", + "Q S", + "o ising", + "ĠFor ward", + "ĠPer ipheral", + "shif ted", + "b ula", + "ram olecular", + "ĠF EM", + "ĠPro ton", + "AM E", + "Ġsched ules", + "Ġa a", + "ĠU DP", + "st ere", + "Ġmorph ine", + "Ġspecial ist", + "ĠAnd roid", + "Id entif", + "Ġun expl", + "Ġheter ozyg", + "Ġf id", + "pyrid yl", + "ĠW y", + "phosph or", + "Ġfriend ly", + "Ġmic rol", + "ĠS plit", + "agn er", + "crib e", + "Ġm oth", + "ĠEu ro", + "ig s", + "ĠCon ditional", + "ĠSte wart", + "pro perties", + "AS C", + "ĠTra ditional", + "ĠPortug al", + "Ġear ned", + "Ġcat he", + "Cre ate", + "ici encies", + "Ġsph ing", + "x ml", + "Ġimmun omod", + "Ġcomm ute", + "Ġselen ium", + "ang es", + "ho ok", + "den oted", + "Ġjus tify", + "ĠP ool", + "Ġgu inea", + "Ġcont ra", + "Ġfol ded", + "Ġlist ing", + "ĠL G", + "ĠL ane", + "Ġsure ly", + "v et", + "fluor ophenyl", + "Ġcoron a", + "ĠAb und", + "ĠOb jects", + "Ġt rough", + "ch t", + "Ġdis h", + "ith i", + "ĠMat lab", + "w orm", + "Ġprote omics", + "Ġinter molecular", + "ĠPet ers", + "Ġmir rors", + "quin oline", + "art ens", + "ĠJew ish", + "k B", + "ĠD egradation", + "Ġrele asing", + "V EGF", + "Ġsub populations", + "ĠTra ffic", + "Ġpro line", + "ĠH f", + "Ġad ren", + "b irth", + "Ġs ender", + "Ġat las", + "Ġwork place", + "Ġreflec tivity", + "ĠEx istence", + "cl s", + "Ġfin er", + "Ġbreast feeding", + "on ectin", + "Ġc ogn", + "ell ate", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "by te", + "Ġsk et", + "N ULL", + "s ystems", + "ĠB ranch", + "ĠPro posed", + "lear n", + "Ġtoler ant", + "Ġver tebrates", + "Ġmulti level", + "ĠPA H", + "Ġaud ience", + "ĠW L", + "nit rop", + "ĠC t", + "Ġsati va", + "e ight", + "Ġme g", + "oc ell", + "Ġst ating", + "dom inant", + "b ytes", + "Ġp u", + "ĠB atter", + "ot axis", + "ĠE BV", + "Ġnanoc rystals", + "Ġmonop ole", + "Ġdia phrag", + "ĠV el", + "Ap pendix", + "at ten", + "im pl", + "Ġland mark", + "encl ature", + "ĠST AR", + "Ġprost agland", + "oprot ective", + "Ġload ings", + "ĠPres ence", + "ĠN SF", + "ress es", + "F U", + "il ers", + "Ġeryth rocytes", + "t rac", + "is lation", + "ĠN ight", + "Ġster oids", + "ti z", + "ĠD MA", + "Ġr ic", + "Ġsal ient", + "ĠF ur", + "spec ial", + "Ġbio informatics", + "ign ant", + "ĠEX PERIM", + "avor able", + "dis k", + "Ġcur riculum", + "imid azol", + "hig her", + "Ġdesign er", + "ĠSt rength", + "Ġcytos ol", + "ĠCh annels", + "L and", + "s par", + "Ex pression", + "Ġday time", + "merc ial", + "v box", + "in ar", + "ie ving", + "ce in", + "ĠNC BI", + "R AN", + "¸ Ģ", + "H ig", + "ĠD HA", + "Ġsub script", + "Ġ ¢", + "or ange", + "Ġknow s", + "ĠN AF", + "pro duced", + "ep id", + "Ġdex amethasone", + "Ġformal dehyde", + "yl l", + "Ġec topic", + "ĠVer ification", + "activ ating", + "ĠI G", + "ĠP av", + "Ġtra ding", + "Ġgrad uate", + "ĠF IR", + "enc il", + "ever y", + "Ġradi ological", + "ĠMamm alian", + "M ES", + "in ium", + "ĠS AS", + "ĠW H", + "Over ride", + "ĠSched uling", + "ĠB es", + "ĠY ao", + "Ġgl ad", + "ĠStandard s", + "Ġprov inces", + "en ers", + "Ġn r", + "Ġtrans pos", + "ĠCar ib", + "Ġfa una", + "um i", + "res et", + "Ġsup ra", + "Ġdiv isions", + "Ġbiod egrad", + "metric s", + "og rafts", + "Ġfunc tors", + "Ġsup portive", + "Ġcaud al", + "Ġexer ts", + "Ġc ub", + "od imer", + "Ġair borne", + "Ġdeliver ing", + "Ġmultiv ariable", + "Ġfurn ace", + "Ġremn ant", + "Ġinc o", + "ĠElect romagnetic", + "m apping", + "Ġdecl ines", + "c old", + "ĠS eed", + "con version", + "Ġglyc ogen", + "d T", + "aw i", + "AP P", + "H ol", + "ataly sts", + "ĠSat ellite", + "gar is", + "c ard", + "ĠBre ak", + "ĠAgain st", + "d dot", + "Ġpr uning", + "ĠCa enorhabditis", + "Ġsucceed ed", + "ub ert", + "ĠÏ ħ", + "ID s", + "Ġasympt otics", + "Ġauto anti", + "ĠScal ar", + "Ġnemat ode", + "h d", + "Ġg yn", + "ist ocene", + "Ġunderg round", + "ĠEth ical", + "Ġs ial", + "ĠM igration", + "cop e", + "Ġstig ma", + "Ġele ven", + "Ġcolor ing", + "in itions", + "ĠJ ay", + "ob a", + "ĠL DA", + "Ġbuild s", + "g ences", + "ĠEc ology", + "schem e", + "ĠUltr as", + "Ġmedi ation", + "ĠTa q", + "Ġf lying", + "ĠEqu ilibrium", + "ophosph ate", + "ĠArgent ina", + "ps ia", + "tt es", + "Ġdispar ity", + "Ġadver tis", + "agg reg", + "I SA", + "od em", + "ĠR ational", + "Ġsil ent", + "divid ed", + "P an", + "J A", + "cl aim", + "Ġradio active", + "Ġp ink", + "Ġcon verse", + "ĠM ell", + "en ib", + "rus kal", + "sl ope", + "hen ol", + "ĠP on", + "par tition", + "SM GR", + "tit led", + "ĠInter ference", + "t osecond", + "Ġse q", + "Ġtrans itive", + "ĠW id", + "review ed", + "× ¥", + "ĠV C", + "rec all", + "ogene ic", + "ĠOverex pression", + "Ġcom mitted", + "Ġsyn apse", + "Sh ort", + "ĠNeut ral", + "ic les", + "IS M", + "Ġintr insically", + "Ġmicros atellite", + "R N", + "ĠâĪ ĥ", + "det ection", + "Ġcod imension", + "Ġdrawback s", + "ĠTurn er", + "Ġsputter ing", + "Ġdis mut", + "Ġhyp ogly", + "Ġspe ak", + "J D", + "Ġs ul", + "Ġperin atal", + "Ġin k", + "ies t", + "Ġoffic ers", + "tic k", + "Ġre taining", + "ĠN ET", + "Ġexchang es", + "Ġany one", + "ĠEnd othelial", + "s end", + "in jection", + "ĠPer u", + "Ġcl ades", + "uct uations", + "Ġsulph ate", + "pi o", + "Ġphys i", + "ĠMi y", + "ĠB AS", + "ari us", + "Ġlip opolysaccharide", + "Ġneurode generation", + "ĠTurk ish", + "Ġo phthal", + "Ġac ted", + "ent re", + "Ġsh aking", + "Ġchlor oplast", + "ĠS id", + "regn ancy", + "as ion", + "ĠH s", + "Ġiniti ating", + "Ġflex ural", + "Ï ª", + "Ġpar ac", + "Ġinter layer", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "c ause", + "rac tions", + "Ġval uation", + "SY SMGR", + "ĠGarc ia", + "ar rays", + "Ġcast ing", + "ĠP FN", + "ĠL anc", + "ĠGl ob", + "Ġd enti", + "Ġport folio", + "ĠHol ocene", + "ĠMAT ERIAL", + "Ġs arc", + "L ear", + "Ġt in", + "ĠC lear", + "bel ow", + "Ġadv ection", + "Ġoverl aps", + "Ġarth roplasty", + "comput e", + "Ġglycol ysis", + "he pt", + "lor a", + "f rames", + "ĠH ern", + "pro to", + "Ġsw ine", + "Ġje jun", + "Ġrepe ating", + "ancre atic", + "ĠColl ins", + "ĠPrinc iple", + "Ġnan of", + "Ġadj acency", + "Ġsyn ov", + "che t", + "ĠAl most", + "Ġintr usion", + "Ġechocardi ography", + "lif eration", + "Ġquies cent", + "ĠM uk", + "Ġlife times", + "grad ed", + "Ġoverw hel", + "z el", + "Ġnit ride", + "Ġdisturb ed", + "Ġfast est", + "gra bility", + "Ġtoler ated", + "f rag", + "ĠExt ension", + "ano ate", + "ifer ous", + "Ġhydro dynamics", + "IO NAL", + "ĠT oday", + "ĠExp ansion", + "Ġven om", + "ĠHep atitis", + "ñ o", + "on ation", + "syn uclein", + "Ġbasket ball", + "cl usions", + "Ġsett led", + "I QR", + "ĠC ra", + "Ġautom ation", + "ĠHealth y", + "ĠPortug uese", + "ĠAb elian", + "Ġg ad", + "ĠH G", + "ĠR oth", + "Ġcons ume", + "F G", + "in als", + "ĠM CMC", + "Ġpregn ancies", + "D ES", + "por tional", + "ĠBi ochemical", + "Ġmiss ions", + "ĠAnti body", + "ĠB CG", + "ĠL AS", + "mar ine", + "D MA", + "Ġl ongevity", + "ĠD ry", + "ĠR ao", + "Ġinterfer ometer", + "Ġdiscre tized", + "osens ory", + "s it", + "et ta", + "tain er", + "other wise", + "AK T", + "ĠFac ulty", + "Ġas certain", + "ĠSim ulated", + "Ġpay load", + "O UT", + "Ġsuff ers", + "Ġt ungsten", + "ĠAn xiety", + "ĠHeter ogeneous", + "ling ual", + "Ġphe rom", + "b ors", + "l inux", + "Ġmon key", + " £", + "ur l", + "ĠAc ross", + "ĠAK I", + "Ġop p", + "ocal ization", + "Ġmorph ogenesis", + "g ic", + "ĠP CM", + "Ġolig omers", + "Ġexhaus tive", + "ĠG IS", + "Ġpr istine", + "ĠAc tiv", + "ĠSc ilab", + "ĠAc oustic", + "ĠP ick", + "integr al", + "Ġphilos ophy", + "ĠD eng", + "ĠH ab", + "sc ape", + "ĠEmerg ency", + "Ġe pi", + "ĠB ET", + "ric ket", + "Ġann ulus", + "Ġlys osomal", + "Ġstrand s", + "C AP", + "ĠAmin o", + "ĠSt ri", + "epend ence", + "Ġfoot print", + "ĠFat ty", + "ĠN az", + "n est", + "ĠEx plicit", + "plan etary", + "le ad", + "Ġg rip", + "ne ed", + "AT T", + "ER V", + "ĠTarget ed", + "CR P", + "Ġparam agnetic", + "ĠT yr", + "ĠMicro RNA", + "h line", + "g h", + "p it", + "ĠIs olated", + "ject ory", + "Ġclean ed", + "ost e", + "Ġpath ologies", + "prop ylene", + "ĠRe ason", + "ĠIN FO", + "RA Y", + "Val ues", + "Ġal ive", + "Ġbi of", + "ew icz", + "Ġcrack ing", + "go ogle", + "lock ed", + "c rop", + "ec a", + "ur ane", + "SV M", + "ut ta", + "ĠMet ric", + "ĠEn cycl", + "ĠMod ule", + "Ġwarrant ed", + "Ġmulti disciplinary", + "ĠEl astic", + "lab elled", + "ĠSchwarz schild", + "ĠP CC", + "ma jor", + "v ideo", + "Ġst oring", + "ĠM ake", + "ak o", + "ĠJ ia", + "Ġtor oidal", + "ĠH MM", + "Ġmask ing", + "Ag ain", + "Ġneph ropathy", + "g f", + "Ġdom inating", + "er kin", + "ĠFabric ation", + "ĠF el", + "DE F", + "c ulture", + "ĠI ra", + "ĠRE G", + "iling ual", + "Ġm uss", + "pl ain", + "z h", + "ist on", + "ĠÎ ¥", + "min imal", + "c mp", + "Ga N", + "Ġmonot onic", + "Ġinv olution", + "Ġwh atever", + "ĠInstr ument", + "im ple", + "ĠPC I", + "ĠNe uronal", + "Ġfac ets", + "Ġhemod ialysis", + "ap atite", + "ĠK il", + "ont ally", + "Ġinser ting", + "ĠR IP", + "Ġconn ective", + "ĠFed eration", + "n ut", + "ĠG un", + "inu ous", + "M or", + "ĠW isconsin", + "Ġmus h", + "IT S", + "Ġe ject", + "ĠB PS", + "ĠH orn", + "ĠEmbed ding", + "Ġr aces", + "ĠJ am", + "Ġpost ure", + "ĠIn vol", + "ĠIMD b", + "ĠP lease", + "pro portion", + "ĠInter leukin", + "Ġar te", + "Ġsub sp", + "oder ma", + "F ind", + "im it", + "ĠCl in", + "H el", + "FI LE", + "orig inal", + "erv oir", + "Ġple ural", + "clip se", + "enc er", + "in aries", + "Ġv ictory", + "Ġinvestig ates", + "ĠImport ance", + "ĠM IN", + "Ġphon ons", + "integr ated", + "Ġex changed", + "ys tis", + "Ġmig rate", + "R ob", + "el and", + "pro of", + "ĠIntegr al", + "Ġmerg ers", + "Ġpolyphen ols", + "ĠF ully", + "Ġu ro", + "Ġhom ogenous", + "Ġrecogn izing", + "ĠSign als", + "v at", + "ig ms", + "Ġaccur acies", + "Sub stituting", + "Ġpoison ing", + "Ġsh rimp", + "ĠH ölder", + "ĠTanz ania", + "J S", + "M ENT", + "ĠTop ology", + "Ġin vers", + "ĠD U", + "Ġun iaxial", + "ĠS EC", + "par ty", + "Ġcontroll able", + "Ġf um", + "os tics", + "Ġmanif ested", + "Ġpropag ated", + "Ġsuff ix", + "ĠC AN", + "ĠP ret", + "ke eping", + "Assum ing", + "Ġs uture", + "Ġp est", + "Ġg amet", + "ĠAl ignment", + "esare an", + "t um", + "Ġref ine", + "Ġpop ulated", + "Ġest u", + "ĠDef ense", + "ĠPri vacy", + "ĠWe in", + "ĠSen ate", + "Ġazim uth", + "ĠProf essional", + "Ġlab our", + "Ġsem inal", + "ĠInter vention", + "ĠOl der", + "A U", + "W ind", + "d ynamical", + "ĠV eter", + "aci ón", + "Ġco oking", + "Ġâī ª", + "Ġbe ad", + "Ġdens ely", + "Ġpall iative", + "m ort", + "ĠA AV", + "ĠR yan", + "P rim", + "g alax", + "mu ir", + "st ers", + "ĠSal t", + "quee ze", + "ĠPlate au", + "Ġ í", + "Ġl ighter", + "ord inary", + "formal dehyde", + "ĠW er", + "Ġb ark", + "Ġhomogen ized", + "Ġpyram idal", + "Ġin ert", + "ĠA PC", + "ĠMic ros", + "ĠProte obacteria", + "ĠPur ification", + "Ġparametri zed", + "Ġ ille", + "acc uracy", + "embed ding", + "Ġtough ness", + "Ġis ometry", + "back s", + "ĠF IG", + "ĠR on", + "ĠE SP", + "Ġmicrogl ial", + "inter p", + "ĠIntegr ating", + "ĠReduc ing", + "Ġhe arts", + "Ġserious ly", + "Ġspec ially", + "CT RL", + "ĠSur prisingly", + "Ġhyper plane", + "pol ynomial", + "Ġrecon c", + "Ġpharmacokine tic", + "M art", + "ĠB right", + "m able", + "Ġion izing", + "Ġtr ich", + "zym atic", + "Ġlept ons", + "et ting", + "ĠH ex", + "Ġneu rop", + "Ġadip ocytes", + "Ġro ds", + "Ġsuper critical", + "Ġsuc cin", + "Ġan ter", + "ĠN AC", + "ĠSub sequent", + "IG H", + "Ġs outheast", + "Ġend owed", + "Ġconver ging", + "Ġspati o", + "Ġcele br", + "hel ix", + "Ġaccess ions", + "Ġimmobil ization", + "ĠE Q", + "sp atial", + "Ġinform al", + "Ġd ere", + "ĠEn zyme", + "ĠB BC", + "ĠE PR", + "Ġelect rically", + "Ġleuk ocytes", + "Ġal anine", + "Ġmit ogen", + "Ġintram olecular", + "ĠN I", + "Ġpro kary", + "IS O", + "Ġd odec", + "ĠTra de", + "ĠD ai", + "cc c", + "ĠWal ter", + "ĠNe ither", + "Ġvul garis", + "Ġlong itude", + "ĠInt ro", + "op tion", + "ĠQ C", + "Ġâ Ŀ", + "prot ection", + "ĠI MF", + "ap rote", + "Ġlink er", + "Ġfound er", + "Ġaspir ation", + "clust ers", + "ĠP ay", + "ĠR oles", + "Ġac yclic", + "over ing", + "Ġrem ind", + "ĠT ong", + "ĠAt ten", + "Ġengine ers", + "Ġdys regulation", + "ĠFour th", + "Ġfil ename", + "ĠCo ol", + "prot ected", + "Ġnil potent", + "ĠH K", + "cl one", + "ĠSt adium", + "a is", + "os amine", + "AB ILITY", + "rov ascular", + "ĠA H", + "ĠCon cept", + "Ġcereb rospinal", + "ow itz", + "Ġresol ving", + "Ġw ings", + "ĠE GF", + "ĠCom mand", + "iaz ep", + "Ġbe ef", + "Ġsp ines", + "Ġprior ities", + "Ġattempt ing", + "Ġtel omere", + "B QU", + "Ġviol ations", + "L B", + "om nia", + "os m", + "ir q", + "Ġdivers ification", + "al t", + "ĠB RAF", + "Ġorgan isation", + "di e", + "Ġaut oreg", + "ick ed", + "ĠEc ological", + "ĠT rain", + "ĠP Y", + "Ġmusc uloskeletal", + "Ġhoriz ons", + "Ġo mega", + "Ġquas ars", + "ep tion", + "Ġer ad", + "Ġlum inal", + "Interest ingly", + "Ġpay ment", + "c nt", + "Ġdi pl", + "Ġrecogn ised", + "C at", + "ĠCh l", + "Ġmill ions", + "Ġdisappear ance", + "G AP", + "Ġradi ographic", + "Ġpost partum", + "develop ed", + "x ual", + "Ġhe d", + "id ered", + "ĠC ertain", + "Ġdys plasia", + "____ ____", + "ĠHal f", + "Ġas ymmetries", + "ĠAl cohol", + "S um", + "Ġf m", + "Ġch ap", + "Ġpre treated", + "ĠGall ery", + "Ġoutper form", + "Ġbreed s", + "Ġt ied", + "Ġdiffe omorphism", + "Ġcaus ative", + "Ġcollec tively", + "Ġsub optimal", + "Ġins ulation", + "Ġmanip ulate", + "Ġkil omet", + "Ġrep ulsion", + "Ġchloro form", + "Ġbe an", + "Ġhe ro", + "rophys ics", + "ĠP eptide", + "Ġout lier", + "Der ived", + "iss er", + "ĠInf ant", + "sulf onyl", + "Ġrecurs ively", + "H u", + "ĠK oh", + "pyrid ine", + "Ġs quad", + "Ġth irty", + "Ġsp oken", + "ĠZ ar", + "other mic", + "Ġcalc ification", + "ĠHels inki", + "Ġbe ach", + "ĠF DR", + "Ġprob iotic", + "Ġfin ishing", + "ymmet rical", + "Ġvac ancy", + "Ġthrom bo", + "Comp ared", + "A ST", + "st ed", + "othe rap", + "Ġiod ide", + "Ġt t", + "al ignment", + "Ġmicro vascular", + "Ġinitial ize", + "ĠANAL YSIS", + "Ġtop ographic", + "ĠReport ing", + "Ġunderestim ated", + "put ed", + "Ġatheros clerotic", + "Qi agen", + "g ut", + "ĠCor tical", + "Ġdisrup t", + "es te", + "Ġgl ue", + "Ġnarrow er", + "Ġin patient", + "Ġsch olars", + "Ġb c", + "ĠPsych ological", + "ĠHamilton ians", + "Ġhon or", + "tib ular", + "Ġinser tions", + "oscop e", + "Ġpharmacokine tics", + "Ġmathem atically", + "Ġfor k", + "ip ital", + "ĠAr gs", + "abol ism", + "Ġâİ ł", + "ĠRob ot", + "ĠC asc", + "Ġle aching", + "ĠL ack", + "Ġend ocytosis", + "Ġtr is", + "Ġsensiti vities", + "Ġlic ensed", + "Ġsp onge", + "carbon yl", + "fe at", + "Ġpre cl", + "Ġwa ist", + "tif ications", + "Ġol iv", + "b inary", + "at ri", + "ĠBi ot", + "T Z", + "Ġf ake", + "ĠM osc", + "ĠH PS", + "ĠVol tage", + "Ġâİ Ŀ", + "ĠAh med", + "ĠSex ual", + "dehyd es", + "ĠC ot", + "Ġmag ma", + "oxyl in", + "Ð Ī", + "amet hyl", + "ĠL OS", + "di phenyl", + "experim ental", + "Ġpluripot ent", + "agit tal", + "w alk", + "Ġplas monic", + "Ġcontrac ts", + "Ġexp ed", + "ĠArab ia", + "Ġshoot s", + "ĠR AN", + "ustr ated", + "Ġconvex ity", + "Ġm J", + "ĠAbs olute", + "ĠS EL", + "MI P", + "ĠAct ually", + "so le", + "Q I", + "ĠTGF β", + "Ġâİ ŀ", + "Ġrearrang ements", + "Ġc uring", + "exp ensive", + "cepti bility", + "Ġour s", + "ĠKid ney", + "Ġassign s", + "Ġvox els", + "ore al", + "Ġeven ing", + "h us", + "Ġ ãĢ", + "or adi", + "ĠCor rection", + "Ġnanofib ers", + "Ġcan tile", + "big oplus", + "umin ous", + "eclam psia", + "ĠC ult", + "EC H", + "at ology", + "Ġj i", + "cr yp", + "ĠAsp ects", + "en i", + "Ġsem is", + "IR S", + "ĠP ho", + "enc oding", + "ĠJus tice", + "ococc i", + "Ġhypoth alamic", + "ract able", + "ĠOr b", + "Sim ons", + "Ġmanip ulated", + "att ribute", + "on ov", + "or ously", + "end ar", + "ud er", + "ins ert", + "Ġlys ed", + "ĠHod ge", + "Ġfootball er", + "Dev ice", + "ĠLe ast", + "Ġstrat um", + "Ġmit ral", + "Ġs ell", + "ĠM uc", + "gly cer", + "o j", + "Ġpathogen icity", + "ĠDecl aration", + "op ause", + "ĠAr ticle", + "Ġrins ed", + "ĠLé vy", + "re ment", + "Ġan ts", + "ĠD ic", + "Ġk Pa", + "ur ry", + "mo tion", + "cl ient", + "Ġaccess ory", + "Ġdepolar ization", + "nam ely", + "Ġdispar ities", + "Ġfavour able", + "ĠTib et", + "Ġo ocyte", + "ist ration", + "Ġun resolved", + "cri ptive", + "phys ics", + "Ġben zo", + "Ġcrystall inity", + "Ġpay off", + "Ġumb ilical", + "os il", + "ĠSystem ic", + "ĠST M", + "Ġstabil izer", + "U SA", + "ĠJ ensen", + "A ug", + "ĠH at", + "AG G", + "under brace", + "Ġmanip ulations", + "ĠM anc", + "ned y", + "Ġscr atch", + "C herry", + "osacchar ides", + "Ġprecipit ate", + "quar ters", + "ic ul", + "Ġoptim ally", + "man y", + "Ġneoplas ms", + "Ġin ward", + "ary ng", + "Ġm oll", + "ĠW el", + "ĠW iley", + "Ġnewsp aper", + "Ġinhabit ants", + "ĠS uccess", + "Ġbrid ging", + "Ġdis connected", + "Ġhygi ene", + "D ist", + "Ġsc ripts", + "Ġmes oporous", + "Ġrestric ts", + "act one", + "Ġaqu ifer", + "ĠïĤ ·", + "Ġp lex", + "Ġpresum ed", + "Ġ ips", + "ĠM ilitary", + "Ġjud ged", + "Ġal d", + "Ġsequ est", + "comp ared", + "UL ATION", + "adap ted", + "Ġinstruc ted", + "p ulse", + "Ġc usp", + "mat ching", + "car rier", + "Ġenfor ce", + "ĠInter view", + "ometric s", + "Ġnull ptr", + "Ġflav our", + "ĠPare to", + "ĠB ER", + "Ġu v", + "Ġcr ash", + "ĠC ann", + "ĠMin eral", + "ĠOlymp ic", + "Ġpolyc rystalline", + "le tt", + "T ables", + "requ ent", + "Ġsed entary", + "uns aturated", + "ĠBern oulli", + "Ġad missions", + "itor ial", + "ac ute", + "Ġad ditions", + "we et", + "AL E", + "ĠMan ip", + "tok ens", + "prec ed", + "d k", + "cons ider", + "Ġïĺ ¹", + "Ġwr ites", + "car dia", + "ct omy", + "omat ous", + "S ymbol", + "ust en", + "Ġprote olytic", + "c ategories", + "Ġf ic", + "Ġsw ing", + "Ġpass enger", + "Ġoverl apped", + "if i", + "Ġmut ational", + "ĠJoseph son", + "Ġreg ret", + "ĠAr k", + "ĠCF D", + "Ġman eu", + "enc oded", + "texts c", + "Ġdecom positions", + "ĠDe b", + "Ġmand ibular", + "d U", + "ĠP IC", + "Ġtranscript omic", + "Ġtel escop", + "ĠSant os", + "o E", + "ĠM CP", + "Ġind igenous", + "Ġmicrosp heres", + "Ġcod ew", + "z ip", + "Ġfing ers", + "Ġcampaign s", + "¸Ģ ł", + "Ġacc idents", + "ĠTo ols", + "Pl anck", + " »", + "ed er", + "ing ham", + "oxid ase", + "Ġancest or", + "wh ose", + "Ġphosph olipid", + "Ġconvers ation", + "ĠH of", + "cor tical", + "gly cos", + "Ġmanufacture rs", + "op ulmonary", + "Ġincl ined", + "ĠBet he", + "Ġsp ending", + "ĠFus arium", + "u itively", + "Ġfem ur", + "ĠL inks", + "Ġnit rite", + "M ain", + "Ġfl ora", + "ĠPh D", + "ĠWr iting", + "ĠHess ian", + "Ġμ s", + "ool s", + "Ġvictim s", + "ĠR ew", + "ans en", + "E ar", + "Ġor n", + "Ġthermo electric", + "EN SE", + "ĠWeight ed", + "h oles", + "Ġc en", + "Ġac uity", + "Ġvac ancies", + "ĠDu ke", + "Ġpac litaxel", + "Ġconver ts", + "bour ne", + "ĠA CS", + "os i", + "Ġcrim inal", + "ĠI b", + "un es", + "ĠNan oc", + "P ost", + "ĠMD S", + "Ġecon omics", + "Ġthough ts", + "Ġneuro protective", + "Ġinters ects", + "c ers", + "at id", + "us a", + "ĠAn s", + "Ġafter wards", + "ĠOF DM", + "ĠCM V", + "ĠC um", + "AT G", + "ĠImage Net", + "ĠAtt ack", + "ogene ities", + "Ġcouns eling", + "ĠCON TR", + "á lez", + "ĠD h", + "ĠG V", + "Ġposition al", + "Ġg ang", + "ĠInter active", + "w ig", + "ĠT race", + "ĠD SS", + "Ġsynthet ase", + "ĠGal ile", + "us ually", + "ĠB ass", + "ard less", + "Ġexec uting", + "K P", + "ĠNep al", + "RE AD", + "ĠL ock", + "oh ydro", + "rot ation", + "d il", + "roscop ically", + "re perfusion", + "Ġdis hes", + "ĠProceed ings", + "ĠN PC", + "Ġmon soon", + "ĠLem mas", + "ĠChand ra", + "Ġre actors", + "Ġtr yptophan", + "ĠV T", + "ĠD EM", + "Ġleg islation", + "m k", + "Ġtor ic", + "ĠProgram s", + "ĠPub Med", + "Ġr DNA", + "Ġpost s", + "Ġâİ Ľ", + "Ġshed ding", + "toler ant", + "Ġv oids", + "ĠCarib bean", + "C ODE", + "T ube", + "AL SE", + "Ġchlor ine", + "Ġco erc", + "ĠRh iz", + "ĠKir k", + "Ġà ĸ", + "ro ut", + "ic ides", + "ag u", + "ĠK w", + "Ġcr u", + "Obs erve", + "ĠRe vis", + "Ġan onym", + "Ġpre requ", + "ocor tical", + "Ġrest aur", + "ĠPop ulations", + "d st", + "Ġfor t", + "reg s", + "ĠPolar ization", + "Ġpancre atitis", + "a ph", + "th reat", + "ft en", + "ĠAl aska", + "ĠFlex ible", + "Ġreperto ire", + "k an", + "math choice", + "Ġmit osis", + "Ġe at", + "ut in", + "Ġr t", + "Ġd ummy", + "ĠC ys", + "ĠG or", + "ear chers", + "H PLC", + "Ġb ay", + "ĠNi elsen", + "ĠR oc", + "ian i", + "ic it", + "rag ue", + "Ġcour ts", + "test ing", + "Ġampl ify", + "Ġtu ples", + "prol iferative", + "ĠPar as", + "Ġmagn ets", + "Ġchem okines", + "ĠMit chell", + "ĠPet ri", + "hol tz", + "y ch", + "mat rices", + "Ġcorrec ting", + "ĠPC a", + "ynam ically", + "ĠNAF LD", + "Ġeff luent", + "it um", + "Ġth rows", + "ĠGu id", + "och romatic", + "ĠF ro", + "id ad", + "rom agnetism", + "H erm", + "ĠS pi", + "ĠQu as", + "dom ains", + "Ġquad rant", + "ĠSO X", + "ĠGover nor", + "Ġam enable", + "he ld", + "ĠC ul", + "Ġunder water", + "ĠK ron", + "ĠSp ati", + "ano yl", + "C U", + "ov ir", + "Ġdem ographics", + "With in", + "ĠM é", + "texts f", + "ĠLab el", + "Ġgenu ine", + "Ġh ill", + "ĠL az", + "Ġt esticular", + "ĠB row", + "IC ATION", + " ¡", + "ĠA IC", + "anc omycin", + "str ual", + "Ġarrest ed", + "ĠS om", + "ĠI HC", + "ĠP ose", + "ĠM ö", + "ist ar", + "ĠP AM", + "ĠH CT", + "Ġtyp edef", + "ĠMor se", + "ĠLe ishman", + "lim b", + "Ġsphe roid", + "os ely", + "ĠGu inea", + "re new", + "Ġpsori asis", + "ist a", + "ĠCh ung", + "orth ogonal", + "ĠShe ar", + "ĠMus lim", + "ĠP ict", + "In teger", + "Ġspac er", + "L y", + "Ġd ermal", + "Ġonc ology", + "Ġd p", + "Ġphot oluminescence", + "reg on", + "amin ase", + "ĠẠĭ", + "Inst ance", + "ver b", + "Ġmethyl ated", + "ĠG em", + "ist ently", + "ĠMg Cl", + "ĠEle vated", + "⣠©", + "onstr uct", + "Ġsnap shot", + "en em", + "ĠD isk", + "Ġhydro static", + "Ġïĥ ª", + "v or", + "ĠI E", + "ĠL Y", + "OR F", + "Ġfo il", + "m ale", + "Ġdepend ed", + "s parse", + "Ġmet as", + "Ġtext ures", + "Ġstack s", + "M Hz", + "Ġf n", + "Ġult rac", + "ĠSh ould", + "V ec", + "n ine", + "inf inite", + "ĠLaw rence", + "ĠInvent ory", + "ĠPro state", + "Ġgest ure", + "ĠSuz uki", + "A bs", + "ric ane", + "ĠPeriod ic", + "M yc", + "if iable", + "Ġin efficient", + "Ġcoll apsed", + "Ġtopological ly", + "Ġprefer able", + "Ġbronch ial", + "ust on", + "Ġflex ion", + "our ney", + "trans lation", + "Ġepit axial", + "Ġirradi ance", + "Ġneighb ours", + "sw itch", + "Ġactu ators", + "S OD", + "m ir", + "di es", + "ik awa", + "ĠAL L", + "ĠR SV", + "ĠH EP", + "Ġend urance", + "conn ection", + "Ġgest ures", + "odon tic", + "ĠUn c", + "Ġdismut ase", + "H aving", + "m ix", + "Ġneuro genesis", + "Ġmyocardi um", + "ĠRuss ell", + "H ist", + "ĠS PI", + "tri azol", + "ag ulant", + "ĠRe quired", + "Ġsh RNA", + "ĠArth ur", + "Ġspaw ning", + "d ried", + "Ġrec tif", + "Ġà ī", + "Ġoste ogenic", + "re place", + "Ġgain ing", + "Ġneutral ization", + "ĠHart ree", + "Ġfollic les", + "Ġrelig ion", + "Ġd uplex", + "Ġtrans ients", + "amp ed", + "Ġmicrotub ules", + "int erest", + "Ġste els", + "B atch", + "Ġden aturation", + "ĠPhill ips", + "Ġqu iet", + "ĠB ureau", + "ĠR are", + "Ġqu ercetin", + "a ults", + "Ġel ution", + "uk a", + "ĠInter pretation", + "R V", + "ĠE SC", + "ĠK om", + "are ttes", + "Ġï ģĦ", + "Ġtra dition", + "Ġdiss ected", + "Ne igh", + "Ġshe aves", + "Ġbelong ed", + "ĠHist oric", + "ĠO E", + "Ġj son", + "lem ma", + "ĠY AP", + "ode xt", + "inter face", + "Ġextrem ity", + "cross ing", + "preced ented", + "acc ording", + "Ġconstruc tive", + "ĠStim ulation", + "ĠHF D", + "Ġwaven umber", + "Ġh rs", + "Ġpapill omavirus", + "Ġvom iting", + "Ġre activation", + "omet rically", + "ĠDim ensions", + "ob jects", + "ort on", + "ĠMat hem", + "ĠOl ive", + "Ġcros stalk", + "par tite", + "opath ies", + "ĠCN Ts", + "rous al", + "Ġcrow d", + "ĠLang muir", + "ĠT ox", + "echan ics", + "im us", + "ĠSh ock", + "tan h", + "ĠBrill ouin", + "Ġtransf erring", + "Ġellip se", + "ĠAd dition", + "ĠR ural", + "Ġgeodes ics", + "G EM", + "ĠP OS", + "ĠM ission", + "oc arp", + "ĠJ ane", + "L ie", + "f req", + "op ot", + "ĠV ibrio", + "ĠOb j", + "er ts", + "ĠTri als", + "C FT", + "ĠC odes", + "μ g", + "Ref erence", + "ĠF ung", + "ĠSup pression", + "h og", + "Ġresis tive", + "C hi", + "int ered", + "Ġpost menopausal", + "St atistical", + "ĠEd wards", + "Ġs es", + "Ġfarm ing", + "quar tile", + "cool ed", + "Ġnan op", + "ĠProb ing", + "ĠBern ard", + "un i", + "ie ties", + "ĠMark et", + "os um", + "ĠM essage", + "Ġaxi om", + "c g", + "ĠM oving", + "Res olution", + "Ġadsorb ent", + "Ġmult in", + "Ġin effective", + "prop ag", + "hard t", + "S aharan", + "W il", + "ĠI van", + "ir ubin", + "Ġtra bec", + "all i", + "ĠCD Cl", + "Ġse w", + "ĠIs s", + "Ġagg ression", + "ĠJ uan", + "Ġdispers ions", + "Ġaux in", + "F ET", + "l p", + "re ach", + "ĠP GE", + "che str", + "Ġlect ure", + "ĠD onald", + "sl ip", + "ĠHb A", + "ĠSec ure", + "ĠBe h", + "Ġdam ages", + "W H", + "alk yl", + "H a", + "ĠTh anks", + "Ġsensiti zation", + "Ġwat erm", + "Ġtw ins", + "Ġcultiv ar", + "Ġze olite", + "V ariable", + "ĠB ent", + "Ġanti sense", + "ĠHans en", + "reprene ur", + "ĠSN e", + "ĠEM G", + "Ġre acted", + "Ġover flow", + "Ġformal in", + "ĠUs ually", + "olyb den", + "Ġac ad", + "AT URE", + "Ġwavegu ides", + "Ġch unk", + "Ġmod ifies", + "Ġer yt", + "ĠZh ong", + "Ġgran ule", + "Ġc s", + "ĠGra de", + "Ġland marks", + "ur istic", + "Ġam ines", + "ĠIntr insic", + "Ġerrone ous", + "Ġlock down", + "yp ti", + "Ch ild", + "Ġunivers ities", + "Ġparas it", + "Ġign ition", + "T im", + "ar aj", + "ra vel", + "ĠL ands", + "ĠCirc ular", + "Ġrot ate", + "Pati ents", + "ĠW B", + "Ġmyel in", + "ĠWe iss", + "Ġdip olar", + "Ġfollic le", + "ĠWat son", + "ĠIn cor", + "Ġfound ations", + "ĠP ip", + "Ġpress ing", + "Ġforb idden", + "av an", + "Ġm Ab", + "un ion", + "ĠF resh", + "ĠCor p", + "fl oxacin", + "co ordinate", + "Ġsh unt", + "Ġconstit uted", + "anil ine", + "Ġtwe ets", + "ĠCh ow", + "Ġmob ilization", + "zy k", + "E ST", + "ne igh", + "ĠM eng", + "ĠRes Net", + "ĠJ et", + "Ġlumin ous", + "Ġstress ors", + "do es", + "trifluor omethyl", + "Ġconcer t", + "ĠCho ice", + "ph im", + "al coholic", + "oc hem", + "ilt ered", + "Ġpredict able", + "Ġt ran", + "ĠP ra", + "Ġval ves", + "Ġaut onomy", + "reg ulate", + "ĠBe ach", + "ĠOnt ology", + "Ġis ofl", + "Ġqu oted", + "ĠL ex", + "th y", + "Ġcompl aints", + "ĠT rees", + "Ġop posing", + "ĠAcc eler", + "con trast", + "Ġcompet ed", + "O E", + "ĠR oche", + "iss ance", + "Ġpe ace", + "ĠA im", + "Ġinfer tility", + "ĠAntarctic a", + "th ien", + "S umm", + "Ġjudg ments", + "am ides", + "Ġsp ill", + "Ġhere after", + "ĠCons tit", + "comput er", + "Ġbeg un", + "ocent ric", + "Ġp umps", + "med ium", + "ch ol", + "met allic", + "Ġfl ares", + "Ġpet roleum", + "Ġwith d", + "ĠThe atre", + "Ġun labeled", + "Ġregular ized", + "oster ic", + "ĠP FS", + "Ġun em", + "Ġpresent ly", + "Ġbuff ered", + "aff inity", + "ĠDem ographic", + "ĠK ondo", + "Ġcent uries", + "Ġmig ratory", + "aryn x", + "Ass ociated", + "anil ino", + "g rown", + "ĠEx ecutive", + "ĠE k", + "ĠH emat", + "ĠPl ayer", + "ĠCH D", + "f lex", + "ĠS ever", + "alth am", + "im pro", + "an et", + "ocy st", + "ĠA ster", + "CO L", + "ĠSimilar ity", + "ĠHow ard", + "Ġmultic ast", + "ĠEns emble", + "ì Ĺ", + "ol ys", + "ĠGen omics", + "Ġreson ators", + "Ġfist ula", + "on en", + "us ers", + "Ġhyp o", + "rog ens", + "Ġmed al", + "ĠM IP", + "Ġvolt am", + "Ġappreci ated", + "ĠP é", + "ĠGa ia", + "Ġbuck ling", + "Ġcongru ence", + "fur yl", + "ĠEp stein", + "Ġcasc ades", + "g old", + "Ġan hyd", + "Ġgrad uated", + "M emory", + "ĠInd ustry", + "ĠSch neider", + "Ġemploy ee", + "ĠCor n", + "M AC", + "ro ve", + "rop od", + "s ervice", + "ĠOx idation", + "Ġenum eration", + "m ad", + "ĠCl ose", + "ĠMod ular", + "Ġprogen y", + "Ġg t", + "read ing", + "ĠInd ic", + "opath ologic", + "ĠPFN GL", + "X L", + "c is", + "ĠM ike", + "ĠB BB", + "ĠExt reme", + "ĠCho ose", + "Ġhoriz ontally", + "ĠASS ERT", + "Ġglucocortic oid", + "B ay", + "Ġp df", + "Ġcontain ers", + "ĠL OC", + "ĠY ield", + "opro te", + "Ġfruct ose", + "ĠI CC", + "Ġdec id", + "rim idine", + "Ġfrag mented", + "Ġisomorphism s", + "Ð ¼", + "Ġintegr ates", + "Ġfib ration", + "ĠâĬ ¤", + "Ġxen ograft", + "nucle on", + "ĠC SP", + "Ġs ut", + "ĠSp ir", + "Ġdiss oci", + "ĠT BI", + "ĠFor ces", + "Ġhyper surface", + "Ġmy osin", + "ĠQueens land", + "N eg", + "ĠU RL", + "b ind", + "Ap plied", + "ĠD ob", + "ĠK E", + "Ġmem or", + "ĠArab ic", + "ĠL ateral", + "ĠSt art", + "n ose", + "ti bility", + "as ters", + "Ġus ability", + "Ġinc enti", + "ym n", + "ĠAnaly tic", + "P et", + "ĠM ask", + "W orld", + "b rand", + "Ġelim inates", + "Ġmer it", + "ĠPhilipp ines", + "ĠB CL", + "ĠO ri", + "Ġparad igms", + "ĠIn ters", + "riz ona", + "Ġcon ception", + "Ġrel ied", + "ĠJ oe", + "ĠAp ple", + "Ġlight weight", + "mort em", + "ol ig", + "Ġv iz", + "Ġst ones", + "Ġkey words", + "ĠSecret ary", + "T N", + "old er", + "ĠInt estinal", + "Ġpossess ed", + "Ġmonoton icity", + "em itting", + "ĠDef ining", + "ĠPar ticularly", + "Ġautomorphism s", + "Ġeryt hemat", + "ĠW aters", + "ĠCycl ic", + "maxim al", + "xt y", + "ĠS ad", + "Ġur anium", + "Ġhypoth alamus", + "ĠSU MO", + "Ġdeal t", + "Ġk its", + "Ġpain ting", + "ĠS ier", + "ch ool", + "OD O", + "sur faces", + "ĠP neum", + "organ ized", + "ĠC PT", + "Ġins oluble", + "ĠCo herent", + "Ġrecess ive", + "Ġb ivariate", + "Ġed it", + "Ġnation wide", + "M ODE", + "c hest", + "ĠS LC", + "Ġintra peritoneal", + "ĠDis ordered", + "Ġinsu fficiency", + "ie v", + "iaz ole", + "W rite", + "ĠD ATA", + "tor al", + "Ġqual ities", + "Ġpossess ing", + "ĠM ats", + "Ġretin opathy", + "ĠB K", + "Ġnovel ty", + "ce ans", + "Ġreserv es", + "ĠNAD H", + "Ġisother m", + "Ġsoldi ers", + "p b", + "iter pen", + "ĠAg ents", + "z u", + "Ġunw anted", + "Ġhyper parameters", + "ec an", + "ĠS ES", + "ĠF G", + "ĠN avig", + "Ġtriang ulation", + "Ġnetwork ing", + "Ġpoly styrene", + "Ġinduc tively", + "brevi ations", + "Ġneurom uscular", + "ĠL inux", + "stud ied", + "ĠBe ing", + "Ġdef iciencies", + "ĠMat rices", + "Ġwe aring", + "Ġhad rons", + "am yl", + "Ġdisc ourse", + "och lor", + "ĠMel an", + "ĠL an", + "V L", + "Ġmunic ipal", + "Ġenroll ment", + "ĠS ymmetric", + "Ġdiscipl ines", + "ĠBar on", + "Res earch", + "Ġmagne tite", + "om ide", + "polar ization", + "le ys", + "Ġseem ingly", + "hep atic", + "Ġcl o", + "ĠQu atern", + "Ġcompe tit", + "R equ", + "ga uge", + "Ġhydro chloride", + "drop out", + "pan el", + "Ġaspir in", + "ĠR UN", + "Ġrib bon", + "Ġinacc urate", + "ĠP all", + "duc ers", + "Through out", + "Ġcell ul", + "Ġsusp ect", + "Ġalle lic", + "Ġsn ake", + "ordin ated", + "ĠAut ophagy", + "Ġe ig", + "Ġr if", + "ĠKen nedy", + "Ġbot tle", + "ĠY outh", + "aw ed", + "linear ity", + "uk er", + "ĠO X", + "ext ension", + "Ġw ard", + "ĠComplex es", + "Ġbios ensor", + "ĠCart an", + "d n", + "Ġs onic", + "Ġindex ing", + "Ġd v", + "rel iable", + "p k", + "RE NT", + "Ġt anks", + "ĠH et", + "ĠW ing", + "ĠCu O", + "Ġprint f", + "Ġlumin osities", + "c ourse", + "Ġsc ram", + "Ġsam pler", + "Ġmulti pliers", + "Def ault", + "od il", + "int r", + "sequ encing", + "Ġtrans missions", + "ĠWh it", + "ĠOp portun", + "Ġintern ally", + "Ġacknowled ges", + "ĠE dition", + "Ġarter i", + "Ġalb edo", + "ĠNucle otide", + "Ġy es", + "ĠRel ativistic", + "Ġv otes", + "ĠForm ulation", + "usc itation", + "Ġconcurrent ly", + "u in", + "Ġnon invasive", + "Ġprim ates", + "μ l", + "Ġsubt ropical", + "g un", + "ĠS outheast", + "ö n", + "Ġequ ator", + "Ġwork shop", + "Ġsch ist", + "und ant", + "ĠMOD IS", + "t ar", + "Ġa eg", + "Ġplot ting", + "ĠD ET", + "Man ager", + "un ed", + "oxif en", + "ĠIn ver", + "Ġx anth", + "ĠSer ver", + "Ġstret ched", + "Gl obal", + "C ore", + "ĠWe ber", + "y ard", + "Ġexpl ores", + "ĠBi ography", + "SN P", + "ĠNeut rino", + "Ġkilomet res", + "Ġcomm utes", + "Ġaccept ability", + "ĠAntib odies", + "ic ol", + "Ġmus eum", + "Ġden it", + "Ġextrap olated", + "Ġacetyl choline", + "T oken", + "ĠF ock", + "ond e", + "Ġdiscrimin ative", + "ĠM ant", + "Ġess ence", + "cel and", + "ĠCh air", + "Ġintegr ative", + "ĠS PD", + "hen ium", + "arbon ate", + "B ASE", + "reg ulates", + "p atch", + "Ġd ib", + "Ġanti symmetric", + "Ġwear able", + "Ed ge", + "re ts", + "Ġperce ive", + "ĠMagn esium", + "ad ows", + "Ġdis posal", + "Ġair port", + "ause a", + "f its", + "Ġnec ro", + "ĠS IN", + "ĠD uc", + "ĠRe ading", + "b ys", + "Ġreflec tive", + "h is", + "omet ries", + "Ġvi rial", + "Ġartif icially", + "child ren", + "ĠUltras ound", + "VI EW", + "Ġsc ulpt", + "Ġsur f", + "Ġsex ually", + "Ġgeomet rically", + "Ġdivis ors", + "Ġiniti atives", + "acc i", + "Ġkeratin ocytes", + "a R", + "aro t", + "Ġïĥ ¨", + "comput ed", + "ĠTC GA", + "psych ological", + "ĠM AN", + "ĠM PC", + "tic ing", + "lim iting", + "am ins", + "Ġsurfact ants", + "ĠSer b", + "Ġrhyth ms", + "ĠRout ing", + "w ang", + "Ġmicro structures", + "oph ytes", + "Ġanalges ic", + "F OR", + "qu al", + "Ġpubl ish", + "ĠTim ing", + "por ous", + "rang ing", + "er on", + "ĠZ i", + "ĠMarsh all", + "Wid th", + "Ġis omers", + "Ġ ·", + "phen oxy", + "Ġure th", + "ro bl", + "Ġmention ing", + "o zyme", + "ĠL ud", + "Ġop position", + "Ġaband oned", + "Ġrout ines", + "ĠH ST", + "mut ex", + "c oded", + "e ating", + "ter t", + "emicon ductor", + "d w", + "Ġbary ons", + "Ġleuc ine", + "ot ron", + "Ġend os", + "Ġreproduc es", + "Ġanalges ia", + "Ġimmunore activity", + "ĠPre p", + "ĠGarc ÃŃa", + "Ġinco herent", + "an ed", + "le pton", + "and ra", + "ul ae", + "ĠH idden", + "F V", + "Ġgeneral izes", + "ĠSte vens", + "ĠF oster", + "Ġfresh ly", + "Ġh f", + "Den ote", + "o es", + "ĠD in", + "Ġdet ox", + "Ġdec oupled", + "Ġsepar ations", + "ucle otide", + "Ġelect rophysiological", + "ĠBAL B", + "Q TL", + "ĠA Ch", + "ĠRe le", + "que z", + "Mn O", + "ect ures", + "Ġis cha", + "Ġins ulators", + "cell ulose", + "ĠFL AG", + "omb ic", + "ĠUs ed", + "j iang", + "exp ansion", + "ĠRep eat", + "ĠRes erve", + "ab elian", + "ĠH unting", + "G RO", + "ly te", + "ĠB ark", + "Ġcre ative", + "Ġb end", + "el erated", + "dis h", + "Ġhigh way", + "Ġcross ings", + "j ust", + "on o", + "ull ivan", + "ĠDe ad", + "Ġtrade off", + "e on", + "og ical", + "experim ent", + "Ġconf ers", + "ĠD ot", + "Ġco ils", + "Ġax ion", + "ĠIR S", + "ĠÅ ©", + "Ġglac ier", + "ĠMosc ow", + "ĠS pringer", + "Ġinv is", + "ĠArn old", + "Un iversity", + "at tern", + "per or", + "ĠLim its", + "Ġincomp atible", + "r ather", + "ĠT es", + "Ġfail ing", + "Ġthick ening", + "Ġest radiol", + "as se", + "Ġnecess it", + "Ġsacrific ed", + "ĠS ear", + "ĠNor the", + "raise box", + "ĠS low", + "ĠM unic", + "Ġlear ner", + "igen ic", + "Ġderm atitis", + "ut en", + "Ġde er", + "Ġhist amine", + "L at", + "M al", + "il ly", + "Ġge ochemical", + "Ġspermat ozoa", + "Ġv inyl", + "em et", + "Ġeffect ors", + "ĠEncycl opedia", + "Ġord inal", + "Ġcontrovers y", + "ĠPers pectives", + "ovirus es", + "mark ed", + "ĠS PE", + "ĠN utri", + "Ġad here", + "ĠHigh way", + "Ġdistill ation", + "MR T", + "ple tion", + "Ġannih il", + "Ġwave function", + "Ġconfig ured", + "Ġmeth ionine", + "L ow", + "s ensor", + "ĠS now", + "S ample", + "Ġdef initely", + "ĠMet h", + "r ypt", + "Ġprom pted", + "Ġmonol ith", + "ĠEn vironments", + "t m", + "ĠCO D", + "or is", + "equ ations", + "âĺ Ĩ", + "ĠNe ighbor", + "Ġimag ine", + "ĠUs ers", + "ĠCam era", + "ĠMod ification", + "ĠAtt acks", + "Ġinhal ation", + "á º", + "Ġventi l", + "ĠN U", + "ĠCon trast", + "Ġconf ining", + "S ervice", + "W allis", + "ĠA TR", + "Ġsub duction", + "Ġïģ ¢", + "Ġtit ration", + "R oche", + "v iv", + "Ġbe ars", + "bol a", + "Ġblind ed", + "meas ures", + "ĠSt ack", + "occ urrence", + "Ġperme ation", + "l ar", + "ept ors", + "ĠD IF", + "cor rhiz", + "ĠV isc", + "fig urable", + "Ġschedul er", + "Ġoccas ions", + "ambo o", + "Ġam p", + "g ain", + "ĠC it", + "Ġpreced ed", + "Ġtac tile", + "Ġïĥ ¦", + "gener ic", + "Ġretro grade", + "Ġf ans", + "Ġf isher", + "Ġl ights", + "ee per", + "Ġundes irable", + "w ald", + "emb ol", + "Ġwr ist", + "Ġauthor ized", + "Ġchond rocytes", + "ĠE PA", + "ne u", + "ĠOper ations", + "Ġche ap", + "Ġan ionic", + "ĠO regon", + "c ot", + "re ason", + "ex istence", + "ĠFin ancial", + "olybden um", + "c us", + "ĠN ON", + "Ġlock ed", + "B it", + "S il", + "m ixing", + "ĠS ites", + "aprote obacteria", + "ĠIn ner", + "Ġcar c", + "Ġbi otic", + "ĠFl ag", + "Ġmag ic", + "kine tic", + "ic ted", + "Ġbul b", + "sup set", + "pe z", + "deriv ative", + "Ġe IF", + "ĠR ough", + "di rectional", + "ex it", + "ax y", + "xt ures", + "phim urium", + "ĠT Fs", + "ath in", + "Ġor ch", + "Ġspect ro", + "duct ase", + "quin olin", + "Ġgras p", + "Ġpar sing", + "Ġdiffic ile", + "ĠLD H", + "ĠJup iter", + "ĠF IF", + "ĠPri ze", + "Ġinten tions", + "s ession", + "pow ered", + "ĠB am", + "ph asic", + "Ġign oring", + "ĠRichard son", + "princ iples", + "Ġoffic ially", + "C t", + "Ġinc on", + "ĠReg ulates", + "Ġm isc", + "ĠE Z", + "Ġsyn onym", + "Ġunfold ing", + "ĠD EC", + "ĠR X", + "PD F", + "Ġbran es", + "typ ically", + "Ġc ages", + "if olia", + "ug u", + "oll en", + "Ġtable t", + "ĠS ah", + "ĠP VD", + "Ġal ert", + "Ġformer ly", + "ĠKR AS", + "s un", + "Ġde acetyl", + "M er", + "Ġskew ed", + "ĠPle istocene", + "ĠB etter", + "ĠH ud", + "ĠBro ok", + "Ġp ts", + "ĠH U", + "om o", + "ag rass", + "Ġenvironment ally", + "Ġhon est", + "ĠN ine", + "Ġpig ments", + "l inks", + "ĠT OP", + "ĠCytoplas m", + "G ib", + "Ġaccess ing", + "mi as", + "Ġexplos ive", + "Ġres ide", + "art an", + "Ġtransition al", + "Ġun precedented", + "Ġ rom", + "ĠTNF α", + "Ġprecipit ated", + "Ġt ie", + "IS S", + "Ġthick er", + "ĠLat ent", + "ĠValue Error", + "d q", + "d ma", + "Ġchrom atic", + "ĠSub section", + "ĠF ACS", + "Ġrenormal ized", + "P rop", + "m TOR", + "ĠH CO", + "Ġover lo", + "bs iella", + "yl obacter", + "Ġneuro imaging", + "Ġassembl age", + "Ġexp ands", + "Ġî Ī", + "ĠF un", + "Ġc itation", + "IK V", + "Ġtro ops", + "in istic", + "Ġc ubes", + "Ġf ont", + "ĠH os", + "ger ies", + "Ġsuccess ively", + "Ġdeco herence", + "S pringer", + "h in", + "at ine", + "ĠâĪ ¥", + "SA S", + "é t", + "ĠSed iment", + "u ously", + "ĠW ars", + "ind icated", + "Ġfl ask", + "A IDS", + "Ġc ra", + "ĠL ot", + "Ġprim al", + "Ġjus tice", + "z ag", + "Ġmax illary", + "Ġgeneral izations", + "uel a", + "Ġtag ging", + "Ġpup il", + "Ġin expensive", + "Ġw atch", + "ĠA MD", + "ĠF ir", + "Ġneuro blastoma", + "Ġmaxim izes", + "ĠObs erved", + "mi xture", + "Ġopportun istic", + "t rial", + "ah an", + "Ġïģ ¬", + "Ġcat ar", + "ĠControl s", + "ĠNew man", + "Ġmicro structural", + "bor ns", + "Ġoxygen ation", + "ĠMac ro", + "ĠJ ak", + "plic ating", + "Ġolig odend", + "Ġres orption", + "Ġd orm", + "Ġsol vers", + "ĠK ruskal", + "ĠRe volution", + "ĠGast ro", + "Dri ven", + "Ġt iter", + "Ġo ri", + "ĠP CL", + "Ġwet lands", + "Ġar ticular", + "CC A", + "en oic", + "Ġt rick", + "oper iod", + "ĠCoch rane", + "ad ay", + "ĠC erebral", + "Ġmod ulators", + "ĠS SC", + "Ġactiv ations", + "Ġadap ting", + "ĠScal able", + "n one", + "p ip", + "Ġpri vi", + "ĠPseud o", + "Ġdisapp ears", + "ĠE ur", + "Ġuncon strained", + "Ġsub mit", + "Ġrep utation", + "at ar", + "ĠB ai", + "ari ans", + "ĠInt racellular", + "tre es", + "Ġwet ting", + "ĠFran ces", + "Ġel igibility", + "fold er", + "ĠSta ff", + "ok i", + "Ġstrengthen ed", + "ĠC ob", + "ter al", + "ĠY east", + "by e", + "dec oder", + "Ġrain bow", + "perturb ed", + "v c", + "Ġsupplement al", + "Ġbir ths", + "W O", + "con c", + "stit ution", + "hy brid", + "Ġk i", + "Ġhyp ere", + "ĠS MA", + "form ula", + "Ġund efined", + "na phth", + "Ġdecl ining", + "Ġshield ing", + "Y au", + "Ġre ver", + "ĠW ilk", + "Ġdec imal", + "H CO", + "ang ered", + "Ġeryth rocyte", + "ĉĉ ĠĠĠ", + "n uclear", + "Ġabnorm ality", + "P res", + "Par ticipants", + "ĠW agner", + "Ġfibr ils", + "Ġfet us", + "ĠEx press", + "requ est", + "min imum", + "ĠBo oks", + "het amine", + "us hes", + "ĠB ach", + "ĠD OS", + "lect ric", + "ĠTw een", + "ĠHug hes", + "Ġm artens", + "Ġn ematic", + "Ġexperiment ation", + "ĠPark er", + "Ġepis odic", + "Ġte lem", + "AD E", + "col umns", + "Ġfundament ally", + "en et", + "ĠV l", + "ear th", + "Ġquanti le", + "ĠRe plication", + "Ġcle ared", + "En ergy", + "Sm ith", + "Ġantidepress ant", + "m x", + "p mod", + "am id", + "Ġser otype", + "Ġundergrad uate", + "ĠA rizona", + "Ġp ushed", + "ul u", + "ĠN IC", + "Ġrhe ological", + "ome gal", + "ĠQ ing", + "or ch", + "ir med", + "ĠQu ery", + "Ġsand wich", + "Ġclinic ian", + "ĠEllip tic", + "ĠMe h", + "DE V", + "ĠDeterm ining", + "alc ogen", + "b ench", + "az ep", + "ĠMiss iss", + "ti zing", + "ĠR BC", + "Ġofficial s", + "T ag", + "k T", + "lu ence", + "ĠRo om", + "Ġlect in", + "bar a", + "k yl", + "ON D", + "ĠD ose", + "Ġpr ism", + "Ġreduc tive", + "ĠSpect roscopic", + "od ied", + "col one", + "ĠCON FIG", + "Ġbr ittle", + "in verse", + "ĠB uff", + "yt ocin", + "Ġform ations", + "ĠCon ventional", + "pre v", + "Ġferr ite", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ Ġ", + "Ġadop ts", + "ĠMi ocene", + "man agement", + "ĠCR F", + "ĠHel m", + "Ġdoubl ed", + "ĠEFF ECT", + "Ġd ance", + "struc tions", + "ra it", + "if ers", + "ell ip", + "ut ting", + "pro f", + "ĠQ in", + "Ġab sc", + "Ġexplo its", + "Ġcy ber", + "def inition", + "ĠCoron ary", + "Ġdet erg", + "ĠPer ception", + "ĠCur ves", + "Ġnemat odes", + "Ġlist ening", + "Ġcatal ase", + "C oll", + "r é", + "isl ative", + "Ġarri ving", + "Ġviol ating", + "Ð ´", + "he tics", + "ĠJ ar", + "con cept", + "Ġbr ush", + "immun ity", + "Ġfinger print", + "res id", + "Ġelev ations", + "ock ets", + "Ġcatech ol", + "и Ñ", + "Ġprecipit ates", + "Ġsoc cer", + "ins ulin", + "Ġpurs ue", + "ĠI CA", + "ĠPol ice", + "ĠMur phy", + "T ask", + "ĠC oc", + "ĠH abit", + "ĠK P", + "Ġfl oral", + "Ġh un", + "Ġhydrogen ation", + "Ġsp ong", + "Ġch imeric", + "ĠK och", + "g on", + "ĠSch ur", + "ĠGre ater", + "R X", + "Ġc ing", + "ĠW altham", + "ang ling", + "Ġcoun ties", + "Ġlam ina", + "Ġco uncil", + "s ort", + "ĠB arc", + "ĠD ow", + "ĠZ eng", + "Ġdev ised", + "uit able", + "Ġmethyl ene", + "Ġsuperior ity", + "Ġepiderm is", + "Ġp rag", + "ĠP ED", + "threat ening", + "ish i", + "Ġe psilon", + "add ress", + "ENT AL", + "ĠB le", + "ĠAnton io", + "o other", + "ĠAg ar", + "Ġneighborhood s", + "Ġshorten ed", + "ST ATE", + "ĠSer ial", + "M AR", + "O U", + "Ġencaps ulation", + "ĠCons ortium", + "D r", + "pro file", + "Ġem itter", + "Ġnec rotic", + "ĠAut onomous", + "ĠPhosph orylation", + "min im", + "anth in", + "ĠS ph", + "ĠG ur", + "di hydroxy", + "dist ributed", + "ĠRP MI", + "st ones", + "Ġhyper fine", + "Ġis let", + "ĠS lo", + "plet ely", + "Ġin activated", + "ĠAgric ulture", + "Ġtrem end", + "Ġevery one", + "omp onent", + "Zn O", + "MP I", + "ĠDi amond", + "Ġ⣠¨", + "C ost", + "Ġdis abilities", + "in ver", + "ĠC ensus", + "ech o", + "Ġveget ative", + "Ġwilling ness", + "Ġrec ap", + "ĠConst raint", + "ĠP atrick", + "Ġover t", + "Ġmo ieties", + "or ax", + "ip pi", + "Di rect", + "Ġcar ies", + "Ġlocal ities", + "lat tices", + "ĠExpl oration", + "ĠA W", + "Ġloc king", + "Ġcoinc ident", + "Ġmultim edia", + "Ġtempor arily", + "ĠC aus", + "enc ia", + "Ġweather ing", + "ĠHelic obacter", + "ĠTh ings", + "hip s", + "m oving", + "Ġs igmoid", + "is in", + "ĠB ec", + "Ġmicro grams", + "bound s", + "ĠCol umn", + "Ġcommut ing", + "ĠJ en", + "Ġhour ly", + "M SC", + "Ġattend ance", + "ĠâIJ £", + "ĠE O", + "pro g", + "Ġrap amycin", + "ĠPredict ors", + "ĠRetrie ved", + "Ġsub species", + "Ġderiv es", + "ĠÄ ¤", + "ĠGener ating", + "ann ers", + "Ġvol at", + "Ġvis iting", + "ĠCalc ulations", + "ñ a", + "Ġdes ert", + "Ġexpect ancy", + "BM Cs", + "ĠExpl o", + "Ġtrav elling", + "ic um", + "Ġsub division", + "Ġcross linking", + "benz oth", + "ĠT on", + "RE N", + "Ġle th", + "rab bit", + "ĠAb ove", + "ul ted", + "Ġcon stric", + "J ones", + "z hou", + "ver n", + "ĠL ady", + "ĠBu ffer", + "ĠControll ing", + "Ġmulti scale", + "nik ov", + "acy cl", + "Ġprost hesis", + "A f", + "ĠCor ps", + "struc ted", + "G rid", + "in ning", + "old ing", + "Ġthi ol", + "ik ov", + "âĢ¢âĢ¢ âĢ¢", + "Ġgovern ments", + "rap ping", + "Ġthromb ocyt", + "L eg", + "R Y", + "ĠI celand", + "ocy cle", + "ĠMem orial", + "g ot", + "Ġid em", + "ĠBu ild", + "olip oprotein", + "D V", + "Ġph thal", + "rich ment", + "ĠHa em", + "Ġansw ering", + "ĠI J", + "Ġtrans gene", + "Ġre named", + "ĠImage J", + "Ġcass ette", + "Ġcoales cence", + "Ġcomp action", + "Ġwild life", + "Ġw ins", + "Ġsuper novae", + "enter ic", + "isp here", + "Ġtrack er", + "Ġevid ences", + "Ġcom orbidity", + "ĠR ules", + "ph asing", + "ĠLange vin", + "ĠF it", + "Ġpsy chiat", + "Ġbreak through", + "Ġch olinergic", + "ĠMet all", + "bre eding", + "itin ib", + "Ġsol o", + "abl ing", + "eli ef", + "osc ill", + "re v", + "ary a", + "Ġgood ness", + "ĠPB E", + "Ġa wards", + "Ġc rani", + "Ġphot ograp", + "aren ts", + "Ġfix es", + "r ÃŃ", + "ass uming", + "Ġcongru ent", + "ĠM other", + "ĠN ap", + "ĠPro c", + "Ġcategor ization", + "in ch", + "ĠH orm", + "ĠInter ventions", + "Ġnone quilibrium", + "Ġencryp ted", + "prim ary", + "i ens", + "l ac", + "ram s", + "Ġbo ards", + "ĠH ell", + "charg ed", + "Ġperi operative", + "em p", + "ĠInvol vement", + "R uss", + "un ivers", + "ĠD J", + "Ġdisag reement", + "Ġper t", + "Ġstrom a", + "Ġcalc ite", + "Ġrot ary", + "Ġmethyl transferase", + "Ġancest ry", + "ĠW itten", + "CR C", + "ure tic", + "ophy ta", + "provid ed", + "Ġcorresponding ly", + "big cap", + "ĠAg ilent", + "à «", + "ro oms", + "Ġdis ent", + "Ġdil utions", + "ĠMy el", + "Ġquas ar", + "Ġtil ted", + "Ġinternal ization", + "ĠPri vate", + "ĠFried man", + "Ġsevent h", + "ĠCl osed", + "CT C", + "g ren", + "ĠColomb ia", + "od el", + "Ġpoli tics", + "ĠMSS M", + "Ġm ate", + "Ġcom mod", + "ĠR us", + "Ġanest hetized", + "t ogether", + "ĠB CS", + "ew ski", + "romagn et", + "ĠC un", + "Ġcur ative", + "Ġim putation", + "Ġcarb ide", + "D FT", + "ns ic", + "be e", + "Ġspl en", + "ĠMary land", + "Ġoligonucle otide", + "ĠVeg et", + "buff ered", + "N ational", + "le tic", + "ĠS yl", + "Ġse ab", + "ardi al", + "Ġport ray", + "Ġaberr ations", + "Ġst orms", + "ĠSh an", + "ĠGen Bank", + "iss a", + "Ġc et", + "Ġben ch", + "ĠRecommend ations", + "Ġtri ples", + "Ġïĥ ¥", + "ĠNeu ros", + "Ġdisc om", + "se ason", + "ĠEx ec", + "chang ing", + "Ġarri ves", + "H ash", + "m RNA", + "Ġf ric", + "as a", + "ob ia", + "Ġpost synaptic", + "optim izer", + "ĠCloud s", + "Ġhyper sensitivity", + "v acc", + "ĠS ig", + "ph ilic", + "Ġground ed", + "ĠW an", + "ĠCal abi", + "ĠMach ines", + "Ġaxis ymmetric", + "ĠSte ve", + "Ġpull ed", + "ĠEx cel", + "Ġdiamond s", + "K R", + "W est", + "ĠD est", + "Ġann ular", + "Ġarch ive", + "Ġparench yma", + "ĠE H", + "ó pez", + "Ġunp ublished", + "Ġs outheastern", + "Ġn ests", + "dim ensions", + "lat itude", + "O rig", + "ec ed", + "ĠD raw", + "red shift", + "Ġam yl", + "omyel itis", + "W hy", + "c aro", + "i q", + "ass ess", + "ĠCont in", + "Ġchir ality", + "mat ical", + "Ġchaper one", + "Ġendometri osis", + "re lu", + "Ġconver ged", + "bro ad", + "ĠIter ative", + "Ġvascul ature", + "f und", + "ĠF ly", + "Ġanti genic", + "Ġmening itis", + "Ġent ails", + "hor n", + "Ġlocom otor", + "iz ard", + "Ġun even", + "par ity", + "pack et", + "tub ulin", + "Ġsew age", + "Ġdec entralized", + "Ġgra fted", + "Ġse p", + "ĠExt ensive", + "Ġspl ine", + "qu er", + "arch it", + "Ġprim ate", + "Ġïģ ±", + "pyrim idin", + "ĠS AP", + "Ġunder lie", + "Ġanalyz es", + "ĠC CA", + "rec ogn", + "IP T", + "Diff erent", + "ĠTE ST", + "Ġunf avorable", + "ed ic", + "ĠAb normal", + "pyrim idine", + "ur ine", + "embed ded", + "var ies", + "otrop in", + "Ġsem en", + "Ġtransmit tance", + "Ġab ras", + "Ġó ¸Ģł", + "Ġtriglycer ide", + "b undle", + "ĠY b", + "ĠCar r", + "Ġnam ing", + "We ight", + "Ġcondens ates", + "Ġn os", + "am ard", + "ver tices", + "EL S", + "id one", + "Ġcont est", + "Ġhead ing", + "ĠGal erkin", + "G V", + "ĠGl i", + "Ġfer mented", + "Ġb ilingual", + "Ġt icks", + "Ġk ary", + "rag al", + "ĠA ber", + "ĠYou Tube", + "UCT URE", + "b ranch", + "Ø ±", + "ĠF H", + "on oi", + "im otor", + "Ġver ifying", + "ĠCon ceptual", + "ĠDetermin ants", + "ur m", + "ur onic", + "ĠK au", + "ĠCon formal", + "Ġdrop ping", + "ĠFlow s", + "glu on", + "ag ain", + "ĠMR SA", + "war f", + "Ġemphas izes", + "Ent ry", + "ĠA SP", + "res ol", + "vent ricular", + "ĠâĨ Ķ", + "Ġoverex pressing", + "omegal ovirus", + "in oc", + "SC O", + "ĠPAR P", + "ĠSch ul", + "ĠCam b", + "ĠP od", + "ĠP un", + "ĠCompe tition", + "ĠG ATA", + "Ġmo on", + "Ġput s", + "angi ogenic", + "ĠRepublic an", + "ĠUb iqu", + "e ys", + "ĠG ong", + "arg er", + "ĠInter mediate", + "Ġinterp olated", + "Ġenlarg ement", + "Ġin struct", + "Ġr c", + "di oxo", + "ey e", + "ĠCar ls", + "ĠMeas ured", + "ir cles", + "ĠR af", + "Ġar b", + "ex amples", + "M i", + "ĠS tern", + "ĠF K", + "Ġmill isecond", + "ĠIR F", + "ĠEp ithelial", + "ed icine", + "el es", + "s ig", + "âĪ Ģ", + "ĠWi ener", + "b auer", + "ous es", + "Ġcol oured", + "ĠIncre ase", + "Ġtriglycer ides", + "Ġaeg ypti", + "ĠNumer ous", + "Ġretard ation", + "Ġinter cellular", + "ĠKle bsiella", + "ĠD ra", + "ĠD IC", + "ĠTh reshold", + "rain ment", + "Ġrepro ducing", + "Ġul cers", + "Ġa rousal", + "ĠH ills", + "Ġcal ves", + "ĠRes ervoir", + "ĠRad ar", + "Ġpsych osis", + "ĠFOR M", + "d uration", + "ĠAc ademic", + "c atal", + "oll a", + "ol ol", + "ĠC ron", + "ik o", + "Ġextrem es", + "ĠTryp an", + "Ġb ip", + "Ġal ginate", + "ĠH och", + "ĠBen nett", + "ĠH ippocamp", + "ĠGe ological", + "N evertheless", + "ĠH es", + "ĠAd ding", + "Ġextern ally", + "Ġsl ag", + "Ġte ach", + "ĠStan ley", + "controll er", + "ĠUn its", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠ", + "Ġaer odynamic", + "oval ent", + "c ube", + "Å Ł", + "re quire", + "romo lecules", + "ir teen", + "Ġcl auses", + "Ġdef eat", + "pol icy", + "Ġfaith ful", + "Ġp q", + "ĠTan aka", + "ĠE ver", + "Ġun predict", + "aut y", + "ĠGAL AX", + "Ġt ide", + "ĠFilter ing", + "Ġeut han", + "mer ce", + "DE X", + "Ġnest ing", + "D N", + "IR T", + "ĠTh r", + "tis sue", + "Ġpal ae", + "Ï ©", + "Ġdil ated", + "Ġpin ning", + "R b", + "ĠS ap", + "rag onal", + "ĠS PR", + "ĠD ial", + "Ġac upuncture", + "di ameter", + "ĠPC B", + "Par ameters", + "ĠProf iles", + "transf ected", + "l iter", + "ĠR ights", + "Ġcontrib utor", + "ĠCor rel", + "Ġregression s", + "Ġsegment al", + "Sh ape", + "I AN", + "ec om", + "com ings", + "Ġhemorrh agic", + "op os", + "Ġrefrac tion", + "P FC", + "pro j", + "ov o", + "ĠDer ived", + "Ġundi rected", + "Ġl os", + "Ġeng aging", + "c ans", + "Ġdestr uctive", + "P op", + "Ġm akers", + "ĠW or", + "ĠAre as", + "vas ion", + "Ġpara formaldehyde", + "abin oid", + "c py", + "pro xim", + "Ġen amel", + "Ġpa ediatric", + "ĠChild hood", + "Ġp ectin", + "ofil m", + "Ġcarboxyl ic", + "Ġa usten", + "Ġun equal", + "ĠCount ry", + "Ġiter ated", + "Ġflank ing", + "Ġt raction", + "ans on", + "isc us", + "ĠDav ies", + "ra ham", + "ter ozoic", + "ĠBr ass", + "O c", + "Ġun ification", + "met er", + "ĠNe on", + "bu ilding", + "ic ting", + "Ġjus tification", + "Pri or", + "Ġfir ms", + "Ġeduc ated", + "Ġinters ecting", + "Ġboost ing", + "P ass", + "m ember", + "con tains", + "ran o", + "rel ax", + "ĠCollabor ative", + "Ġp x", + "Ġseed ing", + "cri pts", + "ine z", + "ome res", + "Ġsib lings", + "ang ing", + "fer t", + "Ġrecover ing", + "p ure", + "Ġs d", + "ĠV ul", + "ped ance", + "Ġfight ing", + "S uper", + "ĠI to", + "Ġper imeter", + "ĠInhib itors", + "electro de", + "en abled", + "f b", + "ĠP Cs", + "Ġn ausea", + "ĠCon version", + "Ġsl a", + "Ġinver tebrates", + "ĠBri an", + "Ġcontig uous", + "ĠACKNOWLED GM", + "ur face", + "Ġco ars", + "ĠLe h", + "ĠComp ression", + "cy cles", + "Ġsin h", + "ĠOcc up", + "st rength", + "Ġcon str", + "Ġpestic ide", + "Ġb isp", + "ĠT n", + "Ġparent heses", + "deg rad", + "Ġhypergly cemia", + "P W", + "k j", + "ec ological", + "Ġth y", + "Ġele g", + "ĠSyn aptic", + "scal ed", + "ti ty", + "Ġequ ity", + "Ġblock chain", + "ĠLith ium", + "Ġsp ark", + "Ġen titled", + "Ġconven tions", + "Arg ument", + "Ġre tail", + "Ġne oplastic", + "Ġdamp ed", + "ĠSurve illance", + "ĠAn na", + "Ġspace times", + "ing es", + "ah ashi", + "ĠInf ections", + "Ġneglect ing", + "Ġevapor ated", + "vast atin", + "Ġg h", + "ĠN LP", + "Ġph ones", + "Ġlif ted", + "Ġdivis ible", + "Ġdur ability", + "os ited", + "Ġexcit ability", + "Ġbuoy ancy", + "Ġuncont rolled", + "b ran", + "ĠP he", + "Ġimmun ocomp", + "Ġevent ual", + "Ġclass room", + "Ġmicro graphs", + "Ġre charge", + "et tes", + "ĠD iver", + "ĠD all", + "Ġmet ac", + "Ġneuro endocrine", + "top ology", + "ĠHaw king", + "oms on", + "ĠHar ry", + "m outh", + "Ġdec iding", + "Ġunc overed", + "Ġgold en", + "ĠCast le", + "Ġfid ucial", + "A ware", + "ĠG an", + "era hertz", + "ĠSat urn", + "L N", + "Un it", + "ĥ Ĺ", + "Ġbind er", + "IN FO", + "ĠTem per", + "ip el", + "Ġnumer ator", + "Ġwebs ites", + "Ġthreat ened", + "Ġremn ants", + "ĠFinn ish", + "h of", + "med ia", + "concent ration", + "ĠRe ed", + "ĠLeishman ia", + "Ġmulti functional", + "rac y", + "Ġdistrib ute", + "ĠDec ay", + "Ġgr inding", + "L oss", + "MP L", + "ĠL akes", + "ĠQ R", + "ĠStruct ured", + "ĠMal aria", + "Ġflavon oid", + "Ġtow ns", + "op ia", + "ĠV ec", + "oth y", + "Ġsing les", + "Ġpenet rate", + "ĠP ig", + "ie ved", + "Ġderiv ations", + "Ġdiscom fort", + "af enib", + "ĠLegend re", + "ĠP ax", + "ĠM X", + "ĠExt rem", + "ĠFore ign", + "ĠCour se", + "ĠH it", + "v age", + "Ġcl ique", + "Ġcompens atory", + "U ser", + "Ġdraw s", + "ĠProt ective", + "Ġalloc ate", + "ĠP ant", + "Ġd ash", + "Ġpar al", + "ĠCirc ulating", + "ĠHist one", + "ĠÅ «", + "Ġproj ec", + "ĠA AA", + "ĠP MS", + "gl acial", + "ĠMe eting", + "ĠAntib iotic", + "ategor ical", + "Ġatten uate", + "P ower", + "ow icz", + "ĠDef ault", + "Ġmar sh", + "plas m", + "ĠPath ology", + "ĠE f", + "L ys", + "fl ies", + "Ġinterview ed", + "ĠQ A", + "Ġimp uls", + "Ġpap illary", + "d R", + "u h", + "ĠJ ing", + "Ġrescal ed", + "e fficiency", + "Ġe f", + "ĠE isen", + "Ġattack ed", + "Ġopt o", + "Ġspec ulated", + "ha z", + "Ġide ally", + "ymen optera", + "Ġl r", + "ĠI z", + "res ource", + "ĠFac ility", + "ĠAc quisition", + "Ġpost ural", + "auti ful", + "Ġging ival", + "Ġper taining", + "ĠExt ra", + "ĠProgram me", + "hes us", + "ferm ion", + "Ġstead ily", + "Ġtermin us", + "P arser", + "ĠIn clusion", + "ĠWu han", + "Ġrepe titions", + "d one", + "ĠC ep", + "Ġun structured", + "ĠCol lectively", + "Ġsett ling", + "Ġj aw", + "ĠUn i", + "Ġrest oring", + "urt les", + "F ull", + "Ġdynam o", + "IG O", + "ĠB AT", + "ov á", + "ven ues", + "ĠPer haps", + "sens ing", + "ĠI schem", + "odem ographic", + "S s", + "ĠL und", + "Ġel ite", + "prot ocol", + "ĠChrist opher", + "bas ic", + "Ġp uber", + "Ġmagne tism", + "v ars", + "in ducing", + "Ġd ated", + "Ġen emy", + "ĠSt op", + "s ocial", + "Ġd ÏĦ", + "ĠB un", + "Sm all", + "pur pose", + "Ġh unting", + "CP U", + "ĠJun ior", + "RE L", + "Ġcontrac tile", + "Ġsilic one", + "adren ergic", + "b z", + "Ġf us", + "if ted", + "se p", + "âĪĴ âĪŀ", + "Ġdr um", + "-------- --", + "ĠTreg s", + "it arian", + "cent ury", + "âĬ ¥", + "Num er", + "ĠB enz", + "Ġcommunic ating", + "Ġp aternal", + "ĠF GFR", + "Ġâ Ĥ¬", + "Ġdevi ate", + "f re", + "Ġmol ten", + "Ġstandard ization", + "Ġfunctional ities", + "ĠPaul o", + "Ġbuck et", + "ĠConcent rations", + "ĠK um", + "Ġmim icking", + "D rop", + "zo a", + "ĠNucle i", + "b rack", + "ec olor", + "Ġcar n", + "Ġveter inary", + "Ġchem otherapeutic", + "Ġfer ment", + "last ing", + "ĠRog ers", + "ier i", + "Ġconver ters", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠ", + "ĠRep air", + "Eu rope", + "T IME", + "Ġt ies", + "ĠP IN", + "Ġtrib ut", + "Ġhomogen ization", + "exc itation", + "at ization", + "ĠR ash", + "Ġpre cession", + "á s", + "Ġspik ing", + "ĠGrass mann", + "min ister", + "Ġfactor ial", + "ĠDe ut", + "sam pled", + "Ġeukary otes", + "overl apping", + "ag glut", + "Ġpres cribing", + "Ġc ro", + "om echanical", + "iz a", + "ĠMan ufact", + "n ative", + "urs ive", + "ĠIss ues", + "Ġstrept omycin", + "en di", + "ĠS pr", + "ce q", + "arg inine", + "ix on", + "ĠFound ations", + "Sing le", + "Ġox al", + "Ġhyd rate", + "Iter ator", + "k ii", + "amin ated", + "Ġspr ings", + "ol n", + "ĠSet up", + "Ġrip ening", + "Ġtheore tic", + "Ġcf g", + "μ L", + "G ordon", + "S K", + "Ġn ations", + "Qu ery", + "Ù ħ", + "Ġf ores", + "requ encies", + "ĠPh armaceutical", + "ĠAll ocation", + "otyp ical", + "ĠPil ot", + "th ora", + "ĠV and", + "Ġsyring e", + "ĠR AP", + "rom etric", + "Ġïģ ´", + "Ġcit ations", + "wo uld", + "Ġnorthe astern", + "compar ison", + "l ocus", + "et he", + "ĠK B", + "Ġhomolog s", + "Ġencephal itis", + "Ġz ig", + "Ġinc entive", + "Ġconf idential", + "Ġves tibular", + "ĠOT Us", + "Ġsynov ial", + "ĠRel ativity", + "Ġsub divided", + "che z", + "Ġlik ewise", + "ĠPD MS", + "ĠÅ ł", + "Ġsoci eties", + "ocyan ate", + "g ia", + "Ġlocal ize", + "Ġlact ation", + "Ġnod ule", + "ĠCO R", + "Ġharbor ing", + "ĠE QU", + "har vest", + "Ġband gap", + "r k", + "Ġres istor", + "Ġy e", + "ĠAs ymmetric", + "Ġpropag ators", + "Ġdiagnos ing", + "ĠAff airs", + "Ġeject a", + "Ġis omer", + "Ġi x", + "Ġfol iation", + "Ġcapac itors", + "Ġc ad", + "ĠNeut roph", + "pl iance", + "Ġcompress ible", + "ĠHun ter", + "ĠM Z", + "ĠWe ib", + "Ġnon coding", + "Ġmountain s", + "Ġadver tising", + "ale z", + "b right", + "lim sup", + "C i", + "ĠNe v", + "ĠStrain s", + "ost omy", + "op al", + "Ġconcaten ated", + "ĠPer f", + "CH O", + "Ġt urtles", + "ĠF ra", + "Ġall ogeneic", + "Ġuns uccessful", + "Y M", + "er ver", + "Ġc uc", + "Ġf ires", + "ch art", + "Ġinter rupted", + "Ġdec ides", + "Ġa uction", + "ĠUn til", + "ĠAT G", + "Ġdi am", + "magn itude", + "Ġd l", + "Ver tex", + "mon t", + "Ġfem tosecond", + "Par ams", + "Ġlys ate", + "is hers", + "ĠP AT", + "ĠK ev", + "ĠKn ock", + "Ġgro ove", + "L u", + "ĠJoh ann", + "Ġreplic a", + "ĠMATERIAL S", + "Ġl ots", + "Ġgener ically", + "ĠAl tered", + "ĠId entity", + "Ġunfold ed", + "C ES", + "ing ular", + "ĠF raction", + "ĠPro liferation", + "ĠVi enna", + "ac ia", + "pl ess", + "ĠSe vent", + "Ġturb ines", + "lys ine", + "Ġperox is", + "AR P", + "ĠEp is", + "ĠSY BR", + "Bu ilder", + "Ġspher ically", + "Ġdef end", + "Per formance", + "Ġmort ar", + "ĠCon cepts", + "work s", + "Ġreinfor ce", + "á ¹", + "Ġc us", + "ĠC IF", + "ĠAgric ultural", + "c rystalline", + "r ish", + "Ġref erenced", + "Ġact ress", + "Ġbounded ness", + "Si C", + "Ġà ¢", + "Ġj ack", + "Ġterm inate", + "ĠJ A", + "ĠKr ish", + "M MP", + "k x", + "ĠP SR", + "end l", + "W HO", + "ĠS ão", + "ĠC ultural", + "ĠE h", + "ul is", + "vi k", + "pr ises", + "ix el", + "ĠMet rics", + "Ġdiscontinu ities", + "ĠU ne", + "SC R", + "Ġproject ing", + "ĠOrig inal", + "ĠHum ans", + "transcription al", + "H K", + "ĠJ ain", + "atisf action", + "mes enchymal", + "Ġpyram id", + "Ġascorb ic", + "g ame", + "Ġno un", + "otox ins", + "p eptide", + "Ġglass y", + "Ġtalk ing", + "D em", + "ĠSch ro", + "ĠAssum ptions", + "Ġð x", + "Ġaneurys ms", + "M ASS", + "ĠH ou", + "ex posure", + "ĠL LC", + "Ġno ises", + "CT G", + "ĠElement ary", + "fl ip", + "Ġdys p", + "Ġmess enger", + "ĠImport ant", + "Ġim poses", + "Ġorgan elles", + "assert Equal", + "Ġjus tif", + "uc ine", + "Ġform ic", + "ormal ization", + "ĠRad ial", + "ĠCur ve", + "ĠCro hn", + "Ġbrow ser", + "Ġeff usion", + "Ġhand les", + "var sigma", + "Ġspecial ists", + "Ġpain ful", + "Ġerythemat osus", + "Ġf en", + "nitrop henyl", + "Ġleg acy", + "ĠQ Ds", + "rap per", + "Ġmon otherapy", + "ĠBel t", + "Z Z", + "Ġs intered", + "en edi", + "H b", + "t v", + "ĠN as", + "ov is", + "Ġmuc in", + "Ġacceler ates", + "Ġacqu iring", + "l uc", + "Ġdil aton", + "ĠPit ts", + "Ġequiv ariant", + "ĠL yman", + "ĠY a", + "Ġprog ressed", + "ĠAfter wards", + "ĠCH AR", + "D on", + "Ġhist ologic", + "Ġcircuit ry", + "p ene", + "op res", + "ĠSte fan", + "Ġsemic lassical", + "m und", + "ĠW aste", + "B Q", + "Ġadip onectin", + "Ġun seen", + "Ġbiom echanical", + "Ġhazard ous", + "r uctive", + "x yl", + "op f", + "Ġpr ion", + "ĠInf inite", + "Ġtrac ers", + "ĠHar rison", + "Ġfibrin ogen", + "Ġhydro lys", + "Ġis lets", + "Ġparallel ism", + "Sp ect", + "Ġimper ative", + "Ġc ured", + "ĠD SB", + "ide finite", + "ick er", + "Ġdiver gences", + "ĠShap iro", + "ab d", + "ĠL um", + "ĠV D", + "Ġf isheries", + "ge on", + "cop enia", + "ĠCl ay", + "Ġmaxim ized", + "ĠGre y", + "ĠB atch", + "Ġinf est", + "Ġam ple", + "Ġest ate", + "ĠSup reme", + "A O", + "is ia", + "ĠSm ad", + "Car lo", + "ĠSub st", + "Ġmon oidal", + "Ġnumer ic", + "Pl ot", + "Ġdyst rophy", + "hypert ensive", + "Ġst ool", + "als y", + "Ġche ese", + "n ih", + "Ġb ought", + "ĠS Q", + "Ġcl ues", + "Ġme iotic", + "Ġgo ats", + "ĠGTP ase", + "Ġrescal ing", + "N UM", + "ic ing", + "ĠÄ Ģ", + "Ġpret ty", + "lig and", + "En glish", + "ĠIntellig ent", + "E very", + "ĠPoli tical", + "ent on", + "Ġpass ages", + "ĠRemark s", + "s b", + "N etwork", + "ĠL RR", + "Ġcur l", + "urs ion", + "ĠA ver", + "ĠG LP", + "here n", + "at an", + "IC ENSE", + "Ġlate x", + "E MI", + "qu asi", + "ĠO m", + "Ġreview ing", + "Back ground", + "Ġs om", + "Ġsnap shots", + "b row", + "w ho", + "ĠT ail", + "ĠM SM", + "ĠG m", + "Ġph i", + "ren cy", + "separ ated", + "Ġg ig", + "os ides", + "Ġpe an", + "Ġappe aling", + "P U", + "n k", + "Ġqu er", + "ĠCh arg", + "ĠMo lecules", + "local ization", + "I dx", + "l ap", + "ĠT ax", + "ĠExp onential", + "ĠInhib itor", + "ĠBiom edical", + "ureth ane", + "le rene", + "rogen esis", + "ĠL ai", + "ĠAgg regation", + "ĠCa Cl", + "Ġsens ible", + "Ġcon junc", + "pa per", + "ĠCov id", + "ĠProced ures", + "Ġk new", + "Ġset ae", + "ĠAl le", + "ĠEx cept", + "Ġpres ynaptic", + "flow er", + "Ġultrason ography", + "Ġent ertain", + "i ors", + "ĠE ry", + "ĠIn teger", + "Ġrep ressor", + "Ġlater ally", + "Ġcomplement ed", + "T AG", + "ĠA round", + "ĠL ister", + "bit rary", + "back ward", + "Me V", + "Ġwh isk", + "AM s", + "ĠBul k", + "Ġqu iver", + "Ġdam aging", + "ĠQuantif ying", + "Ġsup rem", + "t el", + "Ġt ear", + "ot ers", + "vid in", + "Ġtub ules", + "Ġips ilateral", + "is ive", + "Ġsuit ably", + "ri el", + "Ġtub er", + "Ġfav ors", + "Ġcen tim", + "Ġtrans versal", + "ĠCH O", + "Ġtrim ester", + "C AC", + "c ognitive", + "ĠU TC", + "put e", + "Ġmid line", + "am ers", + "eval uation", + "D av", + "Ġb ags", + "tim er", + "Ġshort comings", + "ĠEr d", + "Ġdiscrim inator", + "A nt", + "s izes", + "Ġb ist", + "ing ual", + "ĠC ategory", + "Ġpuls ars", + "ĠSchw artz", + "ĠD rop", + "Sequ ence", + "Ġt ann", + "ĠSympt oms", + "D ict", + "ĠB lu", + "Sup plemental", + "Ġdis abled", + "ĠK oz", + "Ġinv oked", + "ĠC Q", + "ĠConn ectivity", + "Ġtelescop es", + "os o", + "Ġphyt ochemical", + "Ġorthogon ality", + "Ġinvis ible", + "ĠS CF", + "ĠA void", + "ĠH us", + "mic ron", + "atern ity", + "Pro ject", + "Ġadv ancing", + "ĠLorentz ian", + "S a", + "t Ãŀ", + "ĠU P", + "Ġar ts", + "Ġz er", + "ask et", + "Ġappe al", + "n ick", + "ĠCl oning", + "Ġsw ap", + "Ġphospholip ids", + "b g", + "ot hel", + "asc o", + "T rack", + "Ġsub manifold", + "Off set", + "ĠB ird", + "problem s", + "D Cs", + "Ġd ow", + "Ġde ionized", + "Ġsub class", + "Ġpubl ishing", + "ĠCar ter", + "Ġsyn ergy", + "Ġweak ened", + "ĠGl as", + "ĠP ie", + "hen ko", + "Ġsetup s", + "ĠBern stein", + "Ġà ¿", + "ĠSh u", + "ĠChang ing", + "os ov", + "ĠMet eor", + "in th", + "ra h", + "par amet", + "ren a", + "Ġnew borns", + "isc he", + "rot ating", + "Ġconf ident", + "f ac", + "ĠT err", + "Ġline width", + "IC P", + "thon y", + "Ġl anes", + "Ġsm oother", + "mon y", + "ĠCN Ns", + "P ort", + "Ġtrans iently", + "Ġsur geries", + "Ġsubm erged", + "Ġp uncture", + "Ġd ichlor", + "Ġsystematic s", + "Ġcontig s", + "Ġresid ing", + "B W", + "E O", + "G old", + "ion ate", + "voc ab", + "d W", + "ST AR", + "ĠP LC", + "ath i", + "ĠInf ectious", + "L ight", + "á »", + "ĠR al", + "Ġpropag ates", + "ĠLik elihood", + "h ill", + "cur l", + "check point", + "ra x", + "Ġv ancomycin", + "ĠU SD", + "ophe les", + "Ġfil tr", + "Ġstoichi ometry", + "âĶĢ âĶĢ", + "ĠN ad", + "access ible", + "Ġto y", + "Ġn ude", + "ĠS ut", + "ess ential", + "ĠO L", + "Ġper tin", + "Ġrec ur", + "Ġcap ill", + "Ġcomput able", + "Ġsuc tion", + "Ġsoft ening", + "ĠE SI", + "Ġmon itors", + "Ġpy ridine", + "ĠSens ors", + "ĠCombin atorial", + "at ta", + "ĠA MS", + "ĠD ul", + "ple teness", + "E th", + "Ġà »", + "Ġexc ised", + "ĠDiab etic", + "ĠI owa", + "Ġimmunost aining", + "Ġillness es", + "Ġenum er", + "ĠIran ian", + "Ġth umb", + "orphism s", + "Ġlegitim ate", + "l g", + "ĠS VD", + "Ġdes k", + "Form at", + "B on", + "Ġg arden", + "Ġinter personal", + "Ġel bow", + "ĠDem onstr", + "Ġnons pecific", + "F erm", + "ival ently", + "phthal ene", + "AR GET", + "Val id", + "Ġsun light", + "Ġresc ued", + "D AR", + "ĠIn variant", + "Ġid le", + "Ġalkal oids", + "scal es", + "s es", + "ob icity", + "be at", + "Ġcentrifug al", + "analy tical", + "p v", + "Ġt utorial", + "ĠN ation", + "gener ator", + "Ġcollision al", + "ĠC ME", + "Ġsc rap", + "ĠQ SO", + "Ġw ax", + "ĠSc enario", + "Ġminim izer", + "ĠMD PI", + "Ġprostagland in", + "ol ites", + "ocy steine", + "Ġcompac tification", + "Ġfrail ty", + "ops in", + "Ġjun ior", + "lo ud", + "Ġtit led", + "Ġeconom ically", + "th iophene", + "ĠInvestig ating", + "ĠE sp", + "Ġel usive", + "Ġmal ware", + "ĠTH P", + "imid azole", + "Ġre tains", + "ĠM IR", + "ff l", + "j ac", + "ĠP ART", + "ĠD CM", + "trans port", + "MAP K", + "Prob lem", + "S u", + "Ġdel im", + "Ġpsych ometric", + "vit ably", + "Ġhyper geometric", + "Ġuter us", + "Ġanaest hesia", + "ĠA venue", + "Ġmean ings", + "Ġrapid ity", + "Ġdend rites", + "g rain", + "ĠN ile", + "Ġfac ies", + "Ġpip elines", + "ĠCamp ylobacter", + "ĠMemb ers", + "benzo ate", + "Requ est", + "Ġp k", + "Ġref used", + "c aus", + "ĠS ay", + "l ane", + "ĠP SO", + "Ġgather ing", + "Ġrefrig er", + "R CC", + "Ġfib ronectin", + "hel p", + "ĠInt ensity", + "CL C", + "Q ue", + "el ly", + "Ġillumin ated", + "Ġpedest rian", + "ĠM ercury", + "Ġafford ed", + "Ġpathophys iological", + "ĠN GS", + "ass a", + "Ġend ors", + "Ġsens ation", + "Ġstream flow", + "av in", + "ĠGABA ergic", + "Ġreti rement", + "C ells", + "oc a", + "Ġoptim izations", + "Ġdig raph", + "ĠAu tism", + "oct urnal", + "osc ience", + "ĠEll is", + "ĠA j", + "ĠW SN", + "Ġshoot ing", + "i per", + "î Ħĥ", + "ĠWe ather", + "Ġrece ptive", + "Ġquar tic", + "ocycl ic", + "P ATH", + "size of", + "Ġmel ts", + "Ġdip oles", + "Ġbim odal", + "summ ary", + "Ġins omnia", + "opy ran", + "Ġwrap ped", + "ĠJos é", + "A H", + "c ia", + "Ġob eys", + "ĠK ay", + "inter vention", + "Ġrout er", + "ĠDrug s", + "ow ska", + "ĠAr r", + "ĠCap tain", + "ĠT MS", + "ad v", + "Ġbo at", + "Ġtrust ed", + "se ver", + "ill ars", + "ĠMiss ouri", + "Ġequival ents", + "ĠHar vard", + "ĠClark e", + "reson ant", + "rad y", + "trig gered", + "Ġc left", + "Ġun ic", + "Ġbrain stem", + "Ġthrom bin", + "ĠF light", + "Ġsection al", + "Ġconcaten ation", + "Ġcantile ver", + "et on", + "Ġdec ode", + "of acial", + "Ac tion", + "ĠIll ustration", + "ver tical", + "ch all", + "ĠReg istry", + "M AT", + "Ġcons on", + "Ġneo adjuvant", + "ĠW istar", + "ĠIm per", + "Ġal titudes", + "Ġsub population", + "ĠSc ene", + "tensor flow", + "s low", + "Ġh int", + "Ġbeam forming", + "e in", + "Ġimp regn", + "ĠRF ID", + "ĠAnaly zing", + "ĠP ent", + "ĠD NS", + "ĠG ilbert", + "Ġcr ater", + "Compar ing", + "Ġb f", + "Ġfl ights", + "Ġmal nutrition", + "SM C", + "Ġeryth rop", + "ĠTum ors", + "T x", + "Ġis ospin", + "ĠK ub", + "ik ing", + "Ġcorticoster oids", + "urs or", + "ĠBur g", + "in spired", + "ĠI gn", + "Ġmy cel", + "pred iction", + "method s", + "C opy", + "ĠR W", + "ĠK night", + "Ġdem ethyl", + "ì Ħ", + "Ġc ili", + "Ġb es", + "ĠE ck", + "Ġdilat ation", + "Ġan imation", + "ab stract", + "Ġcircum vent", + "Ġinoc ulum", + "S eg", + "ĠC aps", + "ere rs", + "PL S", + "ĠPe er", + "Ġver ifies", + "ateg y", + "ogene tics", + "Ġoligonucle otides", + "rac tical", + "Ġdiver ges", + "ĠStan ford", + "ĠA i", + "Ġweigh ing", + "T g", + "re infor", + "ĠA lam", + "qu iry", + "ĠN ob", + "Ġlinear ization", + "ĠV enez", + "ne xin", + "level s", + "L ip", + "ĠPat el", + "ĠMagn itude", + "e titive", + "ĠE agle", + "Ġsp utum", + "ĠCO S", + "Ġincub ator", + "U l", + "ĠRec eptors", + "ĠSch ott", + "GC G", + "ĠZe iss", + "ĠEnt anglement", + "ĠVacc ine", + "or ted", + "Ġn b", + "ĠS j", + "ĠM rs", + "Ġcal f", + "Ġinte grability", + "ĠPh oton", + "Ġgon dii", + "ĠM IL", + "Ġal iph", + "ĠD ip", + "fall s", + "c trl", + "k u", + "et ent", + "pl t", + "Ġpers isted", + "ĠMan ager", + "Ġprerequ isite", + "f illing", + "ĠM EA", + "S ym", + "ĠG rain", + "Ġduct al", + "ĠT ODO", + "Ġaff inities", + "Ġdegener ative", + "ĠF itz", + "ov ar", + "ĠTri ple", + "Ġdend rim", + "ĠFrank lin", + "m ag", + "ot ely", + "Ġstabil izes", + "Ġc ash", + "ĠS quad", + "Ġch ampion", + "PD B", + "Ġur g", + "Ġalcoh olic", + "Ġt ar", + "yl ed", + "V ersion", + "Ġs ale", + "ĠM LP", + "out er", + "Ġsimpl ifying", + "ĠExt ract", + "Par am", + "ĠRest ric", + "Ġtract able", + "ĠArch ive", + "Resp onse", + "AD DR", + "Ġcommut ation", + "R ich", + "ĠAndrew s", + "Ġosteocl ast", + "rom ic", + "ĠSh ift", + "Ġacceler ometer", + "ĠS ent", + "Ġch ances", + "ost ing", + "Ġmeth acrylate", + "Ġglu ons", + "Ġôı ½", + "Ġpolyg ons", + "ĠRCT s", + "Ġinf ancy", + "Ġproceed ed", + "ĠHor izontal", + "C OR", + "Ġc aching", + "ĠN HS", + "ph obic", + "ĠX MM", + "Ġmicrobi ological", + "G MP", + "Ù Ĩ", + "ĠT SS", + "ĠS ul", + "ĠF act", + "ĠW E", + "Ġcertain ty", + "ens itivity", + "Ġdecon volution", + "ĠG ain", + "Ġbl ots", + "Ġsee ks", + "Ġcos h", + "ennes see", + "Ġsl ave", + "ĠT ran", + "Ġtrans pose", + "re ated", + "Ġsh ading", + "ĠB U", + "ĠO V", + "ĠLo ok", + "Ġcomprehens ively", + "ĠFred er", + "Hand ler", + "f ibr", + "Ġmiss ense", + "target s", + "prom oting", + "ĠP ep", + "var pi", + "ĠHar monic", + "ĠA IS", + "Ġmon ocyt", + "Ġthin ning", + "Ġpherom one", + "W ater", + "an ase", + "ĠS ang", + "Ġsub structure", + "w p", + "ĠK ansas", + "DE BUG", + "ĠPro be", + "Ġpattern ed", + "cle an", + "Ġbro iler", + "odext rin", + "a ided", + "op rol", + "ubl in", + "in um", + "Ġan atomic", + "Ġpl ating", + "ar ro", + "uc al", + "Ġspeed up", + "Ġhaem orrh", + "eptid ase", + "Ġs agittal", + "Ġin tim", + "ĠF ISH", + "Ġsc arc", + "AT CC", + "inc or", + "Ġser ological", + "ent e", + "Ġsh ale", + "Ġover fitting", + "ĠEx cess", + "ĠAL P", + "P ool", + "d ry", + "y u", + "ĠPM MA", + "ĠHyp oxia", + "n othing", + "chest ra", + "colone qq", + "Ġb ibli", + "ĠEX PECT", + "B AL", + "et han", + "ĠâĪ ĺ", + "Ġj ourney", + "Ġbi ocompatibility", + "P AN", + "Ġb on", + "ĠR oh", + "Ġpolar isation", + "Sp in", + "id ences", + "ĠB CR", + "ĠH IP", + "ĠTh ick", + "Ġrecogn izes", + "Ġs ar", + "Ġam end", + "ques tions", + "Ġcareg iver", + "ĠMari e", + "Ġmetalloprotein ase", + "Ġal dehydes", + "Ġinter neurons", + "Ġtetra hedral", + "gue z", + "Ġquasipar ticle", + "Ġo t", + "decre asing", + "st re", + "Ġphot operiod", + "Ġprior iti", + "Ġap o", + "Ġimmunosup pression", + "ĠPier re", + "L PS", + "Ġcl umps", + "ĠPl ane", + "Ġturb idity", + "Ġpollut ant", + "Ġbi och", + "ĠT RE", + "Ġdesign ers", + "Ġrend ers", + "Ġrepl aces", + "ĠP LS", + "Ġhum oral", + "B as", + "re ira", + "ĠA edes", + "vit amin", + "cur ves", + "ocic eptive", + "Ġin disp", + "Ġox y", + "Ġed ible", + "ĠMes enchymal", + "ĠDeg ree", + "Å ¾", + "ĠO ak", + "ĠBhat t", + "on so", + "ĠS BP", + "ĠA ux", + "Ġmar tingale", + "ĠMicrobi ota", + "g low", + "Ġex ud", + "ap olis", + "Ġsome how", + "Ġcent red", + "Ch annel", + "ĠNormal ized", + "il itation", + "Ġtranscript ase", + "Ġcry o", + "predic ted", + "ĠD AG", + "Ġr f", + "end or", + "INT ER", + "ĠMes h", + "ĠFund ament", + "y cle", + "Ġprim itives", + "radi ated", + "Ġr ho", + "enes ulf", + "ĠF SH", + "ĠE cos", + "local ized", + "Ġenter prise", + "cephal us", + "Ġcarc ass", + "A Y", + "ec urity", + "ĠT MD", + "Ġl b", + "ĠA eros", + "ĠM ER", + "At tr", + "ĠA CL", + "ĠBar b", + "c out", + "Ġde oxy", + "ati os", + "Ġpers ists", + "Ġviol ent", + "Ab elian", + "Ġell ips", + "ion g", + "Ġsuccess or", + "ĠGonz ález", + "l iving", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠ", + "iment in", + "Ġcaps ules", + "V IS", + "ĠP OP", + "arithm ic", + "O O", + "w l", + "ino ic", + "ĠCent ers", + "robl asts", + "th ose", + "ĠM J", + "Ġfron ts", + "Ġun int", + "Ġfac ile", + "co herent", + "av our", + "cep tive", + "ta h", + "Ġrelated ness", + "d E", + "un gen", + "## ###", + "Ġam phi", + "ĠGu y", + "st ars", + "ect om", + "Ġlay ing", + "Ġsp ider", + "AC s", + "Ġseed ling", + "Ġdu plicated", + "ic he", + "ĠM ST", + "gr ass", + "Ġprophyl actic", + "e ks", + "Ġl aryngeal", + "ĠS per", + "ĠW als", + "Ġcho lec", + "ĠPlan et", + "ĠHEP ES", + "Ġdi ploid", + "const raint", + "Py x", + "AC h", + "ĠCu i", + "ĠSh ared", + "ĠC and", + "ĠG ö", + "Ġdet ached", + "Ġpass engers", + "Ġaliph atic", + "Ġp our", + "Ġaccess es", + "ĠWal d", + "Ġdecor ated", + "Ġcaroten oids", + "ues tions", + "ĠImp acts", + "S AT", + "ar u", + "ĠP ir", + "ĠCon figuration", + "ĠCong o", + "ĠL ing", + "Ġdes ic", + "Ġmac rom", + "Ġlack ed", + "Ġencompass es", + "Ġp umped", + "ĠFor ty", + "rex ate", + "ifferenti ated", + "Ġn oble", + "Ġrad ion", + "Ġimmig rants", + "Ġbiodegrad able", + "Ġmig rating", + "arg v", + "CO M", + "ĠObserv ational", + "Ġcann abis", + "y ama", + "Ġconcent ric", + "Con n", + "tal ion", + "Ġrespond ers", + "uten ant", + "ĠT rim", + "Ġcontrib utors", + "Ġcontrac ted", + "ĠXen opus", + "Ġlo ud", + "ĠEnh ancing", + "Ġinfarc t", + "Ġo k", + "Ġas ks", + "rel in", + "Ġillustr ative", + "vd ash", + "d g", + "Ġf oc", + "Ġl ivers", + "ĠO tt", + "ĠT SP", + "log ger", + "depend ing", + "Ġdis proportion", + "Ġint ric", + "Ġimmun ized", + "vare z", + "Ġsal ic", + "ĠInstit utes", + "KE Y", + "Ġend oscopy", + "er k", + "el iness", + "ĠS ag", + "ath yroid", + "Ġacid ity", + "aro v", + "ĠVor onoi", + "Experim ental", + "Ġg ently", + "Me asure", + "ïĺ º", + "Ġw onder", + "ĠP ancreatic", + "ĠH ispanic", + "ĠE ug", + "re ducing", + "tain ment", + "Ġsur prise", + "Ġ æ", + "cr iter", + "ĠHypert ension", + "ti que", + "ĠC ris", + "comp atible", + "ens on", + "Ġdistribution al", + "ĠN AT", + "wid ths", + "Ġisother ms", + "ĠP rad", + "Ġbi odies", + "Ġorb ifold", + "ĠE OS", + "Ġat ax", + "ĠB od", + "ĠN MD", + "Ġmon oxide", + "ĠUk raine", + "f oli", + "ĠD ro", + "Ġun available", + "Ġbr ighter", + "âĬ Ĺ", + "ometh ane", + "Ġd ream", + "Ġsp o", + "ĠMa ur", + "Ġoccas ional", + "Ġincons istency", + "ĠT ac", + "op ts", + "ĠG AB", + "ĠTa o", + "ĠMatthe w", + "à ½", + "Ġp iano", + "ĠR CC", + "ĠO K", + "ĠK ul", + "met han", + "ĠPRO C", + "Ġconvers ations", + "ĠC SI", + "ang ent", + "ĠX ue", + "Ġgraph ic", + "den ing", + "health y", + "Ġf p", + "az one", + "Ġdiscipl ine", + "Ġprogress es", + "Ġb amboo", + "Ġchar m", + "ĠAc tivated", + "ĠSh arp", + "yn es", + "Ġtool box", + "Ġhetero structures", + "piper azin", + "Ġa rose", + "ĠInter val", + "Ġstrip e", + "ĠCh ak", + "Ġc uff", + "RE SS", + "Ġnon uniform", + "Ġbeet le", + "P rec", + "z c", + "Th read", + "b et", + "Ġe e", + "ĠOption al", + "Ġt roph", + "ĠP uer", + "ĠF ron", + "Ġmultiple t", + "Ġcalor imetry", + "Ġmonocyt ogenes", + "ĠH imal", + "Ġdr ill", + "AG A", + "Ġferr itin", + "Ġd pi", + "ĠC arm", + "Ġg one", + "Ġun idirectional", + "Ġrem inis", + "Ġadjust able", + "ĠAust in", + "S ARS", + "d al", + "Ġc ef", + "equiv ariant", + "bas eline", + "Ġspin ors", + "ĠPr int", + "Ġm ile", + "ĠL inc", + "mut ation", + "Ġmuc us", + "ĠH SC", + "Ġtherm od", + "Ġpain t", + "Ġdistinct ly", + "ath y", + "Ġph armacy", + "ĠBul g", + "ĠG ang", + "hic le", + "og an", + "ĠJ ian", + "ĠIndian a", + "Ġinstant on", + "Ġpall adium", + "f iber", + "n py", + "ĠU A", + "ĠQ T", + "cepti ble", + "et ine", + "ĠH oles", + "Ġdepend ences", + "Ġthreshold ing", + "ĠMain tenance", + "Ġparticip ates", + "ĠGen omes", + "factor ial", + "ĠL iber", + "ĠTherm odynamic", + "Ġe lective", + "uc her", + "Ġhyper ther", + "Ġstom atal", + "ĠB irth", + "ch olesterol", + "Ġnot ch", + "Ġsym biotic", + "Ġbusiness es", + "Ġapprec iable", + "Ġspecial ization", + "á r", + "act yl", + "ĠGraph Pad", + "os per", + "Ġor chestr", + "Ġdi hydro", + "Ġconcl uding", + "CL K", + "Ġeq s", + "ĠProg ression", + "Ġclub s", + "ak u", + "ev ents", + "Ġspl enic", + "Ġb unch", + "ĠT m", + "ĠM obility", + "Ġtwo fold", + "Ġradi ally", + "L STM", + "M H", + "ĠCo al", + "Ġfron tier", + "J an", + "J un", + "ĠSim pson", + "Ġabst racts", + "P al", + "Ġun im", + "Ġro bo", + "ĠII B", + "dep leted", + "Ġmorphological ly", + "Ġenfor cement", + "Ġd well", + "Ġst agn", + "Ġlim estone", + "Ġmicro v", + "Ġïĥ ¸", + "L uc", + "p acs", + "cy ano", + "Ġintra ocular", + "ĠCalc ulate", + "Sup port", + "SY S", + "ĠV S", + "CM s", + "Const ant", + "ĠD j", + "Ġun balanced", + "Ġrepeat ability", + "g ins", + "i rect", + "ĠM OR", + "ĠBa iley", + "Ġadvance ment", + "Ġpurs uit", + "Ġa rom", + "pro ced", + "ĠIniti ative", + "Ġincenti ves", + "Ġsur pass", + "gen es", + "ĠIN D", + "L H", + "Ġsu icidal", + "Ġbiodies el", + "x z", + "Ù Ĭ", + "le a", + "ĠAn thony", + "Lear ning", + "Ġund o", + "Ġïĥ º", + "ĠCommun ities", + "h ua", + "iti me", + "ĠDe an", + "Ġplas min", + "ÃŃ nez", + "ohyd rate", + "Ġneurode velop", + "Ġstoichi ometric", + "ĠOnc ology", + "Ġshow er", + "ĠD MS", + "W OR", + "ĠP IP", + "Ġster ic", + "mitte es", + "ist ol", + "ox ins", + "no on", + "FF T", + "Ġá »", + "opo iesis", + "Ġresemb ling", + "ĠB ord", + "Ġprob iotics", + "ocy sts", + "gre y", + "ĠCatal og", + "IZ ATION", + "ill es", + "ĠAl an", + "ĠÅ ·", + "ĠLe ib", + "ĠReason ing", + "bi ological", + "uter ine", + "vac izumab", + "lecom mun", + "ĠW arm", + "ep age", + "vari ants", + "B SA", + "Ġïĥ ¶", + "Ġhepat ocyte", + "ket ch", + "Ġstrip ping", + "ĠAd verse", + "ĠFe as", + "Ġïĥ ¯", + "P ac", + "Ġind entation", + "Ġsec ular", + "Ġidentif iable", + "run ning", + "Ġr d", + "Ġz yg", + "ĠD ictionary", + "Ġres veratrol", + "ines terase", + "Ġtet racycline", + "ub les", + "Ġthro at", + "ĠL amb", + "ary on", + "ĠS QL", + "Ġà ľ", + "Ġgly cemic", + "Ġcompet ent", + "ĠAg reement", + "oic ed", + "Ġconstitu tively", + "Ġelectro cardi", + "oplas ma", + "Ġî Ħĥ", + "an ide", + "Ġre organization", + "Ġun infected", + "UT E", + "Ġro yal", + "ĠS it", + "Ġmar ital", + "ĠKob ayashi", + "B arr", + "ĠT ennessee", + "ĠChrom at", + "ĠD erm", + "pro jection", + "ĠJ ob", + "Ġâī ł", + "ĠT rip", + "Ġis op", + "Ġproject or", + "Ġatmosp heres", + "Ġperfor ation", + "st orage", + "ith s", + "Ġmon omeric", + "ĠUS B", + "ĠE ve", + "Ġsp ore", + "Ġm T", + "ox azole", + "ĠDe formation", + "Ġtext ual", + "Ġwar f", + "Ġneuropath ic", + "prep ared", + "Ġbl ended", + "ĠHo uston", + "**************************************************************** ********", + "es ters", + "Equ als", + "Ġallerg en", + "Ġpertin ent", + "f acts", + "uc tions", + "Ġcl ocks", + "ĠV ia", + "ĠCD F", + "Ġest uary", + "Ġphenomen ology", + "ar us", + "AP H", + "Ġarg ues", + "Ġinser ts", + "g ow", + "h art", + "Ġchem otaxis", + "Ġp v", + "Ġre in", + "ĠG rim", + "ĠV F", + "Ġeff ic", + "ĠProf iling", + "Ġan odic", + "ĠDEN V", + "ĠW it", + "ĠSY STEM", + "ĠCay ley", + "En g", + "ĠA QP", + "inter actions", + "ili arity", + "ĠProm otes", + "Ġd ams", + "ing ton", + "ff ff", + "Ġint ran", + "ĠTurb ulence", + "ĠBian chi", + "C RE", + "ĠN OD", + "ap ine", + "ĠK ane", + "ĠPD GF", + "ĠAx is", + "ĠC ausal", + "ĠPo or", + "ĠW ords", + "ĠHR V", + "Ġcyan obacteria", + "Ġreminis cent", + "ĠRemark ably", + "he et", + "@ @", + "b il", + "Ġdiscrim inating", + "ĠBal tic", + "ĠQue bec", + "Ġdef ensive", + "âĪ ©", + "k r", + "ĠR PE", + "see king", + "ĠMo vie", + "Ġinnov ations", + "le pt", + "Ġk w", + "Ġtib ia", + "Ġne at", + "yt est", + "Ġthin ner", + "Ġoste oblasts", + "ĠNorth west", + "M OS", + "ĠP Q", + "Ġsp i", + "Ġrespond s", + "Ġhistor ically", + "ĠPack age", + "ĠCoast al", + "ĠMississ ippi", + "ĠP VA", + "per ing", + "ind ole", + "Ġprosp ectively", + "ĠHem isphere", + "Ġbare ly", + "án chez", + "ag gered", + "yp tian", + "ĠG est", + "yl ine", + "Ġphot ochemical", + "os calar", + "por ated", + "Ġmetabol omics", + "Ġoste oblast", + "EGF P", + "eri atric", + "D W", + "qu est", + "ĠH ave", + "Ġsp ondyl", + "ĠPrim er", + "Ġs inks", + "Ġg aussian", + "ĠK hal", + "En c", + "ĠAn opheles", + "Th anks", + "Ġconstr ued", + "ĠU SS", + "ĠZe eman", + "Ġex ported", + "ĠLe vi", + "Ġcomm ander", + "conn ect", + "Ġnom enclature", + "there fore", + "ul ata", + "Ġent repreneur", + "Ġneuros cience", + "z an", + "Ġext ant", + "AT IVE", + "ope z", + "Ġenfor ced", + "ĠInnov ation", + "ear ance", + "Ġimp ressive", + "ĠPl ac", + "ĠMo z", + "ĠSt ark", + "Ġri val", + "ĠCap ital", + "Ġgranular ity", + "Ġdiaphrag m", + "ut aneous", + "ind s", + "Ġphot ograph", + "Ġrect angles", + "T GF", + "Ġse af", + "Ġm aze", + "ĠH W", + "Ġcorrel ators", + "Ġdistinguish able", + "Ġconfound ers", + "Ġlandsl ide", + "Ġto ll", + "Ġwas tes", + "ĠW F", + "Ġend oc", + "Ġcaps id", + "ec und", + "ĠR BD", + "ps in", + "Ġobst etric", + "Ġnanos heets", + "oc ols", + "ren s", + "ĠSub stituting", + "Ġcustom ized", + "Ġres uscitation", + "Ġtub ulin", + "ophy te", + "~~~~ ~~~~", + "pl ants", + "hic illin", + "hal o", + "ruit ment", + "ĠConc rete", + "Ġnanor ods", + "ĠForm s", + "Ġd ying", + "dis charge", + "Ġwell being", + "Ġwar mer", + "ĠS SD", + "ĠA UT", + "ĠCon jug", + "Ġjuven iles", + "Ġine vitably", + "ĠM CS", + "appro ach", + "ĠM ason", + "ĠG ust", + "ĠTherm odynamics", + "Ġpe el", + "ĠTranscript ome", + "Ġindisp ensable", + "ur gery", + "pos ity", + "Ġpolar izations", + "ĠOther s", + "Ġsand y", + "Ġgli omas", + "Ġpurs ued", + "V EL", + "Ġr st", + "pos ium", + "ne arest", + "Ġdissem inated", + "ĠMY C", + "Ġal dehyde", + "ĠDiagn ostics", + "m ans", + "Ġas phal", + "ĠSe lect", + "ĠRec on", + "and ro", + "D IM", + "Ġf eces", + "ill on", + "ĠMAL DI", + "n f", + "ĠE lim", + "Ġhapp y", + "ĠKar l", + "ĠIn ser", + "Ġinter rog", + "In tern", + "Ġtensor flow", + "Ġhalo es", + "Ġanticip ate", + "ĠDPP H", + "rÃŃ guez", + "H er", + "an ate", + "Ġd ressing", + "ĠH oly", + "Ġnew er", + "rid es", + "plac ed", + "inet obacter", + "ĠOcc urrence", + "ed ema", + "ĠI k", + "ab ad", + "ĠTrans itions", + "Ġoutl ines", + "Ġcoch lear", + "G y", + "s uccess", + "ĠM EM", + "ast ype", + "Ġnormal izing", + "Ġtermin ates", + "Ġsudden ly", + "b box", + "ĠP ul", + "ĠP TP", + "ag inal", + "Ġpre trained", + "Ġun reliable", + "ĠGraph ical", + "ĠSey fert", + "Ġcharacter izations", + "Ġt x", + "Ġbic arbonate", + "math ord", + "Ġher itability", + "stack exchange", + "i ri", + "âĢ ĸ", + "ip it", + "at tle", + "Ġare na", + "ib a", + "ĠA X", + "ĠG Ps", + "ophil ia", + "S EL", + "os ystem", + "ĠâĬ ¢", + "ĠNucle us", + "red ited", + "AC R", + "ĠAnt enna", + "ĠCd c", + "or ie", + "Ġequil ibration", + "el ong", + "st ability", + "ĠSch ist", + "Ġinject ing", + "h p", + "Ġvit amins", + "Po isson", + "or tal", + "Ġà Ĭ", + "ĠÄ ı", + "I ll", + "Ġutil s", + "оР²", + "ĠG rom", + ":: ::", + "ĠGn RH", + "ĠSier ra", + "Ġd rafted", + "Ġcap ita", + "sh ips", + "Ġtim estamp", + "Ġsubstit uents", + "ĠNot able", + "ĠPur pose", + "in ol", + "Ġa i", + "Ġf og", + "ot one", + "ĠPl aces", + "bys hev", + "ti ology", + "ri ption", + "Ġy ards", + "ĠX I", + "Ġtechn ically", + "G AM", + "ĠA BS", + "pl atform", + "ĠW O", + "PRO C", + "Ġrecons tit", + "ĠAnomal ous", + "ĠBi ol", + "St age", + "ĠReview s", + "Ġrecall ing", + "Ġille gal", + "l und", + " ¬", + "ut henium", + "ĠP es", + "Ġo varies", + "sol utions", + "mass ive", + "ĠRA W", + "Ġrecon nection", + "ĠSus ceptibility", + "Ġeconom ical", + "cult ured", + "ĠSh am", + "sq cup", + "Ġp ear", + "dep osition", + "uch s", + "ĠS aw", + "Ġembol ism", + "B ur", + "n ar", + "ou le", + "Ġtex tile", + "se ven", + "th io", + "Ġden oising", + "CE P", + "Ġubiquit ination", + "ĠCarl os", + "a P", + "Ġfol der", + "Ġhemat ological", + "il uminescence", + "ĠF uel", + "ic ion", + "ac ulture", + "AR B", + "ĠTra vel", + "F unc", + "ac les", + "ĠIn te", + "Ġvacu a", + "Ġcock tail", + "ĠIn sp", + "Ġcor porate", + "Ġdepic ting", + "Ġspr int", + "ĠmTOR C", + "Ġc img", + "oc arbon", + "ĠD ave", + "ĠG b", + "ij i", + "target ing", + "Ġsequest ration", + "B ri", + "I GF", + "Ġanaly tics", + "ĠAc inetobacter", + "get s", + "MP S", + "ogl uc", + "C ent", + "Ġver bs", + "Ġinduc tance", + "di agram", + "Ġrec alled", + "Ġcos me", + "Ġautom otive", + "ĠPD Es", + "ĠRe id", + "Ġadap ter", + "ĠOl iver", + "Ġaval anche", + "V ir", + "ĠT oxicity", + "ĠLe u", + "Con clusions", + "Ġtet ragonal", + "ĠDM F", + "umann ii", + "ĠRequire ments", + "t oc", + "it é", + "Ġcontin ent", + "ĠH ank", + "ĠDef initions", + "GP U", + "orig in", + "Ġdich ro", + "M us", + "Ġb ival", + "Ġimp ulsive", + "Ġassemb le", + "Ġpip es", + "doc s", + "Ġexchang er", + "Ġall ograft", + "lo yd", + "ĠÌ ĭ", + "Ġanten atal", + "Ġgrass land", + "Ġhy stere", + "ĠAnti gen", + "ĠGener ic", + "ĠT uring", + "ĠEx cell", + "ĠHe in", + "aj a", + "umin um", + "cit abine", + "f acial", + "iter ation", + "Ġsl urry", + "AM L", + "erge tic", + "ĠTH F", + "Ġkil ometers", + "f g", + "ed uc", + "id ian", + "Ġpredic ates", + "Ġradi os", + "ĠPer i", + "ĠShe ll", + "Ġarc sec", + "Ġstri atal", + "Ġce iling", + "olith ic", + "Ġexhaus tion", + "P UT", + "ther s", + "ym p", + "ĠQ ian", + "ĠProg ressive", + "Ġw el", + "ĠCon vention", + "ĠCur ie", + "ĠM ans", + "ĠN ova", + "ĠW ells", + "de w", + "St andard", + "real istic", + "trans pose", + "ser ial", + "ĠT x", + "ĠA MR", + "Ġind eterm", + "ĠLi ouville", + "hook rightarrow", + "AR s", + "Ġbase ball", + "ac ious", + "agne tization", + "es timate", + "ĠP AS", + "Ġme als", + "multi ple", + "ĠBiomark ers", + "W ide", + "ĠTom ography", + "//////////////// ////////////////", + "Ġres ins", + "Ġany where", + "IN C", + "ĠTe aching", + "ĠSam uel", + "Ġhall mark", + "ĠTh yroid", + "oth i", + "Ġconst raining", + "ĠBar rett", + "ĠEr rors", + "C ole", + "sh aring", + "HD L", + "Eff ect", + "ĠT olerance", + "Ġstress ful", + "ĠBal ance", + "ĠT ech", + "Ġval leys", + "set up", + "ĠRad ical", + "ĠMacroph ages", + "Ġinter rupt", + "Ġdi atom", + "col ored", + "Ġpy rid", + "FD G", + "à ¦", + "Ġre ared", + "ĠR ating", + "Ġop aque", + "pack age", + "Ġnas opharyngeal", + "Ġprecondition ing", + "D iptera", + "ĠM ing", + "ĠCa ro", + "ĠImmun ity", + "rif uge", + "ĠObj ectives", + "g han", + "uc cin", + "ĠF ors", + "ĠF ITC", + "Ġse ats", + "ĠImp aired", + "Ġreef s", + "em aker", + "Ġoff ices", + "Ġaccept ing", + "ĠTR AN", + "ĠTarget s", + "Ġcorrel ator", + "Ġsuper capac", + "in burgh", + "Ġcoll ider", + "Ġenter ic", + "ĠSTR UCTURE", + "Ġmin ister", + "ĠArch ae", + "Lo op", + "ĠA SA", + "Ġcont acted", + "Ġhis tidine", + "fold ed", + "S earch", + "Ġresp ects", + "ĠAT F", + "Ġtro uble", + "Ġprev ailing", + "C p", + "ĠT CM", + "ĠSp inal", + "Ġgu ides", + "ev itable", + "Ġb rick", + "str ings", + "ĠHung ary", + "Ġe ps", + "ent ricular", + "Spec ifically", + "and o", + "iss ues", + "osom iasis", + "k Da", + "Ġas ide", + "Ġaden ine", + "Ġmotiv ate", + "strat ig", + "B LE", + "ĠDep osition", + "m otor", + "ĠH ers", + "Ġne bul", + "ĠBar rier", + "Un like", + "Ġball istic", + "Ġsouth western", + "ĠMont real", + "S can", + "Ġm ould", + "Ġinter rup", + "small matrix", + "Ġelabor ated", + "uc ks", + "AP S", + "ĠCons umption", + "cap acity", + "inn itus", + "Ġgovern ance", + "Ġp alsy", + "Ġsub mission", + "Ġtem ple", + "ĠII A", + "meth ionine", + "Ġker at", + "Ġrid ges", + "Prom ega", + "c ols", + "IS P", + "Ġap nea", + "ĠFl at", + "ĠEp igenetic", + "Ġpar ish", + "ĠPar ametric", + "d ash", + "f uture", + "r ise", + "Ġcontract ing", + "alg ia", + "Ġg oto", + "stad t", + "Ġfabric ate", + "Ġdimer ization", + "d ump", + "ĠL yn", + "Ġrecycl ed", + "posed ness", + "ĠSens ory", + "ï Ŀ", + "ĠW et", + "Ġdi ethyl", + "Ġbl ades", + "Ġtim ed", + "Ġkey word", + "Ġpolyt ope", + "ĠG ot", + "Ġapproxim ates", + "With out", + "ĠB ere", + "ĠL p", + "opl asty", + "ĠF ibr", + "mod ulated", + "ĠAR M", + "Ġunde restimate", + "ĠC BS", + "ĠL ectures", + "unc an", + "ĠSe ismic", + "So ft", + "Ġzo oplankton", + "Ġencephal opathy", + "ĠS SA", + "ĠC ros", + "ĠH ann", + "Ġsh uffle", + "sc ription", + "ĠRever s", + "Stud ies", + "Ġsoc ially", + "Ġsub cl", + "ĠY ong", + "og h", + "Ġïģ ³", + "UD Y", + "ĠHa ar", + "ĠDoc tor", + "Ġint akes", + "Ġbar rel", + "ĠTR PV", + "ĠAgg reg", + "ny i", + "tun ed", + "ac quired", + "Ġho ok", + "F GF", + " «", + "ĠIn jection", + "Ġgra vel", + "Ġmicro g", + "Ġmen strual", + "Fe ature", + "I RE", + "u u", + "ĠS rc", + "ĠSt ore", + "Ġiniti ator", + "PS O", + "Ġepile ptic", + "Ġcing ulate", + "I J", + "R ow", + "Ġsing ing", + "ĠMet han", + "ĠAld rich", + "Ġtremend ous", + "am ining", + "Ġtrac ts", + "Ġâİ £", + "kl ah", + "D iv", + "ind ol", + "Ġind ole", + "ex per", + "Ġgly cer", + "Ġbenz yl", + "Ġwors ening", + "Ġunambig uous", + "u art", + "Ġpar sim", + "ric ks", + "Ġtra il", + "ĠBl anc", + "Ġamin otransferase", + "ĠD OC", + "Ġfum ig", + "id ic", + "ĠCon sequences", + "Ġacid ification", + "ĠCIF AR", + "ĠD atasets", + "ĠA MI", + "Ġexpl ants", + "ĠD iverse", + "Ġde phasing", + "Ġpar liament", + "ip ient", + "Ġhoney comb", + "he avy", + "Ġwaterm ark", + "M ED", + "d atasets", + "w aters", + "Pro vid", + "inter pret", + "rov irus", + "I o", + "R AD", + "Ġl unar", + "Ġwe aning", + "Ġsensor imotor", + "uc a", + "Ġinf ect", + "ĠUn ique", + "GR P", + "Q oL", + "osp ec", + "Ġforward ing", + "Es tim", + "ÅĦ ski", + "ĠM s", + "ach n", + "Ġro ta", + "Ġappoint ment", + "ĠMed al", + "Ġaden ovirus", + "quin ol", + "Ġdeuter ium", + "te p", + "ĠSt yle", + "N d", + "ay ama", + "ĠH amm", + "ĠSpec ification", + "v ability", + "th a", + "Ġj itter", + "Ġâİ ¦", + "a qu", + "w ire", + "Ġclass ically", + "Ġsuper potential", + "ĠSpec im", + "ĠVari ance", + "Ġalbum s", + "ĠSen ior", + "Ġneurotrans mitter", + "ĠRecomb inant", + "D CS", + "v l", + "Ġp f", + "Ġin evitable", + "ĠN ick", + "Ġmanip ulating", + "itu ximab", + "ce iver", + "ĠB ren", + "ĠR ace", + "Ġret arded", + "mod ulin", + "Cl inical", + "Ġneu rologic", + "ĠReg iment", + "Ġzo om", + "ĠOrth ogonal", + "ĠConcer ning", + "ĠJur assic", + "ĠAr tem", + "ĠMel bourne", + "b ins", + "j l", + "Ġin hab", + "Ġsq rt", + "Ġsemis imple", + "ast ric", + "ĠPro xim", + "ĠVari ants", + "Ġa esthetic", + "Ġsummar ised", + "ĠBeck er", + "O CH", + "d ale", + "Ġm ounting", + "and ering", + "Ġsoft max", + "Ġneuro inflammation", + "Ġesophag us", + "oper ators", + "ĠAD AM", + "Ġviol ate", + "ĠPH Y", + "ed e", + "ĠC her", + "ors al", + "Ġmetam orphic", + "ĠI CM", + "ĠAb cam", + "sl ot", + "ser ine", + "Ġdu plicates", + "ĠME MS", + "ĠA bl", + "ĠC hel", + "ĠAuthor ity", + "Ġge o", + "Ġhome omorphism", + "Ġimmunomod ulatory", + "ĠT U", + "ĠK T", + "ater ally", + "ox ides", + "teb ral", + "Ġcatar act", + "le aved", + "ig u", + "ate ur", + "ĠR é", + "Ġdiscover ies", + "bos on", + "oc ated", + "j pg", + "ĠS ato", + "ĠPRO P", + "ĠIm plement", + "EL ISA", + "iqu eness", + "Ġsym bion", + "ĠFar aday", + "ĠPPAR γ", + "w itz", + "re ward", + "ĠB ush", + "st ressed", + "ĠA bor", + "Ġair ways", + "Ġinterfer ometry", + "C irc", + "Ġimmun oprecipitation", + "ĠAp ache", + "roph osph", + "Ġo C", + "Ġf rog", + "ĠG U", + "ff e", + "ĠSt ro", + "Ġdodec yl", + "d an", + "f olds", + "ĠM ust", + "Ġsurround ings", + "Ġcod ons", + "ond a", + "t b", + "od ge", + "av as", + "ĠSe ason", + "t ude", + "ĠPl asticity", + "ĠHawai i", + "D EG", + "ĠC MD", + "Ġsingle ton", + "ke ley", + "Ġalgebra ically", + "Ġnano structured", + "eas ible", + "Ġoverlo oked", + "ĠP ulse", + "rom echanical", + "ĠEl se", + "Ġexcit ons", + "ĠConst rained", + "Ġco hesion", + "Ġreal izing", + "ĠRadi ative", + "Ġtryp an", + "x s", + "ĠT as", + "Ġmain stream", + "Ġcompact ly", + "g rowing", + "es c", + "Ġd N", + "ĠSign atures", + "ĠFundament als", + "Ġex pose", + "ĠR ang", + "Ġhand ed", + "Ġfunctional ization", + "Ġpass iv", + "al tern", + "ag ul", + "Ġschem atically", + "O W", + "Ġ Ö", + "ĠP OD", + "Ġhe ar", + "ym ore", + "ĠPrem ier", + "S outh", + "Ä «", + "ĠO BS", + "ĠAl g", + "gl ia", + "ĠTrans membrane", + "Ġsphe roids", + "ĠR HS", + "Ġinc hes", + "ĠK ato", + "Ġi e", + "ĠCom mercial", + "Ġanaly tes", + "Ġrisk y", + "Ġp iston", + "ĠMark ovian", + "Ġdram a", + "Ġc i", + "ĠHist ological", + "Ġact uation", + "disc rete", + "carb amoyl", + "S MA", + "Ġfeed s", + "Ġneoplas ia", + "ĠControll er", + "b een", + "glut amine", + "in jected", + "Ġc rab", + "ĠC auses", + "ĠSt ory", + "Ġvan adium", + "ĠT itan", + "en ix", + "ass ign", + "Ġimmun ogenicity", + "ĠAp parent", + "Ġenh ancers", + "ĠS ou", + "all oy", + "mathb in", + "Ġsed ation", + "ĠWork shop", + "g over", + "l st", + "Ġup welling", + "me z", + "Ġpoly propylene", + "ĠCol orectal", + "ĠRel axation", + "Ġfrag ile", + "Ä ĥ", + "Ġsub graphs", + "the oretical", + "Oper ator", + "ly wood", + "aw n", + "ĠPer centage", + "methyl ation", + "corrhiz al", + "G rad", + "d ens", + "ĠH α", + "Ġup coming", + "Ġvir gin", + "N ames", + "ĠR yd", + "Ġâİ ¤", + "phosph orylation", + "renew al", + "Y ear", + "In it", + "Ġs elling", + "ĠM ASS", + "roph in", + "ij n", + "Con versely", + "Ġunivers ally", + "orh ombic", + "Ġunpredict able", + "F ock", + "ch air", + "iv as", + "network s", + "Ġterr itories", + "th ia", + "ĠAm plification", + "M arch", + "Ġf lam", + "ĠCh art", + "Ġshort age", + "AM ET", + "Ġgrap e", + "Ġvoltam metry", + "Ø ¯", + "ĠS CH", + "Ġepit hel", + "ĠChrom osome", + "ĠX L", + "ĠPers istent", + "Ġtravel ed", + "Ġmerid ional", + "Ġf printf", + "Ġg um", + "vis ory", + "Un fortunately", + "Ġant eced", + "Ġfric tional", + "D AT", + "ac l", + "ĠP regnancy", + "ĠB Z", + "reg ulatory", + "stim ulating", + "J apan", + "m achine", + "u ti", + "ĠL er", + "Ġnan oflu", + "prot otype", + "identif ication", + "klah oma", + "ĠEm ploy", + "Sch warz", + "Ġincorrect ly", + "at to", + "ri zation", + "ism uth", + "Ġir is", + "iment ary", + "Ġinflation ary", + "Ġoutflow s", + "ĠL ic", + "ore ductase", + "Ġproceed ing", + "ĠT AC", + "ĠH TL", + "Ġres ides", + "str al", + "ĠTrans f", + "Ġdich otom", + "Fil ter", + "J une", + "is ure", + "ĠA de", + "Ġij k", + "ĠPhil os", + "Ġstay ed", + "Ġtam oxifen", + "Ġaspar agine", + "ex ception", + "Ġaccum ulating", + "ast ro", + "Ch ange", + "uz i", + "Ġl on", + "In stead", + "Ġcent rally", + "ĠD ental", + "class ified", + "ĠEg yptian", + "Add ress", + "ĠQuatern ary", + "ĠU SP", + "co in", + "Ġembry ogenesis", + "ïĢ ¨", + "N ull", + "ĠM ixing", + "int ensive", + "Ġnorm ative", + "ĠL ef", + "Ġr umen", + "ĠTh ai", + "Ġsw allow", + "Comp onent", + "Ġrobo tics", + "ĠC ad", + "ĠC IP", + "ĠAc ids", + "ĠO ffic", + "ure r", + "ĠW ick", + "Ġk ink", + "ĠSch a", + "ĠCharacter istic", + "f amilies", + "ĠG Cs", + "ĠOptim izing", + "Ġtim er", + "é l", + "j in", + "re versal", + "Ġsand stone", + "H N", + "t k", + "Ġp tr", + "Ġmon ochromatic", + "Ġfeed forward", + "ding ton", + "Ġcritic ism", + "Ġs ig", + "Ġp ace", + "ĠT K", + "ĠW as", + "Ġcertif icate", + "Ġst uck", + "Ġcor rid", + "Ġlocal isation", + "Ġsil k", + "Ġdig est", + "ĠTem ple", + "ĠPost erior", + "Ġcommut ator", + "ts ch", + "per me", + "ys ed", + "Ġmen u", + "Ġmid w", + "oc atalytic", + "Ġpp b", + "T ypes", + "ar ri", + "ĠL OD", + "Ġlo an", + "sec ret", + "Ġcarb ons", + "ĠH olog", + "olip ids", + "Ġupl o", + "ĠDN ase", + "Ġpuzz le", + "Ġst ance", + "ĠManc hester", + "ĠDet ector", + "im s", + "ĠTerm s", + "ĠP GC", + "Ġinc idents", + "ie h", + "ĠID s", + "ĠAh mad", + "Ġn ights", + "Ġbiom o", + "ĠMethyl ation", + "u ator", + "res ize", + "ĠF inger", + "ĠW o", + "Ġpost er", + "Ġsolid ification", + "ĠVal idity", + "ĠDend ritic", + "Ġad herent", + "iss ions", + "inc tion", + "Ġantagon istic", + "ĠPrelim inaries", + "Ġco val", + "Ġmov ies", + "Ġbud ding", + "K n", + "ĠG it", + "ĠThere after", + "Ġcapac itive", + "A z", + "ĠT LS", + "Ġiniti ates", + "ĠD MR", + "Ġâī «", + "ĠMy ocardial", + "ĠRot ation", + "CON FIG", + "Ġvow el", + "Ġoliv ine", + "H amiltonian", + "Ġst alk", + "N eu", + "R est", + "an ical", + "Ġd st", + "Ġres h", + "Ġexp ressive", + "Ġinf ectivity", + "ok u", + "CT L", + "F requency", + "Ġprem ise", + "W alk", + "Ġâ Ĺ", + "Ġrel apsed", + "t ured", + "ĠU ML", + "ov an", + "ĠRes earchers", + "Ġconven iently", + "us k", + "IN IT", + "Eq s", + "F actory", + "Ġun steady", + "ĠAn sw", + "Al a", + "nit ine", + "q p", + "ul ous", + "res earch", + "ĠB rom", + "ĠDem oc", + "config uration", + "ulos ic", + "Ġf ra", + "Ġg ift", + "Th ird", + "Cl aim", + "Ä Ł", + "od iazep", + "Ġpro x", + "oc ystis", + "ĠR PA", + "ĠLik ert", + "R MS", + "t ech", + "Ġac ous", + "T LR", + "b uck", + "ĠThe rap", + "uss ions", + "hel or", + "ĠEm otion", + "b ird", + "Ġth io", + "Ġquantit ation", + "brack et", + "Ġper cept", + "Ġsub category", + "Ġlight ning", + "Ġher nia", + "Ġneurot rophic", + "SD S", + "ĠAnd ers", + "Ġslow ing", + "strong ly", + "ĠC ounting", + "ĠIn cluding", + "duc tions", + "ub ated", + "ĠSt orm", + "cor related", + "Ġautoanti bodies", + "ĠM erg", + "oc er", + "mic utes", + "Ġnonlinear ities", + "ĠCent ury", + "ĠLand scape", + "ĠDeriv atives", + "ĠContr ary", + "Ġcomp ile", + "ĠHep atic", + "Ġpond s", + "Ġorgan ize", + "D MSO", + "P osition", + "Ġb rach", + "Ġinf lat", + "osp ace", + "Ġskew ness", + "Ġag itation", + "ĠHO MO", + "E U", + "Ġcom mented", + "Ġcor pora", + "Ġmal t", + "Herm itian", + "id ay", + "ĠHelm holtz", + "ro blast", + "ĠC TR", + "un ching", + "ĠM ond", + "ĠCom ment", + "Ġoste osarcoma", + "post erior", + "Ġthym us", + "Ġcig arettes", + "N W", + "o lem", + "ĠH ox", + "ĠNF L", + "ĠAvail able", + "ĠS iber", + "ĠF eld", + "Ġborder line", + "Ġbe ats", + "Ġorgan ised", + "Ġdistingu ishes", + "Ġdial og", + "ĠBerg er", + "ole ic", + "Ġnum bered", + "Ġreach able", + "ĠRoberts on", + "ĠCham ber", + "nd array", + "Ġcytos keletal", + "Ġbl ending", + "bl ood", + "Im port", + "Ġoverwhel ming", + "Ġi o", + "Ġout age", + "ĠSch olar", + "plac ing", + "ĠPol yp", + "Dec l", + "ĠMED LINE", + "ĠK M", + "ĠD AP", + "err ors", + "ĠS HR", + "ĠD ex", + "ĠG AS", + "ĠG ian", + "Ġclinic opathological", + "Ġïģ ·", + "ĠPredic tions", + "ĠQuad ratic", + "Ġarrhyth mias", + "ar id", + "Ġcl othing", + "ĠFract ure", + "ĉ ĠĠĠĠĠ", + "add y", + "ĠAlber ta", + "ĠW ed", + "phi re", + "ĠEn cryp", + "ĠL AB", + "ĠF ano", + "CT T", + "Ġor yz", + "ili ac", + "ĠL iao", + "vers us", + "Ġmes o", + "Ġmid point", + "Ġst ator", + "ĠJ enn", + "ov sky", + "Ġunc over", + "eren n", + "ĠMc M", + "âī Ī", + "ĠCirc uits", + "Ġfet uses", + "Ġaggl omer", + "Ġf b", + "Ġy y", + "at ech", + "AR G", + "Ġba umannii", + "Ġellipso id", + "Ġl oses", + "Ġun ve", + "Ġbut t", + "Ġmultic entre", + "il ine", + "Ġres ort", + "Ġcereb rovascular", + "ĠDecre ased", + "j ud", + "s us", + "am ol", + "const raints", + "Ġt een", + "ĠPass ive", + "ĠCauc asian", + "Ġc ran", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠ", + "ü n", + "ĠDN MT", + "Ġt error", + "ad renal", + "Ġangi ogenic", + "ĠInhib itory", + "p rag", + "Ġco b", + "els h", + "Ġenhance ments", + "ĠSha w", + "ĠTak ahashi", + "Ġsulph ur", + "Ġgrav itation", + "ĠPVD F", + "m ust", + " ¢", + "as ymptotic", + "el man", + "ĠP ros", + "ĠM AD", + "ĠL en", + "the rapy", + "eful ly", + "sulf ur", + "ĠT CA", + "ad ditive", + "tal k", + "Ġpig lets", + "Ġprosp ect", + "ecund ity", + "ĠX iang", + "hand ler", + "Ġcl ath", + "Ġmill imeter", + "j ar", + "Ġbi ophysical", + "Ġcomplex ities", + "ĠHer b", + "Ġrecover s", + "ĠVin cent", + "ĠPuer to", + "E arth", + "R AM", + "Ġc ables", + "des igned", + "ĠOscill ation", + "Ġme iosis", + "Ġfle et", + "ĠHunting ton", + "ĠB eg", + "ĠE Cs", + "ĠAn tic", + "Ġpractition er", + "c ultural", + "k at", + "Ġrec oil", + "ĠIm plicit", + "Ġsumm aries", + "Ġdiscontinu ed", + "Ġencompass ing", + "ĠAlt ogether", + "ĠD IST", + "Ġconst ellation", + "ĠEx isting", + "Ġconduct ors", + "oplas m", + "ĠCosm ology", + "Z ero", + "ĠIn form", + "Ġend angered", + "Ġweap ons", + "at ype", + "ĠAs c", + "Ġflu ence", + "Ġfer ric", + "ĠLaure nt", + "Ear ly", + "Ġs gn", + "ĠHad amard", + "Ġastr on", + "C ys", + "ĠTh m", + "Ġdec e", + "eren cing", + "ĠMe ans", + "Ġhyd rated", + "Ù Ī", + "Ġrig orously", + "Ġamb ulatory", + "ĠDO I", + "Hand le", + "ĠEnterobacter iaceae", + "ĠR Q", + "ĠG FR", + "pro te", + "Ġmig rated", + "then ing", + "ĠHop kins", + "ĠPsych ology", + "ig l", + "ĠE DS", + "ĠâĪ ¶", + "Ġrem otely", + "Ġ ¥", + "Ġinsp iration", + "ĠâĮ ¬", + "ol ian", + "Ġsal iency", + "ĠD og", + "ĠR osa", + "oy a", + "Ġoccup ies", + "cam era", + "Ġdecomp ression", + "Ġsc att", + "Ġinvestig ator", + "Ġcount erex", + "ĠIFN γ", + "ĠPitts burgh", + "Ġad minister", + "ne gl", + "uss is", + "MP C", + "ĠSw itching", + "Ġcool er", + "Ġbron chi", + "Ġpar alle", + "Ġspec kle", + "Ġphys iologic", + "IN VAL", + "Ġheter ologous", + "|| |", + "org hum", + "G AL", + "Ġmal formations", + "Ġweak ening", + "Ġpsych o", + "ĠI H", + "Ġcontrad ictory", + "Ġphon ological", + "ĠPerturb ation", + "b B", + "ĠN os", + "TR UE", + "fold ing", + "phen ol", + "ĠL SM", + "ĠâĪ Ĺ", + "ĠAn gle", + "Ġprov incial", + "Fe O", + "Å Ľ", + "ĠI ber", + "ress ors", + "Ġprolifer ating", + "z ers", + "organ ism", + "âĨ ĵ", + "Z O", + "c img", + "Ġun perturbed", + "Ġj j", + "Ġelectro dynamics", + "ĠEp it", + "NT s", + "ĠBlo om", + "Ġl anth", + "am inant", + "ĠSw ift", + "Europe an", + "Ġaff erent", + "Red uce", + "p ublished", + "ĠF itting", + "ĠF ungal", + "Ġtrib e", + "rec ting", + "Ġconjug acy", + "im eters", + "ĠC ec", + "ĠK H", + "cast le", + "Ġsept al", + "rele asing", + "Ġo ss", + "Ġ ¦", + "ĠMiss ing", + "ĠFat igue", + "ĠBase ball", + "Ġimmunoblot ting", + "Ġo h", + "or ations", + "Ġv ine", + "az y", + "ser um", + "Ġlook up", + "Ġne ovascular", + "ia h", + "so il", + "Ġair flow", + "ĠSlo an", + "h im", + "ç ļ", + "loc ated", + "z antine", + "ĠS uccessful", + "em inal", + "ĠD imensional", + "ĠN SA", + "ĠLog istic", + "emet ery", + "Ġb rak", + "ant al", + "so uth", + "Ġprot otypes", + "Ġadv ised", + "Ġideal ized", + "ophy tic", + "nb sp", + "B inary", + "H yp", + "J oh", + "p olation", + "Ġpoly vinyl", + "estim ated", + "Ġox ytocin", + "ĠLet ter", + "ĠImp air", + "Ġenvelop es", + "main ly", + "Ġm ys", + "Ġint ras", + "Ġbi ogenic", + "cy steine", + "Ġur ic", + "ĠCy an", + "ryp tion", + "Ġphotore ceptor", + "ĠT oxic", + "ĠG amm", + "Ġcontain ment", + "Ig G", + "S qu", + "Ġperf used", + "Ġbios ensors", + "Ġmag matic", + "R ate", + "ĠT f", + "Ġsec rete", + "Ġcritical ity", + "Ġcomposition ally", + "ĠBr uce", + "S Z", + "ĠS port", + "ĠE I", + "Ġdise ased", + "Ġpres chool", + "ĠHar vey", + "ĠPT H", + "Ġbil ayers", + "ĠOscill ations", + "ĠHon or", + "ĠC CN", + "ĠM OT", + "ĠL loyd", + "Ġtrap ez", + "Ġbud s", + "OFF SET", + "Ġmac romolecules", + "Ġbil irubin", + "ol ly", + "Ġutil ities", + "minist ered", + "Ġglob e", + "OLOG Y", + "rop ods", + "ĠMD M", + "ĠPy Object", + "mac roph", + "ĠP BMCs", + "osp heres", + "Ġcatast rophic", + "ĠNavig ation", + "ĠL SD", + "Ġcre am", + "Ġdere g", + "b onded", + "ren ts", + "Ġpotenti ation", + "Ġst ro", + "Ġst eeper", + "ulin um", + "Ġperiodon titis", + "ar ization", + "âĪ ª", + "amic in", + "Ġmagne tized", + "ĠNutri tional", + "Ġacc ord", + "ga ard", + "FT IR", + "r amethyl", + "ĠG le", + "M el", + "ĠCT L", + "Ġtransl ating", + "Ġauto immunity", + "oler ant", + "triang leq", + "am o", + "Ġv el", + "ĠH CN", + "ĠH amming", + "ĠVen us", + "ĠG ad", + "ĠO wing", + "In formation", + "ĠSchem es", + "caro tene", + "I ts", + "an is", + "Ġre play", + "Ġto uc", + "LE CT", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠ", + "Ġtab ulated", + "ĠSchott ky", + "F ar", + "am ation", + "ĠR ies", + "Ġexp ects", + "ĠInst ability", + "Ġs ons", + "Ġdec k", + "Ġïģ ¥", + "ĠSign ature", + "Ġlith osphere", + "W W", + "m akers", + "ugh ters", + "Ġâİ ¡", + "ardi an", + "à ¦", + "Ġac cepts", + "ĠO SA", + "Ġγ δ", + "non umber", + "S elect", + "l ite", + "ĠA queous", + "ag awa", + "ĠEd inburgh", + "ĠMemb ranes", + "ĠS IG", + "ak ia", + "Ġtest es", + "Ġhel i", + "++ ++", + "Ġultraf ast", + "Ġmaneu ver", + "ĠD ate", + "ph in", + "ĠK ad", + "Ġtransfer ase", + "P ers", + "Ġt ones", + "ĠS GD", + "ant o", + "ĠO range", + "ĠGe ography", + "ĠAcc umulation", + "at y", + "Ġbe ating", + "Ġover lying", + "ĠND VI", + "ĠTown ship", + "j ing", + "ĠN OS", + "play er", + "ĠMD D", + "ĠHung arian", + "Ġd w", + "ĠH in", + "Ġvalid ating", + "Ġcolor imetric", + "ĠSupers ymmetric", + "F UNC", + "g ically", + "of uran", + "---- ---", + "Ġimp ing", + "similar ity", + "ĠD OX", + "ĠG lo", + "iv irus", + "list ed", + "Ġbus y", + "ipro floxacin", + "Ġan xi", + "Ġbl unt", + "Ġproced ural", + "Ġunknown s", + "Ad S", + "thick ness", + "follow s", + "cl osing", + "environment al", + "ĠFeed ing", + "un ami", + "end e", + "ip ine", + "Ġimpact ing", + "Ġpenet rating", + "amb ia", + "ĠWave let", + "Ġfilament ous", + "Ġl eng", + "ĠS CA", + "ĠE ther", + "met all", + "Ġfr inge", + "ĠAdj ust", + "us z", + "ĠR ey", + "ĠBo yd", + "Ġburn out", + "Ġco ok", + "Ġnow adays", + "ĠDispers ion", + "ĠRodrig uez", + "F actor", + "ĠO klahoma", + "Ġun ital", + "Ġpredict ability", + "Ġlith ography", + "è s", + "W illi", + "un al", + "ast ing", + "cor rection", + "ĠD ed", + "ĠSoci o", + "ĠChap man", + "ĠE co", + "Ġonc ogene", + "ĠDri ve", + "Ġfun nel", + "u is", + "ĠGEN ER", + "ĠA CR", + "Ġworkload s", + "Ġocta hedral", + "v ich", + "en burg", + "Ġimpro per", + "dec oded", + "Ġimmunos orbent", + "Ġinhom ogeneity", + "R K", + "on ically", + "Ġglycoprotein s", + "on ics", + "ĠF ok", + "ĠB ras", + "ĠCalc ulus", + "ĠM oss", + "ĠR K", + "Ġvi olet", + "Ġlymph omas", + "ens pace", + "ĠPal ae", + "Ġren in", + "ph ant", + "ĠRE D", + "Ġfault y", + "Ri emann", + "à ī", + "ĠEll i", + "B ol", + "T n", + "Y ang", + "g ender", + "Ġdet uning", + "Ġoper on", + "Ġinsectic ide", + "es i", + "am on", + "ĠS CD", + "ĠB ath", + "ĠâĢ ĸ", + "ĠGe ographic", + "Ġcycl ohex", + "ĠConf idence", + "Ġcom et", + "Ġfol ate", + "ob server", + "Ġvis itors", + "ext ra", + "at eness", + "ĠS PT", + "arc ane", + "Ġhol istic", + "sem i", + "ĠM ild", + "Ġsm ear", + "Ġcycl ase", + "Ġan ymore", + "Ġse agrass", + "Ġcons ortium", + "Ġfin ishes", + "cy an", + "duct ance", + "f rost", + "here after", + "Ġpres criptions", + "Ġcm d", + "ĠPer ceived", + "co ordinates", + "Ġst yl", + "ĠB ard", + "ĠH oll", + "Ġsi RNAs", + "s ugg", + "Ġth r", + "Ġmain land", + "SC H", + "Ġasser tions", + "Ġbab ies", + "Ġrecap it", + "T ok", + "Ġres ected", + "con struct", + "B er", + "Ġch oline", + "Ġunit arity", + "Ġcataly zes", + "det ector", + "ĠS MB", + "ter y", + "cl uded", + "ĠAb breviations", + "ĠOlive ira", + "L OC", + "z in", + "ĠLore nz", + "K ernel", + "ly n", + "ĠL EP", + "son i", + "Ġsept um", + "T MS", + "Ġun modified", + "bor ough", + "ĠAud io", + "Ġdoll ars", + "CM D", + "Ġnorth western", + "Ġpal mit", + "ragal actic", + "ĠM iz", + "F H", + "conf idence", + "N EXT", + "ĠA GE", + "ĠEq n", + "ĠClass es", + "Ġmis leading", + "ĠPK A", + "Ġanch ored", + "ĠR ip", + "ph ag", + "Ġint ubation", + "ĠAng ular", + "ĠB EC", + "Th r", + "Ġorgan isations", + "Ġcomfort able", + "Ġcommission ed", + "p oll", + "y dia", + "in stead", + "Ġpass word", + "Ġcompl iant", + "ĠPrec ipitation", + "ophosph amide", + "ust ers", + "Ġpneum ococcal", + "Ġtom ographic", + "tida e", + "ĠFir micutes", + "b w", + "ĠPD B", + "ĠGP Us", + "ĠPlan ar", + "Ġverb ose", + "Summ ary", + "l ance", + "ĠE GFP", + "ong ru", + "Com plex", + "ĠWhe at", + "uc he", + "ĠM CA", + "ĠPro jection", + "Ġstat s", + "Ġsumm and", + "dim ethoxyphenyl", + "ĠAB STRACT", + "Ġcaroten oid", + "Ġbro ke", + "ĠDesign ing", + "ĠHet ero", + "ĠCarls bad", + "C ov", + "in eral", + "Ġanaly te", + "ĠCo leman", + "Ġeigen state", + "ĠHol land", + "ERS ION", + "ĠD ak", + "ell ers", + "Ġà ĺ", + "miss ing", + "dep osited", + "ĠLinc oln", + "an ion", + "ĠSP EC", + "Ġfertil izer", + "ĠC PS", + "Ġco factor", + "Ġtre n", + "Ġcal endar", + "Ġyoung est", + "STAT US", + "ĠEXPERIM ENTAL", + "Ġs r", + "Ġn l", + "ĠM ES", + "Stud y", + "p adding", + "Ġat opic", + "ĠO G", + "Ġent rainment", + "AF M", + "ĠC ou", + "We b", + "ĠMic roscopic", + "Ġunambig uously", + "D ay", + "y otrophic", + "re ous", + "Ġs arcom", + "ĠV AL", + "Ġhind ered", + "ĠRE M", + "ot rexate", + "oc arcin", + "ĠAl k", + "Ġbre vity", + "fact ual", + "C er", + "di ox", + "oph ical", + "Ġly tic", + "T ake", + "Ġint end", + "ĠCl a", + "Ġaster oid", + "ĠS EP", + "ap enem", + "univers al", + "Ġo ceans", + "Ġmon oid", + "Ġsepar ator", + "ĠP orous", + "Ġpost operatively", + "Ġsem in", + "ĠDis play", + "Ġhyd rolase", + "transfer ases", + "Ġthromb us", + "ĠO v", + "ĠDie lectric", + "Ġcomp elling", + "ass ing", + "ĠM AS", + "ull ary", + "ĠMor i", + "ĠPath ogenesis", + "ĠBre aking", + "ĠPL GA", + "cool ing", + " §", + "Ġfe e", + "Ġreduc ible", + "Ġdiver ge", + "Ġque ues", + "Ġmush room", + "Ġdeacetyl ase", + "Y FP", + "Ġdis reg", + "ĠAr rays", + "process es", + "ĠTransport ation", + "Ġundet ectable", + "bur sts", + "Ġphospholip ase", + "O ption", + "as in", + "Ġn octurnal", + "te z", + "ĠDis ruption", + "oser ine", + "behavi or", + "ĠT ony", + "ĠK ot", + "ie val", + "Ġmy ofib", + "Ġhal ogen", + "ĠC PR", + "ploy ed", + "ĠPol ymers", + "Ġaden oma", + "Ġquar tile", + "Ġquatern ary", + "ĠIra q", + "Ġs ieve", + "Ġint ractable", + "Ġfabric s", + "continu um", + "ĠEmerg ence", + "P ot", + "iti sm", + "ven ess", + "ho e", + "Ġred es", + "ĠHR P", + "ploid y", + "pic uous", + "og o", + "ĠG ag", + "Ġnom inated", + "occup ied", + "Ġqu ench", + "rop olis", + "nucle otide", + "ĠEvent ually", + "Ñ ı", + "ĠCl ock", + "ĠSte ady", + "opol ymers", + "ĠA RE", + "ir nov", + "hel f", + "bl ob", + "down load", + "PL L", + "UN T", + "predic tions", + "Ġocc ipital", + "t oxic", + "ĠV ice", + "Ġang io", + "Cu O", + "Ġresist ances", + "ffl ffl", + "D istribution", + "G re", + "on amide", + "ĠI OP", + "UN EL", + "Ġa ids", + "ĠH UV", + "EC M", + "ĠP AD", + "ĠAg NPs", + "Pr int", + "Ġlam ellar", + "ĠUltr ason", + "se vere", + "ĠAn notation", + "N IR", + "s gn", + "ĠO ften", + "Ġit erate", + "Ġcar riage", + "sp herical", + "ĠF rid", + "Ġdiff ract", + "ĠBas al", + "Ġuns atisf", + "ĠDys function", + "arboxyl ic", + "ĠCol lective", + "Ġdegrad ing", + "Ġadi posity", + "Ġfif ty", + "Ġpar s", + "ĠOptim ized", + "oc aine", + "Ġb b", + "ĠS hip", + "ĠL W", + "Ġtre mor", + "Ġà £", + "Ġnucle ons", + "Ġscienti st", + "ĠM ish", + "g ression", + "ĠM erc", + "ĠF lem", + "Ġcor als", + "In cre", + "ĠD SP", + "Ġdef enses", + "dim er", + "ather ine", + "ot ubes", + "str ide", + "ĠAlter ations", + "Ġo est", + "ĠB IC", + "Ġradi ated", + "Ġket amine", + "Ġdissimilar ity", + "ĠAnc ient", + "ĠH ed", + "Ġatt r", + "ĠIs a", + "Ġion ospheric", + "Ġgover nor", + "ĠEstim ated", + "Ġultr athin", + "Up date", + "Ġimmuno assay", + "Ġconject ured", + "Ġ REF", + "ĠSi egel", + "Ad v", + "M em", + "Ġp ups", + "ĠAP PL", + "ecom posable", + "j ournal", + "ĠR ol", + "ĠL ob", + "ring ton", + "Ġnons ingular", + "Ġcit ric", + "ion es", + "os itis", + "AL Y", + "Ġmen tions", + "ĠMark ers", + "algebra ic", + "Ġflatten ed", + "Ġm ail", + "ĠT GA", + "ĠP MA", + "ĠN aval", + "Ġfac ilitation", + "Ġun identified", + "Ġem pathy", + "ject ories", + "log its", + "Ġperman ently", + "Ġbott les", + "ĠBeng al", + "Ġpean ut", + "Ġcapill aries", + "eren ts", + "ĠLo oking", + "chang es", + "ĠMag ell", + "ĠC MC", + "ĠV erm", + "Ġsubs cales", + "dem and", + "ore xia", + "Ġachieve ments", + "ĠRobust ness", + "ĠWall ace", + "ĠD TT", + "og els", + "ock er", + "ĠSp ike", + "Ġpain ter", + "Ġbus es", + "Ġpoll uted", + "Ġt ort", + "ĠP PP", + "ne x", + "ext ended", + "ucal ypt", + "Ġpro static", + "ĠF CC", + "Ġk ick", + "oy al", + "epoch s", + "h ss", + "y on", + "Ġd ans", + "ĠA w", + "Ġad versely", + "Ġalt ogether", + "Ġophthal m", + "Ġc pu", + "ĠF RET", + "Ġfore nsic", + "Ġhot spots", + "Ġpain tings", + "Ġo mn", + "Ġp S", + "og lu", + "of ol", + "FT s", + "Ġderm at", + "prag ma", + "Ġb ump", + "ĠC ir", + "a S", + "Ġn aked", + "ĠN LS", + "ĠSp itzer", + "Ġsal vage", + "Ġintu itively", + "Ġcas ual", + "Ġf ired", + "ver ages", + "ĠBur den", + "W ang", + "yle m", + "Ġradi ographs", + "ĠSch iff", + "OL UTION", + "C ross", + "Ġh ints", + "ow ing", + "ĠSt reng", + "ĠAN Y", + "Ġwor ry", + "ĠRog er", + "Ġtrabec ular", + "B and", + "ĠN ec", + "ip es", + "to ol", + "ĠIL C", + "i Äĩ", + "o cean", + "ĠA ri", + "AM A", + "ĠVer tex", + "activ ate", + "L ocation", + "on ts", + "Ġh s", + "Ġsl ender", + "ref ring", + "ĠEnd ogenous", + "adi abatic", + "Ġcryp tic", + "Ġerad ication", + "ĠKev in", + "Ġm c", + "Ġcardi o", + "Ġphosphor yl", + "W itten", + "Ġs cl", + "ĠI w", + "ĠM ade", + "Ġfound ing", + "ofl ag", + "al ine", + "hor izontal", + "ĠGeneral ization", + "psy chiatric", + "ĠD uncan", + "ĠSn O", + "ĠA ar", + "Ġg g", + "Ġpre mi", + "ĠSt rom", + "ĠEx plan", + "Ġleth ality", + "Ï Ĥ", + "od o", + "Ġsub scrib", + "ĠST UDY", + "Ġoutper formed", + "Ġcoval ently", + "M HC", + "f ail", + "ĠK ac", + "EG R", + "ĠTR I", + "rob ot", + "ĠCandid ate", + "ĠTN BC", + "Ġarchae ological", + "E ukary", + "Ġl ava", + "di pole", + "Ġunc ons", + "An ti", + "Ġpred nis", + "ĠRob in", + "Ġstratig raphic", + "Ġ ¤", + "Ġfin ance", + "ĠStud io", + "re nder", + "Ġre aring", + "Ġg er", + "ĠO pt", + "ĠMan ifolds", + "Ġdest abil", + "Ġtel omerase", + "Ġpick ing", + "Ġamplic on", + "Ġyear ly", + "ĠN CC", + "ins er", + "ĠEn richment", + "ĠMicro structure", + "ĠWar ren", + "ophys ics", + "Ġfif teen", + "Å ij", + "Ġreview er", + "Ġsk illed", + "Ġmagnet oresistance", + "Ġrecon figuration", + "Ġpo et", + "Ġpred etermined", + "Ġcry opres", + "Ġattract ors", + "Ġprojec tile", + "ĠC rystals", + "ĠM CM", + "ĠX anth", + "Ġclock wise", + "regn ant", + "Ġg ated", + "ry za", + "ĠP rosp", + "ad in", + "Ġm olybdenum", + "ĠAl ps", + "ĠBal d", + "Ġhall uc", + "ud o", + "Ġmon t", + "ĠFl ash", + "Ġpull ing", + "ĠL Q", + "ĠWals h", + "ĠTh omson", + "mes on", + "Ġinter cal", + "Ġel apsed", + "FF FF", + "ĠFore casting", + "à ¯", + "ĠL SP", + "end orf", + "Ġx ml", + "sub strate", + "M u", + "d uring", + "oc onstr", + "EM A", + "Ġïĥ «", + "ĠD FS", + "ĠV on", + "Ġfat hers", + "Ġunc o", + "ĠUnd erg", + "Ġmultiplex ing", + "at ra", + "Ġco hesive", + "ĠU I", + "ĠPre v", + "çļ Ħ", + "c um", + "h f", + "ĠS CN", + "atal ysis", + "ĠAr sen", + "amp ing", + "ĠPl astic", + "ĠMad ison", + "Ġsuprem um", + "ĠC ited", + "Ġare n", + "isk i", + "in el", + "st ro", + "Ġcor rupted", + "Ġgl ab", + "Ġcardi opulmonary", + "Ġprag matic", + "C AG", + "St ack", + "thi oxo", + "ĠRepro ductive", + "Ġste atosis", + "B est", + "ĠB ars", + "Ġr acing", + "ĠU tah", + "equ ivalence", + "ĠFif ty", + "ĠCytok ine", + "Ġutil ised", + "hor izon", + "our acil", + "ivers ary", + "em er", + "ĠQ uestions", + "Ġlink ages", + "anche z", + "V V", + "Ġphotod et", + "k owski", + "RE ST", + "Ġhost ing", + "Ġpush ing", + "Ġneurot oxicity", + "S Q", + "r st", + "Ġh ockey", + "Ġtri ps", + "ĠInd oor", + "em atics", + "Ġtrans ect", + "ĠAB I", + "ag ar", + "âĪ ļ", + "eg enerate", + "ĠQ P", + "MI D", + "ĠAc cept", + "ĠCy ber", + "N orth", + "Ġd θ", + "all a", + "Ġbra id", + "f inding", + "al in", + "ĠL ST", + "ĠL ax", + "ud in", + "Ġi NOS", + "con vert", + "AC A", + "ĠGu an", + "Ġlymph ocytic", + "Ġsyll able", + "ĠT OR", + "ĠS CR", + "ĠA J", + "Ġout burst", + "bl adder", + "OT A", + "aud io", + "chrom en", + "Ñģ ÑĤ", + "Ġgrate fully", + "Ġt iling", + "Ġqu it", + "sh an", + "ĠAcc retion", + "Ġnarrow ing", + "ĠInduc es", + "M ic", + "Ġf uc", + "Ġth alamus", + "AN ES", + "Ġquatern ion", + "ĠLister ia", + "d uality", + "he nd", + "and e", + "Ġpa ro", + "Ġinsp ected", + "ques tion", + "ĠH oney", + "Ġch unks", + "Ġfore arm", + "radi ents", + "ific antly", + "ob ank", + "Ġsome where", + "Ġmon etary", + "ĠLouis iana", + "Ġem ulsions", + "Ġprogram mable", + "Ġmanif ests", + "ĠMart inez", + "Ġt ed", + "em en", + "ann i", + "Ġoverl aid", + "Ġvir ulent", + "M ask", + "ĠU tility", + "Ġw k", + "ose xual", + "ĠEar l", + "d ar", + "h dr", + "ract ors", + "Ġconstruct or", + "Ġnas cent", + "inz burg", + "ĠCra ig", + "Ġplex us", + "re verse", + "og rav", + "tag s", + "Ġcalibr ate", + "à ®", + "Ġh ide", + "ĠF ol", + "Ġinter acted", + "Ġconf ron", + "mark et", + "Ġsoci odemographic", + "ĠLuc as", + "ĠM CT", + "ĠR SS", + "Ġmicro plate", + "under st", + "I tal", + "ĠC MR", + "rec y", + "ĠPC OS", + "Ġdetox ification", + "Ġsubt ree", + "Ġsubs ections", + "Ġpropos itions", + "Acknowledg ements", + "reinfor ced", + "l is", + "ĠC IR", + "Ġim printed", + "vi um", + "af ic", + "Ġcheck list", + "ĠR x", + "ĠE ph", + "Ġsol der", + "trans formation", + "ĠStra it", + "az ar", + "Ġhand ler", + "ke let", + "B CL", + "M ath", + "Ġw ishes", + "um inescent", + "ĠP EC", + "ir t", + "yl idene", + "Ġlo osely", + "na issance", + "IL s", + "fo il", + "ĠGN U", + "ĠK et", + "vi x", + "ĠPl ain", + "ĠRE S", + "Ġparent ing", + "ĠConn ection", + "Ġrhiz osphere", + "opre valence", + "i atic", + "Ġp A", + "ĠV il", + "set ting", + "ĠRe LU", + "ĠBO OST", + "Ġappreci ate", + "b x", + "ore st", + "olog ie", + "Ġpal p", + "fo o", + "us ual", + "Ġquestion ed", + "Ġtrig on", + "ĠGF AP", + "ĠKy oto", + "dis e", + "anti le", + "ü ck", + "ĠQuanti zation", + "Ġs cler", + "Ġbe half", + "ĠD uality", + "Ġmagnetic ally", + "Ġeleg ant", + "U A", + "ep is", + "Ġsub clinical", + "ont rol", + "ĠChemical s", + "Util s", + "Ġlow ers", + "ext raction", + "Ġampl ifiers", + "ĠEnt ry", + "ĠWOR K", + "Ġthrombocyt openia", + "M il", + "id us", + "emb ry", + "man ager", + "ĠCo ordination", + "ĠPhen otypic", + "ch unk", + "Ġhypot ension", + "Ġcry ogenic", + "Ġreact ants", + "ĠM MSE", + "Ġcent ros", + "ĠBut ler", + "Ġcav itation", + "ĠLess ons", + "es tion", + "ĠM IS", + "ass oci", + "AP E", + "ĠEuler ian", + "Ġrecre ational", + "ĠNe o", + "ĠCD M", + "rep eat", + "det ails", + "B al", + "ST A", + "Ġâī º", + "ĠCam ero", + "ĠTele vision", + "Ġwork force", + "Ġcomputer ized", + "Ġextra ordinary", + "Ġrib onucle", + "Ġhydroph obicity", + "ĠFeas ibility", + "O l", + "T w", + "ĠM am", + "ĠF AC", + "pro fit", + "negl igible", + "ĠF ruit", + "Ġear s", + "Ġshe aring", + "ĠCorrespond ing", + "f un", + "i eck", + "m os", + "ĠE MI", + "ĠSome times", + "Ġfluor ine", + "Ġdeterg ent", + "Ġal g", + "rac es", + "iv able", + "CO MM", + "ĠSw itch", + "Ġstra ined", + "vir tual", + "Tem perature", + "Ġcredi ble", + "ĠG PCR", + "ĠDe bye", + "ĠL it", + "Ġhe mic", + "Ġtrans ducers", + "met ast", + "adi ene", + "Ġoryz ae", + "t n", + "Ġafter noon", + "ĠArab ian", + "ĠChrom atin", + "Ġxen ografts", + "Ġcrypt ographic", + "Ġax illary", + "Ġvolunte er", + "ĠNev ada", + "Ġp ions", + "un known", + "ĠF U", + "ven ously", + "radi o", + "ĠLab our", + "ĠVill age", + "R ic", + "Ġmet at", + "Ġser otypes", + "reg ression", + "s aturation", + "re ra", + "Ġfar ther", + "Ġround ing", + "Ġlib itum", + "Ġsh uff", + "ĠO w", + "Ġlocal ised", + "ĠAL G", + "Ġhypert rophic", + "p pm", + "im ine", + "ĠA the", + "Ġan hydro", + "Ġsup ramolecular", + "Ġmac ros", + "acet ed", + "ĠOl iv", + "Ġmotiv ational", + "ĠC ave", + "enz ie", + "Ġaffili ated", + "Ferm i", + "Ġequal ities", + "ĠMil an", + "Ġd ressed", + "Ġan ger", + "ad os", + "Ġav g", + "ĠPh on", + "Ġradio activity", + "ĠE ch", + "Ġorgan oids", + "Ġïģ §", + "ĠAnth rop", + "l ateral", + "Ġal pine", + "Ġaud it", + "W ER", + "ĠC SC", + "Ġrank ings", + "ĠER R", + "GL ER", + "Ob viously", + "ĠMad rid", + "obenz ene", + "other mia", + "Ġrespons ibilities", + "omes tic", + "ĠInf lation", + "Ġepidem ics", + "Ġt aut", + "ph os", + "ĠUn less", + "Ġge omagnetic", + "ĠCF TR", + "vel d", + "ari etal", + "Ġend otoxin", + "AD P", + "Ġsupp ressive", + "rand ial", + "Ġïĥ ©", + "exc ited", + "ĠInn ate", + "ĠL ópez", + "omyc etes", + "Ġbe autiful", + "ir k", + "ĠH wang", + "ĠU SE", + "ÏĢ i", + "Rec ord", + "Att ribute", + "Ġre acts", + "ĠB und", + "Ġcow ork", + "Ġconf luence", + "ĠReg ardless", + "Ġmetagen omic", + "M AL", + "Ġa ided", + "ang a", + "Ġam n", + "ĠI CI", + "ĠP ML", + "Ġdel ivers", + "Ġke yp", + "Ġbeet les", + "Ġoxid ant", + "Im mun", + "Ġrhyth mic", + "fem ale", + "J C", + "P AD", + "gen itor", + "A MS", + "c atalytic", + "ĠM om", + "ĠH ert", + "ad ish", + "Ġcont ention", + "Ġy olk", + "Ġdem yel", + "Ġsuc c", + "Ġtravel s", + "V e", + "ĠF ul", + "ĠR if", + "Ġint rons", + "enc aps", + "col our", + "Ġhot el", + "Ac cess", + "ado op", + "Ġcoal ition", + "ĠMu h", + "ĠL TP", + "aut om", + "ĠL ak", + "Ġrem edi", + "Ġtra iling", + "ins ulator", + "ĠRel ig", + "ĠHud son", + "em ics", + "O Ac", + "our t", + "Ġrel ic", + "ĠMi xture", + "Ġcalor imeter", + "ĠR DF", + "ĠHod gkin", + "Newton ian", + "ĠDelay ed", + "ĠNorthe ast", + "her ing", + "Ġhel ices", + "Ġprincip ally", + "Ġsusp icion", + "Ġextrem ities", + "Ġdead line", + "ĠEnter ococcus", + "m j", + "Ġh p", + "ĠN AS", + "ous s", + "Ġintram uscular", + "L IN", + "Ġch icks", + "S core", + "Ġf ür", + "ĠR SA", + "Ġk r", + "Ġphot ography", + "Ġclear ing", + "hol omorphic", + "t hem", + "Ġp om", + "ĠL is", + "Ġdisc ard", + "Ġgu an", + "c x", + "ub ov", + "ĠCons istency", + "Ġple i", + "ĠUr inary", + "Ġbread th", + "E I", + "m echan", + "Ġd q", + "ĠBl ast", + "co eff", + "IL D", + "Ġunem ployment", + "A rm", + "ĠC n", + "mod erate", + "Ġagg ress", + "Ġcircum f", + "l os", + "Ġb aro", + "velop e", + "Ġulcer ative", + "Ġhelic ase", + "H W", + "K G", + "r ion", + "Ġgen otyped", + "Ġar id", + "ĠAndre as", + "Ġthere of", + "ĠOper ating", + "ĠNE W", + "ĠAntib acterial", + "ĠDar win", + "Ġrefere e", + "Ġd ome", + "ag us", + "ĠD MD", + "AT OR", + "Current ly", + "ĠInequ alities", + "d N", + "ol ymer", + "em pirical", + "ĠBra un", + "F IN", + "ĠO ber", + "pr one", + "Ġdimin ish", + "ĠGrad uate", + "ĠT SH", + "ĠH su", + "oid osis", + "Ġepid ural", + "Ġreinfor cing", + "Ġthe atre", + "Ġv ib", + "ĠH ob", + "col lection", + "MAN GLER", + "ĠH ecke", + "Ġtr uck", + "Ġmotiv ates", + "ĠV OC", + "Ġun bound", + "ram id", + "ious ly", + "ĠFern ández", + "ĠF acial", + "ox azol", + "Ġtre adm", + "ĠRes id", + "Lo ader", + "ĠRun ning", + "otin ib", + "P AC", + "V II", + "i u", + "Ġc ite", + "ĠH ockey", + "ES C", + "rho ea", + "Ġmac aques", + "Ġmedi ast", + "at im", + "ĠT MP", + "ĠA GB", + "ĠR up", + "ug a", + "Ġass urance", + "p ay", + "en ergies", + "ĠK end", + "till ery", + "Ġanest hetic", + "Wind ow", + "Ġbe verages", + "ag uchi", + "ĠFL T", + "ĠBound ed", + "ĠPolymer ase", + "S am", + "ĠOr bit", + "Ġseason ality", + "Ġtachy cardia", + "este em", + "ĠPerf ect", + "S EC", + "l ater", + "tal e", + "ĠForm ally", + "L G", + "z yn", + "Ġmicro algae", + "Ġindi um", + "erenn ial", + "ĠI PT", + "Ġk j", + "ĠPD A", + "Ġassim il", + "whe el", + "ĠS OS", + "ĠP FC", + "Ġdec oded", + "AT S", + "Ġsoci etal", + "Ġdiffe omorphisms", + "Ġtra verse", + "Ġcoll ateral", + "g ives", + "ĠC EN", + "Ġra nd", + "Ġher self", + "Ġpay ments", + "Ġps i", + "âIJ £", + "ĠGrom ov", + "Ġacc idental", + "ĠRe ality", + "Ġlog istics", + "Ġrobust ly", + "ĠSar ah", + "N U", + "d ates", + "ĠC UR", + "ĠD ream", + "Ġdegrad es", + "ĠGE O", + "Ġbutter fly", + "Ġpend ulum", + "q a", + "Ġas partate", + "pseud o", + "Ġall osteric", + "der r", + "ĠQ oL", + "Ag ilent", + "ĠHard ware", + "ĠCum ulative", + "Ġp n", + "qu antitative", + "Ġapp raisal", + "Ġpoly acrylamide", + "Ġmild ly", + "Ġcontrac eptive", + "ĠPubl ished", + "Ġupl ift", + "be h", + "Ġadap tor", + "ĠEqu al", + "thien yl", + "at ched", + "Ġrep ly", + "Ġup wards", + "Ġaut opsy", + "sim ulation", + "Ġgran ite", + "Ġpel vis", + "Ġhat ching", + "ĠS PS", + "ĠG EM", + "illi ard", + "ĠRet rospective", + "ĠEarth qu", + "ĠInvestig ations", + "ĠMer ck", + "Ġchol angi", + "Ġinfiltr ating", + "Ġoverestim ated", + "focus ed", + "A min", + "Ġpre eclampsia", + "osp atial", + "ĠTRA IL", + "P air", + "Ġsub marine", + "Ġprote olysis", + "Ġcomple ments", + "ĠKir ch", + "Ġcent rom", + "Ġn ap", + "ĠWe ar", + "Ġpun ishment", + "Ġautoreg ressive", + "Ġcompos er", + "ĠEng el", + "Ġana emia", + "ĠKron ecker", + "ĠD id", + "ĠCar p", + "pe er", + "Ġbug s", + "ĠIslam ic", + "ith romycin", + "Ġcons ec", + "Ġfam iliarity", + "et axel", + "Ġint ensively", + "ĠU pt", + "Ġindic a", + "AD A", + "ĠChe byshev", + "Ġhierarch ies", + "Ġworth while", + "Ġburn ed", + "ĠHM GB", + "Ġpolyg onal", + "b rile", + "Ġz oon", + "war ning", + "Eukary ota", + "d A", + "ĠRep eated", + "ĠCast ro", + "Ġmet ropolitan", + "ont inuous", + "ĠBar nes", + "ĠPost operative", + "Ġcyt ology", + "Ġspot ted", + "vers ity", + "aff ine", + "sor ted", + "ĠPro to", + "ĠDes criptive", + "Ġhit ting", + "Ġanalog ously", + "feed back", + "Ġspirit ual", + "ĠL INE", + "ress in", + "oph thal", + "Ġpoly unsaturated", + "Ġpi per", + "observ ations", + "ĭ ¤", + "ir re", + "ĠW NT", + "Ġund ifferentiated", + "eral d", + "ĠCT C", + "Ġhomomorphism s", + "ĠNeon atal", + "F in", + "ro zen", + "ĠL ux", + "Ġmod ifier", + "ĠK A", + "osa ur", + "Ġinterven tional", + "ĠHa pl", + "Ġlumin ance", + "Ġun fortunately", + "Ġsleep ing", + "Ġcit rus", + "reson ance", + "Ġm oss", + "ul ay", + "ĠP enn", + "ad ministration", + "ĠN GF", + "Ġsec ured", + "ĠA Es", + "ĠP WM", + "oc co", + "ob uf", + "Ġphotoc urrent", + "ĠScilab Double", + "A pril", + "Ġfor amin", + "Ġpar alysis", + "ĠQu ark", + "eq ref", + "ĠBro oks", + "ĠColl ision", + "W ar", + "Ġ ig", + "am ylase", + "ist ered", + "Ġret raction", + "ĠMulti plex", + "ĠMa o", + "Com mon", + "ĠEcon omics", + "ĠCriter ion", + "ĠC CC", + "ĠLe i", + "Ġorth orhombic", + "Ġaliqu ots", + "Ġst ric", + "ĠL enn", + "Ġdis closure", + "amet h", + "Ġnormal isation", + "Ġphyl ogen", + "ĠQTL s", + "ĠVers us", + "ĠUtil ization", + "y ne", + "un ted", + "ĠD uff", + "ĠG J", + "Ġoptim ised", + "iform is", + "ĠIncre ases", + "ĠFD G", + "ĠBatter y", + "P he", + "ĠC CS", + "Ġch rys", + "of en", + "Ġmultic omponent", + "disc ussed", + "bond ing", + "ore tically", + "ĠAll iance", + "Ġhead quarters", + "ĠGlas gow", + "Ġb out", + "Ġe ighth", + "Ġinc urred", + "ĠBar ry", + "Ġquad ric", + "Ġdu ties", + "Ġmind fulness", + "rastruct ural", + "T rain", + "sh itz", + "CD C", + "Ġdys lipidemia", + "Ġalle ged", + "Ġbron ze", + "Ġattain ment", + "Q D", + "rom bin", + "Ġap olipoprotein", + "own ed", + "Ġge ographically", + "work ing", + "ĠBl ind", + "Ġdon ation", + "ĠSer ge", + "Ġspread s", + "ĠHeter ogeneity", + "ĠFr é", + "Ġdef er", + "Ġlif ts", + "EGF R", + "ĠPort land", + "Ġbrother s", + "ĠTrypan osoma", + "in ian", + "Ġp ressed", + "Ġtrans duced", + "Ġpol yn", + "Ġlist eners", + "bo ards", + "ĠSustain able", + "al an", + "ĠS ullivan", + "Assum ption", + "oft en", + "j p", + "or ative", + "pl ers", + "Ġmodular ity", + "ĠHerm ite", + "Ġhydroxy apatite", + "ĠHir sch", + "D eterm", + "f acing", + "ir radiated", + "Ġhar sh", + "Ġtoler ate", + "ĠT rap", + "ĠA ware", + "ot ax", + "AT ING", + "Ġhist opathology", + "ĠIsra eli", + "clock wise", + "z ig", + "ĠJ C", + "ĠQu ick", + "ĠSL AM", + "Ġf ox", + "ĠR av", + "gener ating", + "Ġhemat oxylin", + "yl transferase", + "Ġcorrobor ated", + "F DR", + "o ard", + "Ġequ id", + "Ġ »", + "Ġneuro psychological", + "Ġbreak up", + "Ġemphas izing", + "Ġemiss ivity", + "block ing", + "Ġpar all", + "Ġtil ting", + "Ġp eng", + "ĠSc an", + "Ġion osphere", + "Ġm ount", + "fore st", + "Ġcall us", + "α β", + "ĠChrist mas", + "ĠMag azine", + "eval uate", + "ĠP ag", + "ĠBe at", + "Ġaccum ulates", + "Ġcrow ding", + "unn eling", + "Ġ Ñ", + "ĠA CP", + "ge ometry", + "MP T", + "Ġpharmac ists", + "Ġpull back", + "Ġduc tility", + "S upervised", + "Ġlymph oblastic", + "pe a", + "typ ical", + "bro ken", + "F c", + "Ġl ining", + "ĠD um", + "Ġmulti ples", + "ó w", + "Ġmer its", + "Ġextinc t", + "ĠNur sing", + "ĠExplo iting", + "ĠBhatt ach", + "J uly", + "t ze", + "th romb", + "te enth", + "Ġtoxic ities", + "Ġdenit rification", + "Ġex position", + "Ġim perf", + "Ġsur name", + "po inter", + "ĠEr n", + "ĠAbund ance", + "ĠD unn", + "oph ora", + "Ġtool kit", + "Lo ad", + "ĠDeriv ation", + "c ould", + "ĠC aspase", + "ĠSp rague", + "ĠTr p", + "Ġbright est", + "ill ard", + "Ġinter disciplinary", + "Ġqu arant", + "Ġhyper surfaces", + "eli ac", + "ĠAL MA", + "Ġacryl ic", + "Ġgent le", + "De ep", + "ĠPand emic", + "Ġinf easible", + "Ġradi ol", + "AB P", + "Ġmes enteric", + "ylind er", + "pack ed", + "Ġsomat osensory", + "Ġp ave", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠ", + "Ġpharmac ology", + "Ġtan h", + "ĠMt b", + "Ġchim pan", + "Ġautophag ic", + "Ġwithd rawn", + "ĠM CC", + "Z F", + "ĠS pl", + "ĠL au", + "Ġbi ologic", + "elect rons", + "Ġunderestim ation", + "Ġcharacter ise", + "circ ular", + "ĠTHE ORY", + "B rown", + "F BS", + "J o", + "d G", + "m ars", + "ar ticular", + "ĠP ren", + "ĠM SA", + "ĠIt em", + "Ġsem idefinite", + "ĠGib son", + "Ġtour ism", + "ĠK ok", + "Ġexpos ing", + "Ġintra venously", + "dri ver", + "ĠFort unately", + "ĠS ach", + "Ġcont aminant", + "Ġab rog", + "ĠEm otional", + "VAL UE", + "dispers ion", + "Jac obi", + "ĠImper ial", + "I on", + "L in", + "f idelity", + "ĠB irds", + "ĠCon current", + "mat ism", + "co al", + "Ġt q", + "ĠMn O", + "Ġfoss ils", + "Ġt ender", + "Ġr hesus", + "Ġblo om", + "ab dominal", + "Ġscal p", + "Ġhome ostatic", + "ĠH unt", + "ĠPharmac okine", + "b rown", + "ĠH YP", + "Ġdiss ociated", + "ĠSoc cer", + "ĠInequ ality", + "m aker", + "Ġsh ade", + "ĠZ ur", + "obs ervation", + "al tered", + "U U", + "Ġthe or", + "ep it", + "Ġphyl um", + "Ġvig orous", + "ĠA CM", + "Ġmeth otrexate", + "dem ographic", + "Ġsing ly", + "ĠPhys iology", + "Ġremod elling", + "ĠK rist", + "rop ies", + "flow s", + "hard ness", + "igh teen", + "bre ve", + "ĠRet inal", + "Ġscin till", + "Ġutter ance", + "Ġmonolith ic", + "ĠVl ad", + "ĠL MC", + "ip t", + "arrow s", + "ĠPubl ishing", + "ĠStrept omyces", + "f al", + "Ġtroposp here", + "B en", + "c andid", + "ĠS ic", + "tim ore", + "L en", + "in en", + "amp ered", + "ĠMon th", + "Ġopp onent", + "Aug ust", + "Ġst aggered", + "cent re", + "exp ect", + "Ġred dening", + "ĠT l", + "hib ition", + "Ġmicro particles", + "ĠInt rac", + "ĠInitial ize", + "Ġdict ated", + "D ig", + "ä º", + "he aling", + "Ġd V", + "Ġappe tite", + "Ġunus ually", + "ĠAstr onomy", + "Ġw are", + "Ġover coming", + "Ġcoll iders", + "ĠUS ING", + "ocardi tis", + "P ick", + "Ġd ub", + "ĠJ ason", + "ĠEd itor", + "ê ³", + "Ġl ags", + "Ġcl s", + "Ġsur gically", + "ĠPV C", + "par ticularly", + "Ġred ist", + "Ġlog ics", + "sk ii", + "ĠD VD", + "Ġcomp ly", + "az i", + "ĠInter acts", + "bo olean", + "ĠER P", + "ĠEr r", + "otrans piration", + "ĠPé rez", + "A sp", + "am iliar", + "ĠF etal", + "Ġdecl aration", + "k inson", + "t ube", + "Ġphysiological ly", + "c ue", + "ĠE ri", + "Ġen vision", + "ex ternal", + "inter mediate", + "Ġshop ping", + "ĠF ras", + "ĠH aj", + "ĠAl ger", + "Ġanthrop ometric", + "Ġcancell ed", + "H PV", + "k ers", + "af a", + "Ġvulner abilities", + "electro lyte", + "ĠGonz alez", + "íķ ĺ", + "q v", + "Ġde af", + "Ġbut yrate", + "ĠCo efficient", + "Ġstar burst", + "Ġpolym orph", + "ĠE RA", + "ĠMax imal", + "ĠMu eller", + "Ġabsor bers", + "Ġa rab", + "re tions", + "Ġne bula", + "Ġmin es", + "е н", + "%%%%%%%% %%%%%%%%", + "Ġband pass", + "Ġpoly urethane", + "Re LU", + "ĠFer ro", + "pic illin", + "C AD", + "T y", + "ĠP CD", + "ĠB AC", + "Ġplankton ic", + "F er", + "Ġc ricket", + "Ġman ure", + "oun s", + "âĪ §", + "Ġtor ques", + "m itian", + "Ġt ion", + "ĠG arden", + "Ġfol k", + "Ġsusp icious", + "à Ĥ", + "od ia", + "ist encies", + "ãĢ ī", + "ĠInv itrogen", + "ĠS UN", + "ĠSuper ior", + "Ġdiscontinu ation", + "c ock", + "k not", + "Ġext ens", + "ĠWh itney", + "Ġhar bour", + "P ID", + "Ġp mol", + "ol ymph", + "Ġg ard", + "ĠO varian", + "Ġrep ressed", + "ĠAl ab", + "Ġà Ħ", + "ule x", + "ĠAust rian", + "Ġa flat", + "Ġpar athyroid", + "Ġgroup oid", + "Ġdev ast", + "ĠK v", + "Ġbor row", + "Ġuncon ventional", + "Ġbore hole", + "Ñ Į", + "ĠD ays", + "Ġlex ic", + "N or", + "ĠH erc", + "ass ays", + "Ġdraw ings", + "def in", + "ev oked", + "ĠÈ ³", + "ĠSund ay", + "ĠC hes", + "cons idered", + "oped ic", + "larg er", + "om inant", + "ĠB omb", + "Ġf iss", + "Ġh inge", + "ĠI onic", + "Ġdest ro", + "Ġcomplement arity", + "Hig gs", + "or ia", + "our cing", + "ĠX in", + "Ġwork space", + "ĠLig and", + "Ġstrugg le", + "ĠImmunohist ochemical", + "Ġn ick", + "ĠGu ard", + "rig id", + "Ġaqu aculture", + "Experim ent", + "Ë Ī", + "ti r", + "ĠS MS", + "Ġbe vacizumab", + "Ġmod ulations", + "Ġge ophysical", + "Pro perties", + "Ġpain ted", + "Ġs anc", + "Ġin timate", + "Ġn ail", + "id entity", + "Ġdat um", + "anth us", + "Ġdy adic", + "Ġconvinc ing", + "e lem", + "Ġh iding", + "Ġr ugby", + "ĠX e", + "ĠIs sue", + "Ġves icular", + "ĠKel vin", + "Ġdist ancing", + "echn ology", + "af ers", + "ĠAut hentic", + "Pub Med", + "Ġdeform ity", + "ĠCha os", + "ĠSh ield", + "ox etine", + "ĠWork ers", + "ĠMO I", + "Ġdehyd rated", + "ĠGast ric", + "Ġmonomial s", + "od ox", + "ĠD ublin", + "Ġle ishman", + "Ġpl anner", + "circ le", + "Ġfract ured", + "ĠLoc ally", + "ĠAc tions", + "Ġlic hen", + "h annel", + "ĠT AG", + "Ġdec isive", + "ĠQ M", + "Ġbiom aterials", + "ĠVirus es", + "hydrox yphenyl", + "ĠI AA", + "ĠR U", + "vi olating", + "Ġp ockets", + "ch ant", + "ib erg", + "lect omy", + "oler ae", + "Ġattract ing", + "Ġket one", + "ĠC od", + "Ġmicro arrays", + "ĠMet als", + "benz oyl", + "Ġsemigroup s", + "Ġreconstit uted", + "s ites", + "an abe", + "ĠCom posites", + "Ġwild type", + "Ġleuk aemia", + "Ġmur der", + "Ġdent in", + "H ub", + "O rient", + "on n", + "syn chron", + "Ġchron ically", + "methylene amino", + "Ġdop ant", + "Ġf ecundity", + "de lete", + "rem ia", + "ĠNH L", + "iti dis", + "Ġcop ep", + "X I", + "Ġloc ating", + "ĠZ IKV", + "hex a", + "ĠFactor ization", + "ynch us", + "M ethyl", + "h agen", + "ĠP aw", + "ne ath", + "bs ite", + "Ġtrac he", + "B re", + "u w", + "ro it", + "Ġre acting", + "ĠB ae", + "Ġquoti ents", + "Ġp ins", + "ĠV ARI", + "Ġequ ine", + "ĠRun ge", + "Ġcolon ial", + "measure ment", + "ĠAbb ott", + "Ġorth o", + "Ġmeta phor", + "benz oic", + "ĠTransform ers", + "L ower", + "ĠO VA", + "radi al", + "Fl ag", + "author bs", + "Ġtreadm ill", + "Ġenter ica", + "ĠJul ia", + "Ġpl umes", + "Ġinv oke", + "chlor ic", + "ol ino", + "Ġinter ruption", + "sub unit", + "ĠMD P", + "Ġmanip ulator", + "ĠScal es", + "ĠHT ML", + "ĠFreder ick", + "G arc", + "Ġb ell", + "ĠR ect", + "rom ised", + "W ord", + "o ples", + "oper ated", + "Ġcollec ts", + "ĠHor izon", + "Ġsa fer", + "d up", + "ĠM ills", + "AL P", + "Ġex opl", + "AT TR", + "war a", + "ĉĉĉĉ ĉĉĉ", + "Ġdeb ug", + "Des criptor", + "stat istics", + "ĠC ub", + "ST ER", + "ĠSt abilization", + "ĠIR AS", + "Ġconform ally", + "Ad ap", + " Ń", + "ĠQ S", + "Ġmicro strip", + "Ġdel icate", + "Ġpubl isher", + "Ġh os", + "ĠS v", + "ĠDes ert", + "ĠGu er", + "ĠCap ture", + "E BP", + "d ust", + "å ¤", + "ĠO ls", + "Ġsuper script", + "ĠFl uctuations", + "ill ium", + "Ġcap tion", + "Ġconc ur", + "Ġquantif ies", + "ster dam", + "Ġspik ed", + "N an", + "us in", + "ĠL AN", + "Ġobserv es", + "ĠAl a", + "ĠInt uitively", + "cur r", + "Ġshr inking", + "Ġcompress ibility", + "orp oreal", + "Ġdeb t", + "ç Ķ", + "ĠT il", + "ĠW AT", + "ody ne", + "Ġgate way", + "Ġduc tile", + "ĠJes us", + "os itol", + "ĠM ales", + "Ġsol vation", + "Ġdisag ree", + "Ġortholog s", + "S an", + "ig o", + "Ġph ages", + "Ġneg atives", + "Ġinterp re", + "AA A", + "Ġgrating s", + "ĠM oll", + "ĠR ivers", + "Ġcr uzi", + "ĠGen erate", + "ĠBar bara", + "ĠHer itage", + "ĠFlu orescent", + "ĠLaw s", + "Array Expr", + "Ġmultip ole", + "Ġsquee zing", + "S PSS", + "l f", + "n lm", + "Ġw orn", + "ĠK uz", + "Ġgenes is", + "ĠEm peror", + "vol atile", + "Ġsib ling", + "iv ir", + "o en", + "Ġprot ost", + "Ġtransform ers", + "enn ium", + "Ġpropos ing", + "Ġbroadcast ing", + "Q M", + "ĠD ependent", + "Ġdis able", + "ĠU AS", + "Ġwar nings", + "Ġarm ed", + "Ġjournal ist", + "Ġmonoc linic", + "ol ium", + "ap ing", + "to on", + "Ġorth odontic", + "ĠNormal ization", + "Ġmand ible", + "ab an", + "ĠW ak", + "ext end", + "Multi ple", + "in vestig", + "is cal", + "ut tered", + "Ġbur g", + "dec ode", + "em por", + "ĠD uration", + "ann y", + "opro st", + "ĠRen ormalization", + "ĠF UNCTION", + "yt orch", + "Ġsyn apt", + "ĠForm at", + "ĠCR T", + "ĠJon athan", + "ĠOF F", + "or r", + "Ġres ur", + "Ġcor ruption", + "d welling", + "Ġback up", + "AG T", + "ĠSaf e", + "dor fer", + "Ġatax ia", + "Ġpar v", + "read er", + "Ġsubt ract", + "embol ism", + "Ġt innitus", + "Ġcyt omegalovirus", + "Ġdele ting", + "T ex", + "ĠC SS", + "ard t", + "Ġout growth", + "Ġmy ocytes", + "dig ital", + "Ġsub scale", + "usp ension", + "Ġham ster", + "Ġinflat on", + "h ara", + "ur ches", + "ĠC LE", + "ĠY as", + "ĠEn coding", + "ĠAug er", + "Ġanastom osis", + "A gent", + "ĠS IL", + "ĠC CT", + "Ġbr ine", + "Ġolig o", + "Ġfluor o", + "Ġgall ery", + "d dots", + "Ġc ilia", + "ĠP PV", + "ĠU TR", + "Ġinter tidal", + "ocal ized", + "Ġcrow ds", + "od or", + "Ġco v", + "Ġnon etheless", + "Ġïģ ¤", + "Ġboost ed", + "ĠChak ra", + "H al", + "P ear", + "Ġimp rec", + "ĠSup plement", + "go al", + "Ġôı¼ ģ", + "Ġst all", + "Ġher d", + "small er", + "Ġreconstruct ing", + "Ġarte facts", + "Ġt eg", + "con ventional", + "rad ical", + "Ġliter al", + "frame work", + "ipro cal", + "E EG", + "Ġg ins", + "od ermal", + "ĠAg u", + "ĠTw elve", + "M ul", + "Ø ¨", + "ir l", + "ĠB elief", + "Ġinc ont", + "IC C", + "hex ane", + "Ġe jected", + "ĠP SC", + "ĠH PC", + "ĠV H", + "Ġequival ences", + "plot lib", + "en ital", + "ri ans", + "pro v", + "ĠV ibr", + "Ġgram matical", + "bach ia", + "accept able", + "od icity", + "ab b", + "Ġher bs", + "Ġpredom inance", + "ĠOrient ation", + "Ġinver tebrate", + "Ġpel agic", + "count ry", + "ĠOrig ins", + "ĠAdoles cents", + "ĠT uning", + "rain ian", + "ĠSc ar", + "Ġlight est", + "Ġemit ters", + "ĠTs ai", + "ri tical", + "ĠEx pert", + "aut hors", + "E CTION", + "ĠSever ity", + "N am", + "p ubl", + "ĠA be", + "Ġnanoc rystalline", + "ĠNak amura", + "ĠP ec", + "ĠB ug", + "Ġsens ed", + "ON S", + "IC s", + "Ġelectro chem", + "ĠR OM", + "ĠRec ruitment", + "Ġ⣠©", + "Ġbiomo lecules", + "ĠB rac", + "Ġtrans position", + "ĠW P", + "ĠO mega", + "Ġdiag on", + "plate let", + "J M", + "ac re", + "ĠA SR", + "ĠK ath", + "Ġpri v", + "opl asts", + "S amples", + "d F", + "at ti", + "ĠS anger", + "ip itated", + "Ġric her", + "ĠG RA", + "Ġplant ar", + "Ġfo ams", + "Ġmathem atic", + "Ġsta phyl", + "ĠUpt ake", + "Ġc ant", + "ĠS Z", + "Ġdis miss", + "Ġselec tions", + "plit z", + "Ġexempl ified", + "Ġtors ional", + "E v", + "Ġv oters", + "ĠN est", + "ys cale", + "Ġspec i", + "Ġpol ished", + "Ġlat encies", + "q ing", + "Ġon wards", + "ll vm", + "the orem", + "log ging", + "ĠAL K", + "ĠBa um", + "ĠGh osh", + "Ġchair man", + "p aired", + "ĠP AP", + "not es", + "olester olem", + "Ġestu arine", + "ĠTibet an", + "ĠV ER", + "Ġcheck er", + "FLAG S", + "rol imus", + "ĠMut ant", + "Ġspray ing", + "ĠC hest", + "olin ium", + "ĠTri assic", + "Ġlid ar", + "A rt", + "ĠM ilk", + "Ġind ecomposable", + "Ġrock et", + "ĠPart ners", + "Ġseman tically", + "entin el", + "L arge", + "P en", + "ĠT ru", + "Ġher itage", + "ĠMut ual", + "ĠChem otherapy", + "Ġdoub les", + "ĠEmbed ded", + "it ual", + "ĠB PA", + "Ġch olerae", + "ĠIn side", + "ĠK atz", + "con vergence", + "Ġindividual ized", + "kin je", + "Ġdiscover ing", + "Ġintric ate", + "Ġin land", + "RE CT", + "ĠCh ick", + "ĠSU R", + "Ġye asts", + "l uminosity", + "Ġf ain", + "ion i", + "ĠT ig", + "ound er", + "Ġdel iber", + "ĠCons ervative", + "ĠDel hi", + "B ER", + "ĠY B", + "ole y", + "ĠBe au", + "TE XT", + "Ġsquee zed", + "Ġs ocket", + "Ġp T", + "py razol", + "co efficients", + "Ġrecruit ing", + "Ġduc ts", + "Ġf oster", + "om eration", + "ĠP SI", + "ĠD up", + "Ġk s", + "ĠOp tics", + "Ġliter ary", + "ĠNi O", + "ĠVEGF R", + "Ġgravit on", + "Ġutter ances", + "Ġb rady", + "Ġfor ty", + "ĠTrans plantation", + "Ġagre ements", + "Left rightarrow", + "w aves", + "Ġacid osis", + "Ġwood en", + "ĠCytoplas mic", + "s afe", + "Ġj umping", + "enn ial", + "Vari ous", + "ĠEry th", + "ul ins", + "un lock", + "methyl ated", + "asser stein", + "Ġheterozyg osity", + "oxy cycl", + "Ġcre ativity", + "MP LE", + "in ative", + "Ġcon volutions", + "Ġno uns", + "eg an", + "ĠAb raham", + "Ġdens er", + "C he", + "l c", + "ĉĉ ĉĠ", + "Ġsem im", + "ĠOut er", + "Ġc and", + "od ule", + "est hesia", + "ĠJ oy", + "ĠProt ocols", + "ĠCalc ulated", + "at op", + "ĠF ALSE", + "Ġref in", + "Ġmig rants", + "ĠïĤ ´", + "ĠSpecific ity", + "ĠFellow ship", + "ĠP MT", + "Ġdis close", + "unc hes", + "Ġdi atoms", + "cor r", + "Ġsky rm", + "Ġrenew al", + "g cd", + "ce reb", + "Ġup right", + "Ġmes oscopic", + "hyd raz", + "B AS", + "F LO", + "H CC", + "M ouse", + "Ġpos et", + "Ġprotein uria", + "Ġre app", + "ĠN ickel", + "Ġstrip es", + "Ġrip ple", + "Sep tember", + "od omain", + "ĠP ope", + "ĠN ons", + "Ġtechn ic", + "Ġneut rop", + "des criptor", + "Ġdissip ated", + "Ġglac iers", + "ĠH IGH", + "ĠL av", + "ret ely", + "Ġback wards", + "Ġcri tics", + "ĠExt ending", + "b ic", + "ĠCh ao", + "of ibr", + "Ġcoun ters", + "Ġstre ets", + "Ġprost hetic", + "Ġbiod egradation", + "complex ity", + "ĠS PL", + "ĠC AC", + "Ġad ducts", + "Ġmorph ometric", + "ĠMat t", + "Ġinduc er", + "Ġast rocyte", + "Ġtriple ts", + "Ġpert ussis", + "P ES", + "id y", + "unc ertain", + "Ġhyper parameter", + "ĠInf rastructure", + "ìĿ ĺ", + "Z W", + "Ġadd r", + "Ġdisrup ts", + "Ġove restimate", + "ĠDY NA", + "Ġvolat iles", + "em erg", + "iss ue", + "c pp", + "Ä ħ", + "ĠV IP", + "Ġu ve", + "ĠCN V", + "yleth yl", + "on azole", + "ĠH iro", + "Ġc n", + "ti k", + "ub ted", + "ĠJac obs", + "Ġadvoc ated", + "ĠBif id", + "m aterial", + "Ġst yrene", + "ĠK eller", + "rocy tic", + "pine phrine", + "ĠWr itten", + "ĠRecommend ation", + "b led", + "ĠB ootstrap", + "th irds", + "Ġcap tain", + "equ als", + "SR C", + "ĠKent ucky", + "Ġeosinophil s", + "A verage", + "H i", + "W he", + "ĠD AT", + "ĠU M", + "Ġtend encies", + "ĠPet erson", + "Ġocc ult", + "Ġexhib ition", + "ĠIN S", + "Ġadip ocyte", + "J ust", + "h ift", + "t ensors", + "Ġc iliary", + "ip ation", + "Ġmotiv ations", + "Ġwitness ed", + "it ches", + "ĠS oy", + "Ġg ib", + "ep tic", + "ĠK OH", + "Ġïģ ¨", + "ĠTor res", + "Î ¿", + "ar po", + "ok inase", + "ĠBud d", + "ĠG MM", + "Ġunder pin", + "Ġoptim istic", + "oge ography", + "numer ical", + "og g", + "Ġdise quilibrium", + "Ġsw ab", + "ED S", + "ĠPD Fs", + "ĠSuper nova", + "phosph o", + "Ġlys osomes", + "gal actic", + "ĠPerm e", + "Ġfisher y", + "ĠB OLD", + "Ġun ravel", + "ĠEncryp tion", + "J P", + "h ur", + "Ġdisc ount", + "ĠWat anabe", + "ĠRhe umat", + "F ITC", + "Ġt erahertz", + "ĠF ont", + "ian ces", + "ĠAd ditive", + "ĠE ither", + "met adata", + "amp hetamine", + "ĠPal mer", + "Ġlever aging", + "J ohn", + "O CT", + "in fer", + "ĠM SD", + "ĠâĪ ĵ", + "ou ver", + "ĠAnd ersen", + "Ġworld s", + "Ġtor i", + "Ġïģ °", + "engine ering", + "ĠSquad ron", + "A ff", + "å ı", + "ox el", + "yle tic", + "ĠCharacter izing", + "V T", + "r ational", + "ere mia", + "Ġcomplex ation", + "ĠER α", + "carboxyl ic", + "ïĤ ·", + "Ġgalact ose", + "ĠAur ora", + "Ġplasmin ogen", + "ure n", + "ign e", + "Ġrep aired", + "Ġblock ers", + "ĠMN IST", + "Ï ħ", + "ĠA xi", + "Ġst adium", + "di ethyl", + "âĢ İ", + "Ġcycl otron", + "Ġlymph aden", + "Ġv in", + "ĠM ayer", + "Ġendomet rium", + "ĠSp herical", + "Ġpers u", + "Ġimm ortal", + "benz enesulf", + "ĠÅ ľ", + "Ġb ite", + "ugg ed", + "ĠDiff raction", + "GT G", + "i ate", + "Ġt p", + "Ġab er", + "ĠRe in", + "Pro gram", + "St yle", + "ĠRegular ization", + "ĠLeuk emia", + "Ġprokary otic", + "oc omial", + "sk b", + "Ġdevi ates", + "Ġf use", + "ĠN ull", + "Ġïĥ Ĺ", + "ĠOper ational", + "Ġcompress or", + "ĠRyd berg", + "Ġf ought", + "Ġe co", + "ĠS SP", + "CD s", + "ĠME K", + "ĠAnis otropic", + "ĠDi rection", + "ĠSpect rometry", + "Ġglut en", + "ĠPow ell", + "recogn ized", + "Ġpsych otic", + "Ġhind er", + "Ġaccommod ation", + "ĠNorm an", + "Q x", + "Ġper iv", + "ĠUn known", + "Ġjo ins", + "ĠMinim ization", + "ĠS ons", + "ĠC in", + "Ġun avoid", + "ĠPT X", + "Ġc ada", + "ĠL uk", + "Ġr uling", + "Ġbi phasic", + "ĠCom plications", + "ĠDef ects", + "Cont ent", + "ĠGreg ory", + "ĠWer ner", + "ĠWeib ull", + "eld om", + "Ġactiv ators", + "GL API", + "math ring", + "Ġhe ns", + "N SC", + "h owever", + "ĠT ME", + "ma frost", + "co efficient", + "ĠIns ect", + "ĠRO Is", + "ĠBor rel", + "ĠQi u", + "Ġinhal ed", + "id ate", + "Ġanti hypertensive", + "Ġtreat s", + "ĠNear ly", + "suc c", + "ĠOrb ital", + "er adish", + "ad ministered", + "ĠÏ Ĥ", + "ĠCol ony", + "ĠâĮ Ĭ", + "ĠIndones ian", + "ĠB auer", + "ĠK od", + "mann ed", + "Res istant", + "Ġda ughters", + "ĠPredic ted", + "Ġvoc ab", + "Ġcontras ted", + "m argin", + "ĠDi rected", + "ED TA", + "Ġsynchron y", + "ick i", + "ĠSal v", + "t reat", + "in cess", + "var nothing", + "Ġhex ane", + "Em pty", + "Ġgem citabine", + "om ib", + "ore pinephrine", + "pro c", + "ĠMet S", + "ĠDR AM", + "Ġantico agulant", + "n om", + "am ater", + "ĠLi DAR", + "Ġmob il", + "Ġamelior ates", + "n iz", + "Ġj a", + "Ġem uls", + "ĠZ a", + "Ġastr onomical", + "ĠAlf red", + "H ilbert", + "ĠK F", + "CR T", + "quad ratic", + "Ġdifferenti als", + "rob acterium", + "ĠHippocamp al", + "p ull", + "Ä Ļ", + "Ġs ad", + "ally l", + "Ġhot spot", + "ĠElectron ics", + "Ġconstit ution", + "iton in", + "ا ÙĦ", + "P c", + "Ġre vascular", + "Ġus able", + "ĠSc atter", + "Ġgraph ically", + "lim inf", + "Ġrestaur ant", + "ucalypt us", + "AC G", + "Anal y", + "ĠMill ipore", + "Ġmunicip alities", + "ĠMacroph age", + "Ġmacrom olecular", + "L icense", + "g c", + "Ġl avage", + "ĠA ES", + "ĠF CS", + "per itone", + "Ġmeas les", + "TE X", + "ĠVir ulence", + "Ġhemat oma", + "ĠF res", + "ĠN utrient", + "ap ar", + "ĠSp ot", + "co plasma", + "ĠExp ect", + "Ġc iprofloxacin", + "phyl axis", + "ĠAtl anta", + "ro uting", + "ar ate", + "ĠC is", + "ens ure", + "car riers", + "ĠVari ant", + "sur gical", + "ĠEstim ate", + "à ¹", + "ĠL iqu", + "Ġam alg", + "Ġbl a", + "Ġthem atic", + "IR Q", + "ACT ION", + "ĠChris ti", + "æ ľ", + "Ġn py", + "de ath", + "Ġhair pin", + "Ġmultiplic ities", + "Gib co", + "he ated", + "af ety", + "mut able", + "quark s", + "S un", + "q l", + "Ġproduc tions", + "Ġge ology", + "Ġt ides", + "at rix", + "Ġad mixture", + "trans lated", + "ĠAb u", + "nucle us", + "Ġweakness es", + "Ġflav ors", + "ĠLu is", + "ĠPut ative", + "sent ence", + "ĠM ast", + "ĠM PS", + "ĠE SS", + "Ġcomp ose", + "Ġbi refring", + "ĠRam sey", + "ĠCL L", + "Ġlign ocell", + "ĠL amin", + "ĠW elsh", + "v on", + "Ġp ests", + "Ġf iction", + "ĠH RT", + "Ġass ure", + "CT s", + "ĠPA Hs", + "Ġcrypt ography", + "en erated", + "Ġop s", + "ĠSyn erg", + "ig inal", + "ĠC raw", + "Ġk ne", + "Ġcurv atures", + "Ġl ux", + "ĠK enn", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠ", + "print ln", + "Ġverteb rae", + "Ġru tile", + "ĠAeros ol", + "re ferred", + "lactam ase", + "ve hicle", + "ad ir", + "iz ards", + "Ġcall back", + "Cl uster", + "Ġsil t", + "Ġresearc hed", + "ĠGener ator", + "ĠRest oration", + "ĠCh in", + "omet rical", + "ĠCo efficients", + "rach id", + "F ace", + "M en", + "c ounts", + "Ġp eg", + "Ġe cl", + "Ġcom edy", + "ĠL n", + "ob uty", + "ĠSh aring", + "Ġadequ acy", + "urt osis", + "ĠPic ard", + "Ġf estival", + "Ġdis position", + "ĠCom plement", + "ĠEx clusion", + "Ġdext ran", + "m ons", + "ĠInter polation", + "ĠSte ven", + "Ġcelebr ated", + "Ġh Pa", + "of requency", + "Ġexception ally", + "Ġenerge tically", + "psych otic", + "Land au", + "T uple", + "dist ributions", + "ĠRich ards", + "Ġpolyp s", + "ĠAbs ence", + "Ġcele b", + "X G", + "Ġsim ulates", + "mit ters", + "Ġheat map", + "ĠSD N", + "ĠSte ps", + "Ġshall ower", + "ĠTurb ulent", + "Y T", + "Ġn al", + "plic ative", + "pha e", + "ĠLe ica", + "ĠAPP RO", + "Ġarrhyth mia", + "Ġre writing", + "Ġuns afe", + "Ġcowork ers", + "ĠG AD", + "iv ol", + "Ġdisrup ting", + "ĠUltra violet", + "ere e", + "ĠL opez", + "Ġneg ation", + "Ġjaponic a", + "ec essor", + "ĠP atch", + "Ġso ap", + "ĠY ing", + "MS K", + "Ġtrac heal", + "ic os", + "Ġv p", + "FA IL", + "Ġcat abolism", + "sol ver", + "f ont", + "es p", + "ĠZ ou", + "Ġdark er", + "Ġlys ozyme", + "c overed", + "Ġmulti tude", + "requ ently", + "Ġmetam orph", + "Ġchap ters", + "h h", + "ch l", + "red undant", + "ack ing", + "Ġent ail", + "ĠPack et", + "ĠHabit at", + "im edia", + "ĠC of", + "ph rase", + "Ġcl oth", + "ars al", + "Ġdr ums", + "TP UT", + "Ar gs", + "duct ory", + "ĠUl timately", + "ic ates", + "anti gen", + "Th ough", + "ĠFl ore", + "pro bs", + "Ġcirc ulatory", + "ĠCont emporary", + "e plitz", + "Ġh atch", + "ri zed", + "ĠK op", + "mit ting", + "Ġhyper spectral", + "ĠAb st", + "S IM", + "Ġfruit ful", + "Ġrecip e", + "Ġimid azole", + "Ġsyn onymous", + "Ġattrib ution", + "ĠMart ÃŃnez", + "ĠRod rÃŃguez", + "par ticular", + "ĠInter acting", + "Con f", + "O RE", + "ĠT MA", + "uc idation", + "Ġbi ochemistry", + "ĠLe vy", + "Ġconcentr ates", + "Ġinduc tor", + "Ġpy rophosph", + "Ġrespond ent", + "Z hang", + "Ġro pe", + "Ġdesign ation", + "ĠCl im", + "Ġconstrain s", + "s helf", + "Ġd Ïĥ", + "ĠT LC", + "ĠA har", + "ĠM atch", + "ĠM OL", + "Ġfe es", + "we alth", + "Ġhyper activity", + "ĠBr uker", + "ĠFre und", + "dichlor ophenyl", + "re ro", + "ĠF ear", + "dot sc", + "Ġhy g", + "ĠText ure", + "T ak", + "am pled", + "Ġal geb", + "sub t", + "Ġdocument ary", + "ĠJ E", + "CN S", + "Ġdecl ar", + "He ight", + "K i", + "en oid", + "ĠC ervical", + "frac tory", + "Ġplant ed", + "IF I", + "Ġconcept ually", + "Ġfill ers", + "ic ola", + "le an", + "Ġcl ump", + "Ġwr iters", + "Gener ally", + "Ġo st", + "op ening", + "CL ASS", + "Ġherpes virus", + "In stit", + "Ġdr inks", + "ĠInt ensive", + "Ġmusic ian", + "Ġanch ors", + "S eries", + "ĠF AM", + "ĠB ott", + "ĠE CC", + "Ġinvers ions", + "Ġac res", + "Ġsw abs", + "ĠÍ ī", + "ĠBer keley", + "Ġpl um", + "Ġem power", + "Ġphoto emission", + "ĠRab i", + "E ast", + "T aylor", + "OS E", + "Ġden ied", + "ĠHT TP", + "M U", + "he w", + "Ġth ri", + "ĠC ERN", + "Ġsuff ice", + "functional ized", + "Ġcra bs", + "Ġidem potent", + "Ġpost ulate", + "ĠCB F", + "disc rim", + "Char acter", + "ĠRecomb ination", + "C ache", + "om it", + "ĠA da", + "Ġcur sor", + "EM T", + "Ġmes oscale", + "gu ide", + "Hy per", + "Ġh t", + "ren es", + "uss en", + "where as", + "Ġintegr ator", + "Ġsyn cy", + "aro us", + "Ġcounter act", + "hal ose", + "ĠNot ation", + "ĠRele vance", + "v f", + "Ġin bred", + "Ġrec irc", + "Ġend e", + "Ġpres idential", + "Ġlact ose", + "ac ional", + "os pi", + "ĠV GG", + "ose lectivity", + "ĠCon fig", + "Ġfinger prints", + "Inter face", + "pur ple", + "et us", + "ĠN in", + "ĠK ras", + "ĠRe ports", + "ĠSe attle", + "AD C", + "Ġlipoprotein s", + "cyclohex yl", + "op ressin", + "Ġwave front", + "tet razol", + "th ys", + "Ġdiv or", + "amin ophen", + "ĠPer ry", + "ĠConsider ations", + "ĠHal o", + "Ġreflex ive", + "thiazol idin", + "oxycycl ine", + "C W", + "od im", + "ĠCh ong", + "Ġequil ibrated", + "r ime", + "ym ology", + "Ġdev oid", + "rig el", + "amater gic", + "Ġidentif ications", + "Ġcontroll ability", + "ectic ut", + "ĠSynchron ization", + "ul atus", + "Ġcorrel ating", + "Ġmu ons", + "Ġcompartment al", + "Ġinhom ogeneities", + "Ġevac uation", + "resp iratory", + "dim ethoxy", + "Ġinterfer ometric", + "Ġastr onomy", + "Z D", + "Ħ Ħ", + "el ia", + "bl er", + "Ġpione ering", + "Ġp its", + "Ġman soni", + "ĠCON D", + "Ġcodew ord", + "im ura", + "ĠDop amine", + "ĠGi ov", + "ĠCamero on", + "S em", + "d ong", + "ot to", + "em ies", + "Ġinter quartile", + "ll bracket", + "otrop ies", + "Ġhapp ening", + "ĠPal m", + "Ġst uff", + "Ġpar king", + "eg al", + "ĠCO P", + "Ġorgan izing", + "Ġpoly hedral", + "Ġproven ance", + "J s", + "ch ains", + "eg u", + "mer cap", + "level and", + "Ġeryth roid", + "ympt omatic", + "Ġzig zag", + "Ġinf erring", + "Ġappro x", + "Ġdown link", + "ĠDef iciency", + "rbrack et", + "ĠT IM", + "ST S", + "ain en", + "Ġun loading", + "ĠX P", + "ĠWh ilst", + "ĠID H", + "ĠTI MP", + "r rbracket", + "ac ities", + "Ġwh ale", + "ĠW AR", + "Ġinf l", + "ĠPresent ation", + "authorbs nm", + "Ġbacter icidal", + "SP EC", + "Ġdys regulated", + "ĠIC AM", + "n ano", + "Ġw afers", + "ĠM UC", + "Ġal ien", + "ch ke", + "Ġsl abs", + "Ġback ing", + "ns is", + "Ġbal ances", + "eth ane", + "Link ed", + "C hen", + "H ymenoptera", + "it ations", + "ĠO UT", + "trans plant", + "condition ed", + "ĠBenef its", + "T yr", + "at mosp", + "ĠAd hesion", + "Ġthor ac", + "activ ator", + "Ġphosphatidyl inositol", + "Ġreported ly", + "ĠCL ASS", + "Ġrenew ed", + "ĠPharmac ological", + "Ġminim ise", + "gluc osidase", + "aden osyl", + "Ġov ip", + "initial izer", + "Ġfor age", + "rm s", + "ĠIm ag", + "ĠAnne xin", + "ĠVehic les", + "Ġf les", + "st a", + "ĠG BS", + "ĠCh at", + "measure ments", + "ĠAud itory", + "C ut", + "F v", + "Ġm aker", + "ap plication", + "Ġrevers ing", + "Ġsti p", + "Ġfaecal is", + "icy cle", + "Ġtrim med", + "Ġexacerb ation", + "Ġtransc ranial", + "ĠMoment um", + "Ġf c", + "ĠF OV", + "Ġang ina", + "Ġnano structure", + "Ġantagon ism", + "ĠLED s", + "ìĹ IJ", + "Ġf als", + "ap oration", + "ĠIn vasive", + "ĠK m", + "ert ation", + "Ġhar ness", + "Ġfer tile", + "ĠTR UE", + "Ġshel ter", + "ĠWol bachia", + "sho ot", + "Ġs ess", + "ĠH ous", + "ĠA ce", + "ĠC ML", + "Ġpro active", + "Ġsh ots", + "Ġco up", + "rest ling", + "uniform ly", + "y am", + "ol ase", + "ĠI CS", + "ĠE bola", + "roll ing", + "tr unc", + "ĠRepresent atives", + "Ġgras ping", + "ĠAnomal y", + "ĠM ine", + "ĠM PO", + "ler ight", + "Ġinstit ute", + "Ġsug arcane", + "ÑĢ Ð°", + "Ġoccl uded", + "ĠMagell anic", + "B EC", + "W i", + "o A", + "Ġg apped", + "ĠPR C", + "ĠMA E", + "Ġmusic ians", + "ĠSignific antly", + "Ġforth coming", + "Ġaccl imation", + "re quired", + "ver bal", + "ĠF X", + "ĠM LE", + "Ġcomp ass", + "ĠMultim odal", + "G rant", + "Ġt vb", + "In struction", + "Ġsens es", + "urb ed", + "ham n", + "Ġfram ed", + "Ġuro thel", + "or in", + "se al", + "Ġfl asks", + "sh ops", + "Ġwhe els", + "ĠRad on", + "ĠPlan etary", + "Ġhed ge", + "Ġd k", + "Ġevid ently", + "thread s", + "Ġt ad", + "el im", + "im ov", + "ist em", + "and i", + "Ġle isure", + "ost om", + "Ġcar ing", + "ĠSm oking", + "Ġcompetit ors", + "A FS", + "x l", + "ĠS atur", + "ĠF erg", + "Ġch in", + "ĠCD R", + "ĠSO M", + "osacchar ide", + "MOD EL", + "E CC", + "Ġd as", + "agon ist", + "st ery", + "Ġrel ays", + "ze k", + "Ġneoplas m", + "C hip", + "Ġg ill", + "lam ed", + "cer ning", + "Ġincons istencies", + "ace ans", + "ĠAd ri", + "ĠAf ghan", + "Ġnic hes", + "Ġtunn elling", + "g us", + "ĠI an", + "Ġbur ial", + "Trans form", + "ocomp atible", + "Ġs eldom", + "Ġdis closed", + "âĪ ķ", + "Ġref ining", + "Ġty ph", + "Ġcooper ate", + "Ġasphal t", + "ĠCons titution", + "fl avor", + "Ġwar p", + "Å ¼", + "Ġc raw", + "ĠInd igenous", + "ĠPre vent", + "Ġtrig eminal", + "ĠFried rich", + "ĠInterfer on", + "i osity", + "w arm", + "us on", + "Ġunder lies", + "Ġmultiple ts", + "ĠSU PER", + "ĠManufact uring", + "Ġv imentin", + "ram ine", + "Ġeffic acious", + "ic ed", + "ĠV all", + "oth orax", + "Ġaud i", + "Q s", + "ĠP AL", + "ĠH old", + "hat tan", + "idd ing", + "w ana", + "Ġp ending", + "Ġp erennial", + "Ġtouch ing", + "xp ected", + "D istance", + "n av", + "Ġis omeric", + "ĠM CI", + "num bers", + "Ġrevers es", + "Ġpolyc ystic", + "H em", + "u ities", + "op tional", + "Ġsub cortical", + "ĠSup ply", + "ĠCal der", + "Ġmang rove", + "Ġp ads", + "ur faces", + "ĠF aster", + "Ġunder neath", + "Ġprol actin", + "Ġcle arer", + "Ġscin tillation", + "Ġhumid ified", + "ĠW ound", + "ĠH PA", + "Ġcoll apsing", + "Ġbary onic", + "ĠMEA SU", + "ĠG ü", + "Ġdet r", + "Ġsubstit uent", + "ĠRoman ia", + "ĠInv olved", + "Ġduoden al", + "ĠAm p", + "ĠS IS", + "sc her", + "aut h", + "ĠResp ond", + "ĠRank ing", + "t rip", + "x F", + "ist in", + "Ġpa uc", + "ref lection", + "Ġcorne a", + "Ġbol us", + "Ġpiv ot", + "Oc tober", + "ĠS ERS", + "ĠX ing", + "AN ET", + "Ch inese", + "ĠMus c", + "D ynamic", + "M esh", + "Ġdi phosphate", + "Ġcons pecific", + "lect or", + "ĠEc u", + "ĠCover age", + "ĠãĢ Ī", + "C OD", + "am ong", + "Ġpos it", + "imum ab", + "Ġp N", + "Ġco aching", + "ex ports", + "Ġreal m", + "ĠFer reira", + "Ġnation ally", + "Ġtur tle", + "ubted ly", + "ĠD raft", + "Ġend l", + "ĠContinu um", + "embed dings", + "Ġá¹ ½", + "ĠCr ime", + "Ġimm igration", + "ĠFil ip", + "Ġgar net", + "Ġobsc ure", + "ĠT YPE", + "Ġult rastructural", + "ca emia", + "ĠSem an", + "r ink", + "ti ff", + "uc cal", + "ke e", + "itud inally", + "ĠAll oy", + "ĠAnaly zer", + "contin ue", + "ĠAlab ama", + "Q OL", + "Ġpol lin", + "Ġcorrespond ences", + "ĠRes ol", + "F IR", + "ul are", + "ta wa", + "UR CE", + "Ġurban ization", + "z d", + "Ġgl oss", + "ER A", + "ĠDeterm ine", + "D ate", + "ĠP SP", + "ĠSh ig", + "rep ta", + "ĠGa it", + "neut rino", + "Ġper vasive", + "ĠâĢ¢ âĢ¢âĢ¢", + "Ġhom ozyg", + "Ġadap tively", + "graph ic", + "ĠJohn ston", + "z t", + "ex plicit", + "Ġhel min", + "Ġp es", + "AR F", + "ĠF ram", + "ĠAm sterdam", + "Ġlogarithm s", + "ĠCre ative", + "Page Index", + "Ġp acing", + "ĠP CS", + "Ġfore brain", + "ĠCT CF", + "dec omposition", + "Ġbear ings", + "Ġanhydro us", + "Ġc b", + "ĠM ON", + "ĠN odes", + "str um", + "ĠJ ans", + "Ġdeline ate", + "Ġdichro ism", + "con formal", + "Ġret reat", + "gl ial", + "Ġnucle ase", + "ĠBal timore", + "Ġpay ing", + "Ġbore al", + "tip ation", + "R oot", + "S QL", + "s ources", + "end o", + "ĠOr ion", + "Pl us", + "ĠD EL", + "ĠTh an", + "Ġmon oph", + "Ġreflect or", + "Z e", + "ĠL inking", + "syn c", + "ĠCRE B", + "n ational", + "ur ized", + "ĠP eptides", + "ĠB egin", + "bor g", + "piper idyl", + "Ġoverestim ation", + "R GB", + "T K", + "Ġbe ings", + "Ġat tains", + "Ġres ervation", + "ĠMo tivation", + "Ġtrim ethyl", + "ĠTerm inal", + "Ġinten tional", + "Neg ative", + "ĠCron bach", + "dorfer i", + "D aw", + "V AR", + "d P", + "im ath", + "ove rex", + "Ġfibro tic", + "Ġsmart phones", + "Ġont ologies", + "G ood", + "u tively", + "ĠV B", + "SP E", + "ĠMcD onald", + "galax ies", + "Ġbioch ar", + "ĠE MS", + "ĠN f", + "ors hip", + "Ġback scattering", + "ĠÐ ¿", + "Ġanthocyan in", + "ĠPho enix", + "con tained", + "ĠPS II", + "hl ung", + "ĠLA I", + "Ġlect ures", + "Ġdisp atch", + "V F", + "ĠM EC", + "ĠW es", + "Ġback scatter", + "oti te", + "ĠSR C", + "Ġcurren cy", + "onym s", + "as partate", + "Ġcos et", + "ĠC PP", + "orb ing", + "ĠEmbed dings", + "ĠSurve ys", + "Ġneurodevelop mental", + "ĠS RE", + "ĠInter ior", + "ĠAR DS", + "experim ents", + "brom ophenyl", + "ĠE CL", + "ĠO PE", + "medi ation", + "Ġtherm oc", + "Ġinterpret able", + "ĠMicrobi ome", + "e astern", + " ¿", + "ĠT DP", + "ath on", + "ĠBy zantine", + "any on", + "Ġepit axy", + "Ġcritic ized", + "Mill ipore", + "ĠD EP", + "ĠFre edom", + "j unctions", + "ĠA SM", + "ĠG ren", + "Ġsign ing", + "Ġconstit uting", + "opro terozoic", + "ĠSyn ech", + "ĠVo ice", + "Ġcholec yst", + "b ilities", + "on line", + "ĠE dd", + "ĠK up", + "ĠLet t", + "ĠMar in", + "ĠGo al", + "ĠSY M", + "intro duced", + "naphth yl", + "ĠL ü", + "Ġm x", + "Ġb lu", + "Ġr m", + "ĠDe letion", + "ĠConn ecticut", + "Cole optera", + "t ry", + "Ġso ot", + "ĠCount ries", + "Ġsick le", + "M eta", + "ĠS ib", + "ĠH NO", + "ĠU D", + "Ġexp r", + "Ġallow able", + "ĠInd irect", + "tis ation", + "Ġaden omas", + "electron ics", + "R NN", + "ĠT CF", + "Ġgluc agon", + "ĠC itation", + "Ġg amb", + "and ez", + "Ġtrans mits", + "aj ima", + "Ġhol onomy", + "ì ł", + "act am", + "ĠTh reat", + "ĠPear l", + "Ġerup tions", + "ĠImmunohist ochemistry", + "Y es", + "p atrick", + "Ġa ma", + "Ġd rew", + "ĠT asks", + "ĠP IM", + "Ġdis pat", + "ĠDet roit", + "Ġcoex ist", + "arboxyl ase", + "I BM", + "ĠT UNEL", + "ĠU F", + "ĠAN G", + "Ġsar copenia", + "Ġh aptic", + "Ġcarbon ates", + "Ġmit ophagy", + "Ġciti zen", + "ĠCONTR OL", + "f if", + "Ġw i", + "ĠG LO", + "ens ored", + "ĠPar a", + "ĠAb del", + "oi etin", + "Ġto e", + "ĠS QU", + "ĠR ag", + "Ġx ylem", + "Ġlib eral", + "ĠMarg aret", + "W a", + "k p", + "ĠP EM", + "ĠD DR", + "Ġgen otypic", + "ĠY M", + "ING S", + "ker as", + "ĠEduc ational", + "ĠCult ures", + "in str", + "ĠF uchs", + "ag asc", + "fact ant", + "Ġt enth", + "AB L", + "Ġperme able", + "ĠCam eron", + "Br N", + "ĠMull er", + "ĠRevers ible", + "w ild", + "Ġf usions", + "os ulf", + "ĠE oS", + "ĠK ö", + "det ected", + "ĠColl agen", + "Ġdescend ants", + "e lection", + "ar ange", + "Ġb ounce", + "Ġcont ag", + "In valid", + "ĠCo ating", + "t asks", + "ar ma", + "ĠK C", + "Ġdi ar", + "ĠSup press", + "Ġfraction ated", + "Ġsn ail", + "Ġmicro phone", + "ĠSc ienti", + "Ġchem iluminescence", + "soft ware", + "Ġburg dorferi", + "Ġb oot", + "ĠC SCs", + "ĠM SI", + "ts ev", + "Ġhe ater", + "frac tal", + "Ġend osomes", + "Un iform", + "Ġath lete", + "ĠDri ven", + "Ġviv ax", + "K ind", + "satisf ies", + "Ġcorticoster oid", + "ĠEstabl ishment", + "cal ibration", + "Ġdim eric", + "Ġcere al", + "ĠSuper vised", + "ĠSP M", + "MB ER", + "Ġhemisp heres", + "Ġpercenti les", + "L eu", + "M ajor", + "Ġex agger", + "Ġds RNA", + "Dec ember", + "ĠZr O", + "Ġas ymmetrical", + "ĠV AS", + "ĠJ M", + "Ġintegr ations", + "Ġhand over", + "C ycl", + "im plant", + "Ġqu ote", + "Ġcycl one", + "ĠSte phan", + "ĠFran co", + "Ġaw ake", + "Ġfeed er", + "CH AR", + "Con dition", + "ĠChar l", + "ĠBrig ade", + "Ġremedi ation", + "c ig", + "ĠBoh r", + "ĠVac uum", + "ĠTox oplasma", + "Ġgh relin", + "ĠT RAF", + "ay e", + "Cl ient", + "ili ation", + "xy z", + "ming ham", + "ĠSU B", + "ïĢ ł", + "Ġconvers ions", + "Ġmulti path", + "miss ive", + "Ġeq n", + "bul k", + "my c", + "Ġexacerb ated", + "Ø ª", + "Ġprotein ase", + "Ġbu ilder", + "ah ara", + "Ġinver t", + "ĠRecep tion", + "ax anthin", + "Ġprim ed", + "Ġcop ula", + "Ġproceed ings", + "Ġnond egenerate", + "Ġint ox", + "Ġneed les", + "length s", + "Ġtranspos on", + "h on", + "ĠT PC", + "pl and", + "ox yn", + "IC H", + "Ġintra uterine", + "Ġlamin ated", + "ĠOBS ERV", + "M atch", + "ĠIn sur", + "ĠAm yloid", + "Ġwar ped", + "emat ical", + "ĠPrac tices", + "ãģ ®", + "ĠBrass ica", + "Ġhyperther mia", + "Ġd n", + "ĠL IF", + "ĠMet ropolitan", + "ĠBr dU", + "imp act", + "f iltered", + "ĠRe agent", + "v p", + "ĠT ip", + "ĠPro portional", + "Ġblood stream", + "Sim ple", + "Ġty ros", + "ĠHen ri", + "Ġretro trans", + "aci ens", + "Ġmist akes", + "acyl glycerol", + "ĠMir ror", + "V ERSION", + "v re", + "Ġb act", + "ock ed", + "eps is", + "Ġson ication", + "ĠPur kinje", + "Ġmism atches", + "ĠA OD", + "Ġhyper graph", + "ĠMi ami", + "am med", + "Ġcon versely", + "ĠG abor", + "ĠG DM", + "Ġco iled", + "onic a", + "Ġevol utions", + "ĠR BM", + "ĠRe ef", + "ĠAb ram", + "ĠPrec ise", + "incre ase", + "ĠPlate let", + "Gener ator", + "Ar ch", + "ĠBen ed", + "pre ceq", + "meas urable", + "C AS", + "ĠT ourn", + "Ġg iants", + "Ġed dies", + "Ġcolumn ar", + "agg regation", + "Ġzircon ia", + "duc ibility", + "Ġserv o", + "Ġbe auty", + "Ġhe ap", + "ĠâĪĴ âĪĴâĪĴ", + "Ġconduc tivities", + "Ġdark ness", + "Ġoccup ying", + "ĠCle an", + "b ash", + "ul ans", + "app y", + "ĠMark er", + "run time", + "Ġhaem oglobin", + "Ġdesk top", + "m is", + "ĠS of", + "os se", + "Ġcom oving", + "Ġcl utter", + "our ced", + "Ġsub j", + "arch ing", + "ĠSol omon", + "lock ing", + "Ġpar ap", + "Ġrot ator", + "ĠACKNOWLEDGM ENTS", + "T er", + "y ster", + "ĠWe bb", + "Ġsubs ample", + "osil icate", + "T raining", + "or pha", + "Ġtime out", + "otin amide", + "ĠFab ry", + "ĠRece iver", + "Ġconjunc tiv", + "ĠEcu ador", + "ĠI da", + "Ġcase in", + "Ġïģ ¸", + "ĠBar n", + "ĠSchool s", + "el ona", + "di p", + "ĠCh rys", + "IC I", + "Ġposterior i", + "Ġble aching", + "ĠPerson ality", + "um bers", + "ĠM odes", + "Ġno tification", + "Ġsup ine", + "alu ed", + "ke ep", + "ĠFran z", + "Ġwound ed", + "Y L", + "Ġdi lemma", + "ĠCl ara", + "ĠCar roll", + "Ġsick ness", + "Ġprox ies", + "ec ks", + "ĠÏ «", + "Ġplant ing", + "Ġcipher text", + "ĠF amilies", + "ies el", + "Ġinc ongru", + "ĠExc itation", + "Ġconfer red", + "ĠBut ter", + "Im pl", + "coll ision", + "id ol", + "Ġac quires", + "ĠO wen", + "SA M", + "ĠG UT", + "lec ts", + "Ġdele g", + "Sh ot", + "Ġanth rac", + "Russ ian", + "ĠP CE", + "Ġâ ĥĹ", + "ĠK ab", + "NA C", + "Ġarg parse", + "ĠVi ol", + "Ġantico agulation", + "Ġcredi bility", + "Ġrota virus", + "ĠIn vest", + "Ġrec ol", + "vari ety", + "Ġdeform able", + "Ġenerge tics", + "Ġconsult ations", + "le tics", + "ĠF oss", + "ĠL IGO", + "ph p", + "ĠCh al", + "ĠMal awi", + "Ġstro kes", + "h orm", + "Ġb s", + "Ġpl ural", + "str ategy", + "Ġmis alignment", + "pre vious", + "fil ters", + "ĠDem ographics", + "determ inistic", + "Ġcycl ophosphamide", + "Ġstre ak", + "ĠBios ynthesis", + "Ġsubcutaneous ly", + "j n", + "Ġam picillin", + "ĠCh ag", + "iform es", + "IF ICATION", + "Ġyour self", + "Ġtoler ability", + "Ġaut ocl", + "rh s", + "Ġpup ils", + "Ġgaug ed", + "L ay", + "ĠS anti", + "ĠD BP", + "ĠG ary", + "dri ve", + "Ġtrust worth", + "Ġconting ency", + "C ube", + "H ost", + "f u", + "Ġh sa", + "iss ner", + "IT T", + "ĠSr TiO", + "Ġcouns elling", + "inte grable", + "Ġunder way", + "Ġstandard ised", + "bi us", + "First ly", + "Ġporph yrin", + "A rea", + "i w", + "Ġ ub", + "ĠL ynch", + "ĠW BC", + "ild en", + "Ġhom eless", + "Ġmagnet osphere", + "Ġnight time", + "nc bi", + "Ġdow nt", + "le thal", + "Ġinter im", + "ĠRes il", + "Ġcontinu ally", + "ĠImmun ofluorescence", + "Des ign", + "Ġadvoc ate", + "repta vidin", + "f w", + "st ory", + "ĠP SS", + "Ġfil ed", + "Ġbed rock", + "Ġisofl urane", + "Ġrel uct", + "ew ard", + "ĠInd ependence", + "ĠBurk holder", + "Ġc inn", + "Ġcap tive", + "Ġcompos ing", + "Ġrest raint", + "Ġquestion able", + "ĠTom ato", + "Ġzer oth", + "r ins", + "ome z", + "Ġgl ia", + "ĠGl ac", + "Ind ependent", + "Ġobj ectively", + "p A", + "Ġfav oring", + "ipel ago", + "Ġincont inence", + "b ium", + "ĠL Z", + "ĠL ed", + "hex yl", + "Ġce ased", + "Ġole ic", + "ĠImpair ment", + "Ñ ĸ", + "ong o", + "Ġrun ner", + "Ġcuc umber", + "ĠPer form", + "Ġdouble ts", + "Ġeigen function", + "ĠÌ º", + "ĠHend erson", + "K lein", + "T ab", + "Ġbe er", + "oc om", + "unc iation", + "---- --", + "ĠT SC", + "og as", + "Ġr ud", + "Ġinc is", + "ĠLO G", + "FB Q", + "Ġinterconn ection", + "à ®", + "ar box", + "ĠI BS", + "ĠN CT", + "ĠG and", + "Ġy aw", + "ĠTrans verse", + "ĠSud an", + "Ġconstric tion", + "H or", + "Ġev asion", + "Ġmer omorphic", + "ĠPB MC", + "I UM", + "re ed", + "ĠB ö", + "ĠE MB", + "uk h", + "Ġwin ners", + "Ġasc ites", + "M es", + "Ġe clipse", + "ĠE ocene", + "ad iazol", + "Ġrecover ies", + "Star ting", + "re ma", + "Ġà İ", + "mon otonic", + "ĠMe OH", + "ĠFl ood", + "Ġwat ching", + "G TP", + "i el", + "m üller", + "å ħ", + "Ġpolyphen ol", + "ĠL MI", + "red it", + "ther m", + "Ġneur ite", + "Qu antum", + "rach lor", + "ĠRub in", + "Ġbf nm", + "A re", + "ar achn", + "Ġd uck", + "ĠTra jectory", + "ĠNit ric", + "l v", + "u id", + "im ag", + "ĠM ULT", + "Ġgen re", + "ari e", + "Ġtr ifluor", + "ĠCor pus", + "oli osis", + "ĠCC K", + "K it", + "f ather", + "Ġt ennis", + "its ch", + "HC V", + "l antic", + "ĠA Q", + "iz u", + "ast atin", + "oth io", + "ĠAn atomy", + "Ġá ŀ", + "glob ulin", + "Ġinterp ol", + "Ġtunn els", + "Ġn atri", + "im ed", + "ĠD ew", + "Ġsub scripts", + "tit es", + "Ġhistological ly", + "O pt", + "x n", + "Ġres ampling", + "ane y", + "Ġtr ast", + "Ġsin ensis", + "Ġsenes cent", + "F ast", + "Ġh ampered", + "Ġblock er", + "ush ima", + "Ġhospital izations", + "L im", + "o ons", + "à ¿", + "ĠA PS", + "ĠY ok", + "ĠZ am", + "Ġexperim enter", + "ĠDis ks", + "Ġà ¬", + "ĠS cop", + "ĠA ph", + "ĠP arents", + "ĠPl ots", + "ĠCON T", + "ĠÐ Ī", + "Ġhomolog ue", + "ĠCool ing", + "re th", + "Ġo vari", + "ĠT amil", + "v rule", + "ĠP CP", + "ari ous", + "Ac tive", + "oprot ection", + "ĠAlf v", + "Ġinf ra", + "ĠCo herence", + "clos ures", + "hydrox ymethyl", + "E H", + "Ġm aser", + "ĠN IST", + "lec k", + "con cat", + "Ġtra ine", + "Ġmix es", + "Ġrib osomes", + "l ia", + "p uls", + "Ġas cer", + "ĠB anks", + "ell in", + "ap plied", + "Ġcl ips", + "Ġmet ap", + "Ġcop ro", + "Ġepid id", + "ĠEpidem iological", + "ĠNich olas", + "ĠK ings", + "Ġlar va", + "Bs Ag", + "ĠS ánchez", + "ĠâĪ İ", + "AM D", + "ĠHa o", + "ĠBill board", + "ĠAbor iginal", + "Ġn ylon", + "ĠN AN", + "c ores", + "ĠC rop", + "Ġcom mittees", + "Ġdi hedral", + "ĠJ uli", + "ĠAnd y", + "hyd ration", + "correspond s", + "M ut", + "Ġt orn", + "ĠF EV", + "Ġx s", + "amp hen", + "Ġsummar ization", + "ĠEr g", + "Ë Ĩ", + "ĠJ unction", + "anc ouver", + "ĠEx amining", + "ĠMarc o", + "Po inter", + "Ġscarc ity", + "unc ing", + "Ġbi jective", + "ĠMain e", + "ĠRH IC", + "Ġtow ers", + "Ġgent amicin", + "Ġt onic", + "Ġk T", + "Ġclim bing", + "Ġrecru its", + "ĠHot el", + "ĠJew s", + "ĠRUN X", + "Ġausten ite", + "ĠOffic er", + "in ent", + "uc c", + "ĠB idirectional", + "Ġmay or", + "ĠAss ays", + "ĠER G", + "SN Ps", + "d ine", + "Ch ina", + "star ting", + "Ġirr ational", + "ĠDIF FE", + "Ġmillisecond s", + "L ik", + "in one", + "Ġâ ģĦ", + "Ġcons picuous", + "Ġsur plus", + "ĠX iong", + "Ġup grade", + "Ġtim ep", + "ĠÄ Į", + "Te V", + "orbid ities", + "in valid", + "Ġv ide", + "ter ra", + "Ġan tin", + "em ens", + "oc ese", + "ĠK I", + "Ġevolution arily", + "K er", + "ĠL ES", + "cl amp", + "Ġslow ed", + "gly coprotein", + "enti eth", + "Ġab road", + "Ġinterp olating", + "Ġcataly ze", + "ĠBelg ian", + "Ġphotograp hed", + "Ġp ector", + "ĠS IV", + "ĠE LECT", + "Ġdes al", + "one ph", + "ĠCl os", + "Ġafford able", + "b irds", + "g om", + "Ġr r", + "Ġun i", + "ĠGen us", + "ĠReg ge", + "ĠMulti dimensional", + "Ġpsych opathology", + "Ġcer tification", + "P attern", + "ĠT ower", + "Ġst ern", + "Ġsub lattice", + "Ġgr at", + "Ġly rics", + "f mt", + "o ceptive", + "Ġd P", + "ĠHol mes", + "Ġbudget s", + "Ġeut ectic", + "ĠP v", + "ĠG ott", + "Ġdis infection", + "Ġret inoic", + "ĠOb st", + "Ġrepl en", + "Ġâĸ ł", + "K utta", + "P lease", + "ĠC AG", + "ĠSti r", + "spe aking", + "Ġinsectic ides", + "ĠFung i", + "H od", + "R ON", + "co il", + "ĠVis ible", + "Ġin ception", + "Ġe GFR", + "Ġre ionization", + "Ġdom ination", + "ĠMet ro", + "Ġsw ept", + "MD S", + "Ġsubs idence", + "ĠFall s", + "ĠD rum", + "ĠCons erved", + "ĠMy ers", + "Ġadapt ability", + "Ġly ophil", + "ul ina", + "are lli", + "ocy cles", + "ĠSO A", + "Ġds DNA", + "ĠCE O", + "Ġanch oring", + "Ġde activation", + "yl er", + "Ġinteresting ly", + "Ġ iliac", + "ĠB org", + "ĠPT C", + "ocyan in", + "Ġun used", + "ĠCar rier", + "Wh ich", + "Ġinterven ing", + "Ġprivi le", + "h it", + "Ġche aper", + "ĠCycl in", + "p lying", + "ĠC leveland", + "ĠH ahn", + "Ġag glut", + "ĠAn ch", + "ĠRed ox", + "W ill", + "ĠL inn", + "ron es", + "ĠNew castle", + "ĠExp ected", + "ĠOpportun ities", + "ĠL arger", + "Ġle ach", + "Ġpep per", + "S ha", + "s ector", + "y ou", + "Ġre plications", + "ch olesterolem", + "ĠIn vasion", + "Ġb ony", + "ĠH uber", + "the nd", + "Ġreal ised", + "Ġinvest ments", + "C ataly", + "ĠW itt", + "ĠK ai", + "Ġet ched", + "ĠST EM", + "Ġexcl udes", + "Ex ec", + "ĠStrong ly", + "ĠSym posium", + "ĠTub erculosis", + "il ance", + "ĠR IS", + "ap ia", + "ens ated", + "ne b", + "ĠCh ains", + "Ġent hus", + "quad rup", + "dec l", + "Ġbin ned", + "Ġsynerg istically", + "Ġgaug es", + "whe ther", + "dise ase", + "W estern", + "Ġhyp othermia", + "ĠGard ner", + "Ġaber ration", + "R od", + "Í ĺ", + "Ġf d", + "Ġst ood", + "Ġcondition ally", + "Ġthrom bol", + "P SC", + "Ġm k", + "ĠT ER", + "od ds", + "ĠK ri", + "ĠIV F", + "Ġm ites", + "ĠC HE", + "Ġq q", + "ĠInf ants", + "ĠChar lot", + "bec co", + "et om", + "ĠCD S", + "Ġarchae al", + "ĠHN SCC", + "Ġmonod romy", + "amphen icol", + "a pers", + "re activity", + "Ġund erm", + "In ternal", + "ĠLands at", + "G erman", + "Ġcer vix", + "id azole", + "ĠS ketch", + "ĠL AM", + "ĠN erve", + "ĠTe h", + "Ġmuss el", + "Ð ·", + "ĠMicro array", + "we i", + "Ġwhe y", + "Ġmix er", + "Ġrecon figurable", + "Ġvascul itis", + "Ġkw args", + "Ġre us", + "cor relations", + "Ġwood y", + "carbon ate", + "ectom ized", + "Ġret rans", + "Ġcyt ometric", + "ĠWild life", + "ĠAnsw ering", + "Ġp encil", + "ĠD AS", + "ak rish", + "CE PT", + "ĠÄ Ŀ", + "ĠPers ian", + "conver ting", + "Ġc ater", + "Ġmean while", + "TP A", + "Ġr um", + "ĠG ros", + "up e", + "Ġreg urg", + "Ġpenal ties", + "Pos itive", + "************************************************************************ ****", + "X F", + "e enth", + "ĠC ory", + "od ulation", + "Ġqu orum", + "c odes", + "ar am", + "ĠT SA", + "ĠP n", + "âĪ ij", + "pr ison", + "Ġconfidential ity", + "E PS", + "X iv", + "i ensis", + "est ones", + "ĠZ ag", + "Ġpred ecessor", + "Ġpri ze", + "Ġâİ ¨", + "ster oidal", + "op ard", + "Ġimp ractical", + "Ġdemonstr ations", + "Ġpredis position", + "Ġk k", + "Ġmod ifiers", + "Ġprec a", + "Ġexec utes", + "Ġbin ning", + "Ġped ig", + "ĠKL F", + "ĠS keletal", + "ĠC IN", + "ature d", + "Ġdecom poses", + "Ġaph id", + "B ern", + "P ur", + "ĠE PO", + "mer ge", + "ĠCO SM", + "am yloid", + "mon ia", + "ĠSc ores", + "ĠReg istration", + "ĠAg robacterium", + "Ġenter prises", + "loc ality", + "ĠIT O", + "Ġt ess", + "Ġf cc", + "ĠN c", + "Ġco axial", + "ĠAd vant", + "AP C", + "ĠDem and", + "adj ust", + "Po ints", + "Ġhetero structure", + "iffiffiffiffiffiffiffiff iffiffiffiffiffiffiffiff", + "D Q", + "Ġt ensions", + "ab und", + "ĠH utch", + "bre w", + "Ġvit reous", + "ĠEZ H", + "Ġm erc", + "Ġdeb ated", + "Ġpal ate", + "ocol ate", + "Ġevap otranspiration", + "ĠẠ¼", + "ĠHoff man", + "ĠGALAX IES", + "C AL", + "c aps", + "le gal", + "di ed", + "ĠIs olates", + "Ġagg rav", + "q s", + "ĠI CT", + "Ġse als", + "Ġspin el", + "ĠGe or", + "Bl ue", + "Ġure ter", + "spl ine", + "ĠIntro ducing", + "thend ieck", + "op per", + "Ġafter glow", + "Ġend osomal", + "Ġreal izes", + "sol ving", + "Ġmist ake", + "ĠAthe ros", + "ĠS BS", + "ĠR ut", + "ex ist", + "Pro f", + "ĠNe isser", + "MS G", + "ĠEar lier", + "Ġd T", + "ĠSp read", + "ĠRef lection", + "second ary", + "approxim ate", + "Ġnig ra", + "S olution", + "an one", + "ĠIt ems", + "Ġwave lets", + "ĠSol uble", + "Ġcircular ly", + "ĠCU DA", + "Ġreg enerated", + "SP I", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠ", + "at uring", + "RE Q", + "Ġinter oper", + "ree v", + "ON T", + "isc hen", + "ĠCho osing", + "phosphor ylated", + "á Ī", + "Ġd ress", + "ĠCon form", + "Ġrem emb", + "Ġischa emic", + "B asic", + "ĠP ang", + "Ġcr it", + "ĠOr n", + "Ġg m", + "ĠF og", + "ĠB d", + "rac heal", + "Ġphen ols", + "ĠDist ingu", + "Ġâİ ©", + "ĠGR Bs", + "ĠCe O", + "ĠBiom ass", + "Ġapt amer", + "v isc", + "he tically", + "Ġs id", + "ome g", + "Ġproportion ality", + "ÃŃ s", + "toplas mic", + "ĠConn ected", + "Ġlamin in", + "stra hlung", + "ĠL ad", + "TR AN", + "ä r", + "Ġbasal t", + "ĠCur vature", + "Ġmitig ating", + "opa edic", + "ĠMuh ammad", + "C AR", + "G i", + "Ġet ch", + "ha ir", + "Ġpur ine", + "Ġbenchmark ing", + "re ich", + "Ġmet hicillin", + "âĪ ¥", + "Ġman ages", + "sol vent", + "ĠSha o", + "h c", + "Ġstr uck", + "Ġnucle osome", + "ĠPubl ication", + "M etric", + "Ġw ines", + "ĠM BL", + "ĠH ub", + "ĠAss istant", + "Ġreli ance", + "Ġrout ers", + "ĠHer z", + "ĠTob acco", + "ro gram", + "ĠH SD", + "ĠL BP", + "Ġinf lection", + "sch ool", + "Ġspons ored", + "ĠCen ozoic", + "Ġentertain ment", + "ati an", + "archit ecture", + "brow se", + "RE C", + "ist ure", + "ĠCh olesterol", + "ĠSim plified", + "Ġpolyp eptides", + "Ġpunct ures", + "arachn oid", + "S elf", + "Ġan orexia", + "ĠO le", + "ĉĉ ĠĠĠĠ", + "GB T", + "Ġcardiomy ocyte", + "ĠFlo quet", + "anal og", + "Ġsensiti zed", + "ĠCep he", + "c atch", + "ch ial", + "Ġcere mony", + "Ġter at", + "Ġamelior ate", + "olys in", + "et ooth", + "ak in", + "ha em", + "Ġent ropies", + "Ġarg u", + "Ġcop ied", + "ling ton", + "ĠHer pes", + "ĠSchw ann", + "y k", + "ĠC EA", + "ĠI CH", + "Ġwr ink", + "Ġrun ners", + "Ġgal van", + "Ġconsol idated", + "ĠâĢ ¡", + "ĠClass ic", + "Ġepidem iologic", + "ĠDri ving", + "Ġtrast uzumab", + "C YP", + "N CT", + "t ability", + "Ġs lee", + "ĠN eck", + "Ġassess es", + "Ġsymmet rically", + "ĠPot ts", + "ĠRib osomal", + "d iction", + "g all", + "ĠAcc eleration", + "CL A", + "ACT ER", + "x ed", + "Ġg eriatric", + "th reonine", + "Ġab ort", + "Ġar tem", + "ĠDis ney", + "ĠCorrespond ence", + "Ġre nt", + "ĠN UM", + "ĠCh un", + "ĠRec ogn", + "Ġcrystall ized", + "Ġcontrad icting", + "vis ors", + "mal ignant", + "rophys iology", + "Inf rared", + "g z", + "Ġsub lim", + "omat osis", + "osyl transferase", + "Ġholog raphy", + "oren stein", + "¾ ±", + "ĠSe bas", + "acc um", + "Up per", + "ant enna", + "Ġbl ur", + "Ġsm ell", + "Ġthree fold", + "ĠPl ayers", + "Ġallevi ated", + "B in", + "Ġn inet", + "ĠD na", + "Ġgeneral izing", + "Ġbreak age", + "ĠMor rison", + "mac ro", + "Read er", + "ograv imetric", + "Ġd h", + "le w", + "xt on", + "Ġdec eleration", + "ĠCor related", + "ĠLeg ion", + "Ġgam bling", + "B inding", + "ĠIn As", + "low ering", + "Ġeuthan ized", + "ĠDall as", + "ĠD w", + "ĠDi jk", + "ĠPol ic", + "ĠT IME", + "ĠH EL", + "ĠL anguages", + "Ġpar abol", + "por ating", + "Ġfr ustration", + "μ M", + "ball s", + "ĠArm strong", + "Ġcontrac tility", + "Ġmetalloprotein ases", + "am eric", + "ĠZ ak", + "ĠCost s", + "A lex", + "d og", + "p w", + "ĠT ight", + "ĠAn terior", + "Ġpe aking", + "Ġneg ativity", + "Ġhyd ride", + "ĠL iv", + "Ġster ilized", + "Ġverb atim", + "Altern atively", + "RE QU", + "ĠTy phimurium", + "ĠWein berg", + "D SC", + "r q", + "Ġcor rug", + "Ġmic rons", + "co ord", + "i oid", + "s at", + "Ġfl occ", + "ĠAcc elerated", + "Ġsix teen", + "abs ence", + "ĠSpe aker", + "om ological", + "ĠA pr", + "Ġmat roid", + "tig ht", + "ogene tically", + "rum p", + "ĠInhib its", + "ĠOlymp us", + "Ġposs ession", + "Ġsuper visor", + "Ġconc ise", + "optim ized", + "v ivo", + "Ġstep ped", + "ocy anine", + "F ive", + "an as", + "ar ten", + "ĠC aco", + "Ġsol utes", + "IT AL", + "ĠRed dy", + "Ġwar ping", + "Ġolig omer", + "Ġc apped", + "Ġv oted", + "ĠR ico", + "ĠT rem", + "Ġl ime", + "ĠI SP", + "ĠL ayers", + "sk in", + "rang ed", + "á z", + "Ġbio activity", + "Ġd urable", + "Ġh n", + "ĠC AB", + "Ġv a", + "ĠU WB", + "ĠSt uart", + "Ġlength y", + "Ġinvas iveness", + "Ġâĩ Ķ", + "jo ining", + "ĠRB Cs", + "Ġresil ient", + "ĠManip ulation", + "G erm", + "cont ribution", + "Ġqual ify", + "ĠD ashed", + "Ġacceler ations", + "ĠCyt ochrome", + "Ġcircumst ellar", + "c avity", + "Ġan atase", + "ĠDe vi", + "Ġpur su", + "ĠMicro RNAs", + "Ġnorth ward", + "Ġsun flower", + "ĠEnter tainment", + "Pac ific", + "ĠHolog raphic", + "u j", + "ere ll", + "met hanol", + "Sur face", + "opos itive", + "Ġthreat ening", + "Ġtransc end", + "D epend", + "Ġq i", + "tis ed", + "ĠBr istol", + "umm ation", + "Ġextract or", + "Ġfav oured", + "ĠPy ro", + "ĠEngine ers", + "flat ten", + "toler ance", + "Ġ xt", + "ĠT ot", + "Ġtest bed", + "IC U", + "ĠSw arm", + "Ġintern ationally", + "Ġant ine", + "ĠInsur ance", + "b ai", + "n h", + "Ñ ĭ", + "os ac", + "ĠL ec", + "th or", + "Ġout ermost", + "Ġdo ors", + "Ġbi ometric", + "glut amate", + "ĠWood s", + "ĠMun ich", + "u ximab", + "pl aces", + "Ġam yotrophic", + "ĠPar am", + "ĠChrist ensen", + "A ge", + "en ne", + "Ġan im", + "Ġrec rystallization", + "ĠPro positions", + "Ġsn ails", + "Second ly", + "ĠPU FA", + "F rance", + "S rc", + "v itro", + "om ass", + "ur u", + "ĠL ever", + "ect onic", + "emb l", + "PC L", + "Ġcoordin ator", + "ĠFox p", + "ĠBir mingham", + "ĠLib eral", + "Ġcru ise", + "Ġi θ", + "Ġsym p", + "az aki", + "ĠPar se", + "Ġhyd rologic", + "Ġprolong ation", + "ĠHay es", + "Ġsubm uc", + "Ġaggl omeration", + "A RE", + "ĠF MR", + "ĠL omb", + "math char", + "Ġstruct uring", + "Ġelectroph oretic", + "Ġdimin ishing", + "Ġbra ke", + "chen ko", + "ĠPere ira", + "l ens", + "Ġback end", + "Ġillustr ations", + "Ġdemand ed", + "Ġnotice ably", + "ĠKa iser", + "ĠDavid son", + "Ġbrak ing", + "T p", + "For ward", + "μ ν", + "ĠCd S", + "Ġaster oids", + "Provid er", + "ĠE ut", + "Ġtr il", + "ung s", + "Ġdiv ing", + "ĠUAV s", + "ĠiP SC", + "i int", + "Ġ ×", + "th rombin", + "Ġcoordin ating", + "ext rem", + "Ġembol ization", + "ĠAdi p", + "pl ated", + "ĠH ag", + "ĠE TS", + "Ġbro od", + "An g", + "ĠPC V", + "det ail", + "R SS", + "b ens", + "Ġt ier", + "ĠC ock", + "Ġg ay", + "Ġqu int", + "Ġag enda", + "Ġaff airs", + "ĠMod erate", + "hel ical", + "ĠEqu ivalent", + "Ġproportion ally", + "Col umn", + "FW HM", + "A ir", + "E num", + "ific e", + "arc sec", + "ĠTR IM", + "ĠLab eling", + "Q AM", + "p ies", + "Ġis otropy", + "ĠG ó", + "Ġpo inters", + "tig raphy", + "ram ers", + "Ġmac aque", + "Ġmiss es", + "Ġelliptic ity", + "present ed", + "galact osidase", + "É Ľ", + "in ion", + "Ġm ite", + "ll l", + "Ob jective", + "Ġprison ers", + "ĠHerc ules", + "Ġanti s", + "Ġclos ures", + "ĠMar tian", + "Ġter pen", + "rob ust", + "Ġsequel ae", + "al arial", + "ĠC SA", + "ĠB land", + "ĠG ent", + "Ġor phan", + "Ġind ent", + "big wedge", + "Ġdefin able", + "Ġolig osaccharides", + "ĠBat talion", + "Ġis ometries", + "az olin", + "ĠSh own", + "spect ra", + "Vis ual", + "<<<< <<<<", + "Ġlenti viral", + "othel ioma", + "Ġted ious", + "ĠB CI", + "Ġge ologic", + "Ġconsum es", + "ĠAbl ation", + "le ast", + "Ġth igh", + "Ġsec recy", + "cover ing", + "e iro", + "à µ", + "ĠT BS", + "Ġis omerase", + "Ġrecomm ends", + "ĠVor tex", + "ĠB ray", + "Ġsub d", + "ĠOp tions", + "Ġmetam aterial", + "ĠSqu ares", + "t rap", + "im on", + "Ġhe sit", + "Ġab c", + "cess ing", + "ĠRE T", + "Ġpin ned", + "Ġket ones", + "Ġweld ed", + "ĠMitochond ria", + "Ġing ested", + "ĠQ FT", + "Ġcompar ator", + "Ġoxid oreductase", + "Ġtet rad", + "ĠSens itive", + "Ġcatch ments", + "Ġrefuge es", + "Ġpuber ty", + "A rab", + "Ġinter annual", + "sc attered", + "ĠMet am", + "Ġcycl ization", + "pert ures", + "ĠLIN C", + "r ules", + "ĠP ont", + "PT H", + "ĉĉĉĉ ĉĉĉĉ", + "S anta", + "ĠL NC", + "Ġsub modular", + "rec tive", + "Ġtr if", + "Ġsent inel", + "ĠTw in", + "kelet ons", + "m iral", + "am ing", + "ĠG ay", + "Ġinter specific", + "Ġrel ieve", + "Ġend omorphism", + "ĠExp anding", + "ĠRun time", + "y ang", + "re quires", + "od ine", + "omet abolic", + "St ore", + "plan et", + "Ġre nov", + "__ _", + "aden osine", + "u itive", + "Ġk el", + "ĠPro long", + "ĠAd vance", + "Ġantimicrobial s", + "ĠMunic ipal", + "ĠNeutroph il", + "F As", + "ĠF ame", + "ib us", + "ET E", + "Ġstep ping", + "ĠBl ot", + "ĠLa ura", + "Ġrock y", + "ĠLim a", + "Ġmitig ated", + "ĠLam bert", + "Ġunexpl ored", + "Ġtrigon ometric", + "p ig", + "ĠH eli", + "Ġfin ely", + "Ġoxid izing", + "Ġcolon oscopy", + "activ ities", + "ĠE asy", + "Ġunexpl ained", + "ak y", + "AS M", + "work er", + "ĠCr ist", + "ãĢ ģ", + "ul k", + "ĠS ugg", + "ĠM im", + "Ġiter ates", + "Ġsulf oxide", + "gluc an", + "Ġreact ant", + "Ġphag ocytic", + "B rain", + "uc ted", + "ĠSc and", + "ĠCa CO", + "Ġaffili ation", + "Pol icy", + "ĠInfant ry", + "F unctional", + "r times", + "Ġw ond", + "ard ment", + "ĠWe il", + "Ġdirect ors", + "uff ix", + "ĠRu iz", + "ĠPhenomen a", + "Ġmicro b", + "cos m", + "Ġutil isation", + "pers ed", + "Ġcon sole", + "tic ulate", + "Ġdes ens", + "Ġreplic as", + "Ġpluripot ency", + "ĠUk rainian", + "Ġhydroly zed", + "ĠBiod iversity", + "E fficient", + "ĠK ash", + "min or", + "Ġconcl usive", + "Ġtent ative", + "j ira", + "Ġm b", + "ĠI PA", + "ĠP is", + "Ġgover ns", + "ĠSouth west", + "oe ba", + "ĠMoh ammad", + "alb umin", + "c ircles", + "ĠH edge", + "ĠAm ph", + "B ACK", + "O ld", + "h istor", + "ac ular", + "ĠN OR", + "hen ius", + "vis ions", + "miss ibility", + "Ġthrombo embolism", + "at ized", + "Ġw il", + "aw ing", + "AS I", + "Ġheter odimer", + "Ġbuff ering", + "ĠIde ally", + "ĠE gg", + "ograph ies", + "ĠAp pl", + "ĠCI s", + "mean ing", + "ĠSM AD", + "Ġphenyl alanine", + "ĠTit anium", + "ĠZar iski", + "Ġn ymph", + "Ġh ired", + "ĠP PC", + "ĠK G", + "ĠGu ill", + "ogly cans", + "er ial", + "D ele", + "il us", + "ĠF itness", + "Ġwh ales", + "gr ant", + "most ly", + "Ġclim ates", + "ĠCamp aign", + "Mg O", + "Ġepist emic", + "L ipschitz", + "ĠL AT", + "Ġcl adding", + "vac uum", + "agglut inin", + "k ill", + "Ġs ail", + "Ġar tistic", + "ans w", + "ĠSD F", + "ĠKe ith", + "Ġsor afenib", + "Ġgall bladder", + "direct ory", + "Ġphotore ceptors", + "ĠFok ker", + "D U", + "Ġed itors", + "Ġte lecommun", + "ardi a", + "ĠPublic ations", + "Ġscrew s", + "ĠMathem atica", + "R SV", + "ĠAp ply", + "ĠST S", + "ĠMur ine", + "Ġd ump", + "Ġl ingu", + "ĠD ixon", + "Ġover comes", + "ĠPre operative", + "Ġmig rant", + "Ġbelie ves", + "B K", + "ac tively", + "ĠI SC", + "qu as", + "Ġal ga", + "ich ael", + "Ġdis asters", + "Ġprac ticed", + "hydro phobic", + "ĠNi ño", + "ĠEth anol", + "Q E", + "ĠS J", + "ĠD engue", + "Ġap pl", + "ĠY oon", + "enz o", + "IF Y", + "Ġchron ological", + "er in", + "ĠP eg", + "ĠRe levant", + "Ġqual ification", + "ev ine", + "Ġdend rite", + "DT D", + "chol inesterase", + "w atch", + "ĠS anchez", + "Ġwas hes", + "Ġper mafrost", + "ĠTer tiary", + "Ġsynthes izing", + "Ġexped ition", + "rout ine", + "ĠSear ching", + "ĠS é", + "res idual", + "ĠL CD", + "enti ties", + "Ġend ovascular", + "Ġparam ount", + "p her", + "Ġstraightforward ly", + "Ġvas odil", + "ĠSchist osoma", + "Ġper missions", + "cent red", + "Ġfr ustrated", + "struct uring", + "ĠSch l", + "ĠIniti ation", + "Ġcu ticle", + "Ġforget ting", + "ĠS as", + "ĠS ult", + "un o", + "Ġdis integration", + "ĠV G", + "Ġw ards", + "ĠI RE", + "up ro", + "Ġsub gen", + "Ġsub classes", + "ĠSt and", + "ĠHe ight", + "inter pretation", + "Ġgly can", + "ĠSol vent", + "ĠMal ignant", + "Ġuns uitable", + "ĠCox eter", + "Ġspermat ogenesis", + "Ġful lerene", + "F ox", + "S OC", + "w et", + "arm stadt", + "Ġprop ofol", + "index ed", + "Ġsn akes", + "Ed it", + "ĠmJ y", + "R IB", + "Ġe y", + "ĠAl kal", + "Ġtri axial", + "PS K", + "ne o", + "Ġend o", + "Ġglycos ides", + "Ġsyll ables", + "Ġs orghum", + "lo or", + "Ġge othermal", + "gu inal", + "ĠSerb ia", + "æ ĸ", + "ĠS entinel", + "igh ters", + "Ġkey board", + "Ġban ana", + "gran ular", + "Ġdecid uous", + "ĠH AR", + "ne uron", + "ĠCar n", + "Ġburn s", + "Bo ost", + "ĠDetermin istic", + "p ipe", + "ĠF AD", + "ĠB ovine", + "ĠR ou", + "Ġk an", + "aut onomous", + "utri ents", + "Ġhypoth yroidism", + "ĠSIN R", + "st ret", + "Ġun altered", + "ĠZ ika", + "val ley", + "Ġlong itudinally", + "Ġfluores cein", + "cat heter", + "ĠCong enital", + "Ġpie z", + "Ġabbrevi ated", + "ĠChlam ydia", + "Ġa ired", + "Ġqu een", + "Ġinstruc tive", + "Ġabrupt ly", + "Ġrecur rences", + "I MP", + "Ġex osome", + "ĠH SCs", + "Wr iter", + "el is", + "ĠAr ithmetic", + "enari os", + "Ġlig ated", + "ĠLocal ized", + "ĠFre eman", + "Ġcarn iv", + "ĠC ereb", + "Ġg rac", + "ĠG ond", + "ĠV ancouver", + "ob ox", + "Ġtyp ed", + "ĠÄ ¥", + "Up on", + "F uture", + "EN G", + "de ad", + "Ġser pent", + "ĠAss ignment", + "ĠUp dated", + "Ġhistor ian", + "Ġtroposp heric", + "C loud", + "b umin", + "ĠP ras", + "ĠB asket", + "ĠâĪĴ âĪĴ", + "benz odi", + "ĠTra uma", + "ĠBehavi ors", + "Ġp ter", + "ir radiation", + "Ġsp oke", + "ari atric", + "Ġpl ugin", + "Ġsuper sonic", + "Ġdoc etaxel", + "itig ation", + "Ġdiges tibility", + "n em", + "Ġp b", + "ĠC SR", + "Ġfo uling", + "Ġrhe ology", + "Ġflood s", + "Ġglu ing", + "agasc ar", + "j ets", + "p ti", + "est on", + "ĠK ü", + "Ġopen ings", + "Ġisol ating", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠ", + "Ġsemicon ducting", + "r ative", + "ec ology", + "ur ization", + "Ġmulti factorial", + "sh adow", + "Ġcross linked", + "Ġphyl a", + "Ġprem ises", + "ĠLO W", + "general ized", + "ĠPolynomial s", + "Ġb ismuth", + "ĠR oz", + "ĠDec oding", + "ĠClass ifier", + "conduc ting", + "Ġlit term", + "M ann", + "Ġf ant", + "ĠC Z", + "ĠP SNR", + "Ġstar ring", + "ĠPol yg", + "ĠHol m", + "r g", + "ad ditional", + "gu an", + "prof essional", + "Ġin quiry", + "ĠP g", + "ĠSch mid", + "Ġhead ed", + "cha ft", + "ĠExp and", + "Ġcompan ions", + "V an", + "ĠS ie", + "Ġcan als", + "ored oxin", + "Ġcoll iding", + "abs olute", + "ĠPhot os", + "ĠLeg acy", + "Ġrevascular ization", + "ĠP SM", + "Ġexp enses", + "IS MA", + "inter vals", + "Ġmultic ellular", + "Ġnons m", + "Ġresemb lance", + "H ep", + "Ġw ool", + "Ġn iger", + "ess a", + "asc i", + "Ġrot ates", + "Ġcompe titions", + "Ġarri vals", + "Ġlute in", + "Ġscholar ship", + "F ran", + "Ġre used", + "ĠEqu ivalence", + "ĠGL UT", + "grad ing", + "sal t", + "Ġcommens al", + "Ġfra ud", + "ox ib", + "Ġgastro enter", + "Ġrain y", + "Ġasser ts", + "Oper ation", + "Ġflatten ing", + "P ut", + "X B", + "Ġp M", + "Ġcon ic", + "ob tain", + "ĠRo ber", + "N ovember", + "ĠJ P", + "Ġfe brile", + "ĠBar riers", + "================================ ================================", + "Ġhemic ell", + "ĠS CS", + "ĠN em", + "Ġr aster", + "cl ude", + "Ġïģ ¦", + "ĠElli ott", + "b order", + "Ġd ÏĨ", + "rib ose", + "ĠEn v", + "ĠDiff use", + "ĠSupers ymmetry", + "Pear son", + "F ETs", + "y ah", + "ul ia", + "ĠD warf", + "ĠH ull", + "ĠAtt ribution", + "Ġrepos itories", + "ĠGN SS", + "ĠV ectors", + "Ġsuccess es", + "ĠMan hattan", + "umb ent", + "dig it", + "Ġcircumf erential", + "B etween", + "D eg", + "o ue", + "Ð ¹", + "ĠD ere", + "ĠR f", + "Ġr ide", + "ĠV oc", + "Ġprot est", + "Ġpur pos", + "ĠProof s", + "names e", + "Ġbank ing", + "ĠGastro intestinal", + "ĠU nt", + "Ġwhen ce", + "ĠY ue", + "ĠRe habilitation", + "Ġexchang ing", + "ĠACT H", + "Ġc apping", + "am ido", + "ĠB ap", + "Ġpl at", + "to String", + "Ġelectro encephal", + "Ġelectrosp un", + "M pc", + "j ord", + "on v", + "Ġc raft", + "ĠC Cl", + "ĠSt rip", + "Ġmed itation", + "oxid ative", + "ĠRed uce", + "ĠCommon wealth", + "Ġrif amp", + "F lu", + "Ġre analysis", + "ot rich", + "ĠE SA", + "Ġj th", + "hel in", + "ĠGen otype", + "Ġdiagonal ization", + "ĠGab riel", + "Ġquarant ine", + "ĠC rab", + "ĠD ict", + "acc umulation", + "be k", + "ĠDiff erentially", + "Ġlac tis", + "tetrahydro furan", + "l aser", + "ĠU m", + "Ġme ga", + "rm e", + "ĠInd ians", + "ĠLeon ard", + "Ġcommod ity", + "Ġfumig atus", + "i ou", + "ĠE chin", + "ost ream", + "Ġmemb ran", + "sim ulations", + "back end", + "ĠOB JECT", + "g iving", + "Å Ļ", + "Ġinf ective", + "Al g", + "ĠHu h", + "ĠMI CR", + "Ġfollow ers", + "fer ro", + "Ġcyan ide", + "P resent", + "Ġ END", + "ĠM Cs", + "Ġtim eline", + "ĠEmbry onic", + "Identif ier", + "Ġincon clusive", + "ĠGamm aproteobacteria", + "n ets", + "ĠHe ating", + "ank ar", + "th r", + "ĠK IT", + "ĠCh ip", + "Ġbl ob", + "Ġcalc ulator", + "Ġtext ural", + "Ġalloy ing", + "Ap plication", + "ĠProte omic", + "Ġantidepress ants", + "ur k", + "Ġcrystall ography", + "Ġcred its", + "Ġmuss els", + "T om", + "ĠF ST", + "ĠF old", + "ĠH ew", + "An n", + "bro ok", + "Ġglycol ytic", + "Tor ch", + "Ġv m", + "ĠM are", + "ĠJ y", + "Ġhetero junction", + "ĠBorrel ia", + "R isk", + "ĠN aturally", + "Ġsupp lying", + "sign ature", + "l k", + "Ġa rachid", + "ol ov", + "ĠS ok", + "ĠH ö", + "ĠR az", + "ĠV ander", + "Ġdel ib", + "Ġmy th", + "Ġmid brain", + "Ġdece ased", + "ĠS CO", + "ĠTh romb", + "Ġcur r", + "Ġsum mit", + "mi RNAs", + "dimethyl amino", + "Ġphotoc atalyst", + "verb ose", + "gom ery", + "Ġw ed", + "ĠM ate", + "Ġsign i", + "rastruct ures", + "Ġrecipro city", + "b ner", + "m ast", + "n eck", + "Ġco ins", + "ĠHist ogram", + "cr it", + "Bbb k", + "A W", + "t own", + "dis placement", + "ĠNe ph", + "separ able", + "Ġdiast ere", + "ĠMODEL S", + "Dep th", + "ĠNeisser ia", + "p dev", + "u vial", + "ĠB MS", + "ĠD ennis", + "Ġr p", + "Ġnan ometer", + "roc yt", + "ĠRoman ian", + "Ġconce ivable", + "C OS", + "al veolar", + "as tig", + "ab we", + "enc ode", + "rol actone", + "Ġread mission", + "inters ection", + "Ġamplic ons", + "tim ulated", + "Ġcoll apses", + "ochrom atin", + "H aw", + "ect rum", + "ft ype", + "ric a", + "Ġam id", + "MP O", + "ĠExt ensions", + "Ġvar ic", + "Ġdimin ishes", + "Ġcathe ters", + "N odes", + "Ġb box", + "em ination", + "Ġts unami", + "diagn osis", + "c od", + "q r", + "ĠF en", + "Ġworth y", + "Ġâĩ IJ", + "inform atic", + "ograp her", + "Ġundet ected", + "ĠN CAA", + "Ġcarcin ogenic", + "R U", + "Ġan eu", + "plit udes", + "ke eper", + "ĠÄ ģ", + "Ġau tistic", + "Ġcomprom ising", + "Ġunim odal", + "Ġr umin", + "ap a", + "Ġint olerance", + "Ġdirec ting", + "Ġpe a", + "Ġcomm enced", + "Ġshadow ing", + "C enter", + "Ġcl ad", + "Ġbl ues", + "bin its", + "Ġmis classification", + "ĠFA ST", + "W at", + "Ġm Cherry", + "Ġb rig", + "est radiol", + "Ġwave functions", + "Ġblo oms", + "Ġacc ent", + "aj i", + "occ urring", + "ar rest", + "Ġspecial ty", + "Ġuncon ditional", + "Ġspong es", + "Ġdys functional", + "ĠNO X", + "Ġultrac old", + "Ġmartens ite", + "O US", + "n ier", + "is ic", + "ĠMat sum", + "Ġleuk emic", + "ĠBrad ley", + "D ensity", + "ĠS emiconductor", + "ĠC ause", + "ĠIn set", + "ĠK em", + "ĠU PR", + "par a", + "ech st", + "ym et", + "Ġag ro", + "ĠY Y", + "ĠReg eneration", + "Ġancest ors", + "ĠTiss ues", + "Ġsulfur ic", + "k d", + "Ġl asing", + "ĠP up", + "ae i", + "Ġmamm al", + "ĠBrad ford", + "Ġsegreg ated", + "is olated", + "ĠC uba", + "Ġblock age", + "Ġseam less", + "Ġperoxis ome", + "h ui", + "Ġin aug", + "Ġinf ecting", + "ĠCh ampion", + "ĠAt titudes", + "calc ulate", + "Ġt ighter", + "ĠS AC", + "ĠE pi", + "Ġat m", + "Ġphys ico", + "Ġn th", + "ĠC anyon", + "Ġser oprevalence", + "Ġhom o", + "ĠUnivers it", + "Eval uation", + "ĠAPO E", + "j ob", + "Ġm K", + "Ġre ign", + "ab o", + "ĠR ugby", + "ĠN ets", + "Ġr ituximab", + "ati veness", + "Ġph y", + "orn is", + "Ġfeedback s", + "Un ited", + "Pr inc", + "imb abwe", + "ĠGir ls", + "Ġunavoid able", + "ĠSeman tics", + "B reak", + "F ISH", + "M ix", + "Ġn x", + "ĠBa o", + "dimethyl phenyl", + "ĠT OF", + "ĠC rown", + "ĠG GA", + "ĠJ H", + "Ġsuper string", + "ĠCR Y", + "Ġkind ly", + "Y N", + "Ġund oped", + "ex cluding", + "ĠLe o", + "ĠPROP ERT", + "peritone ally", + "m ant", + "ê °", + "Ġf ranch", + "ĠPro st", + "DE s", + "Ġcot rans", + "Ġr k", + "Ġgeneral izability", + "Aut hor", + "ĠAnd rea", + "ĠConf ocal", + "ĠAdi pose", + "î Ĺ", + "er jee", + "Ġan imated", + "ĠF ad", + "ĠCor rosion", + "ĠCirc adian", + "Ġacceler ators", + "ĠArk ansas", + "Ġm ars", + "ĠC uc", + "ĠInter faces", + "Ġretrie vals", + "Ġmelan in", + "Ġss DNA", + "vast ava", + "Ġallerg ens", + "b ud", + "Ġin accessible", + "ic tions", + "ĠM ood", + "ind a", + "Ġam eric", + "Ġsym biosis", + "bers ome", + "occ ur", + "ĠMarc us", + "ĠSuperconduc tivity", + "ĠC ort", + "ĠH MS", + "Ġph ased", + "ĠJ ess", + "Ġprop ulsion", + "ext ract", + "Ġsuccin ate", + "ĠÖ Ĵ", + "ink el", + "Ġsil ence", + "ĠSU V", + "Ġconstitu ency", + "Ġbacteri ophage", + "g em", + "ĠM CL", + "ore ne", + "ĠG oss", + "IC D", + "Ġglut amic", + "Ġcoex isting", + "STE MS", + "opot ential", + "ĠE y", + "ĠL ecture", + "ell ae", + "Ġimmun oprec", + "Ġtim ber", + "ĠVul ner", + "Ġa roma", + "Ġs ands", + "ĠSp an", + "Ġher n", + "Ġincub ating", + "Ġtransmit ters", + "ĠHom ogeneous", + "ĠConstruct ing", + "d it", + "Ġt c", + "al ass", + "Ġst ents", + "ĠM ID", + "Ġan oxic", + "Ġprov isions", + "ĠCap ac", + "neut ron", + "ĠVO Cs", + "Jan uary", + "V AS", + "on ce", + "ĠC ache", + "op ulation", + "ĠV TE", + "Ġinter phase", + "Ġbl og", + "ocus ing", + "hi ro", + "ĠRE C", + "Ġanis otropies", + "ben ef", + "Ġcons tipation", + "ĠCan al", + "Ġport rait", + "sil yl", + "ĠLink ed", + "ĠBow l", + "Ġmonop oles", + "ĠPere z", + "W IN", + "ĠT AP", + "Ġr uthenium", + "ĠAd herence", + "ĠEn zymatic", + "Ġspecific ities", + "Ġsk i", + "ĠC ST", + "Ġpo etry", + "AT ES", + "ram a", + "lo res", + "AL U", + "Ġvas oconstr", + "Ġgranul ocyte", + "ib i", + "Ġop ts", + "aves drop", + "ept in", + "· ·", + "ĠJe ong", + "Ġmedull ary", + "ĠDemonstr ation", + "ĠF IB", + "ĠB RD", + "ĠV V", + "Ġall o", + "R ule", + "T f", + "Ġun realistic", + "Ġlat itudinal", + "RO P", + "ĠCorrel ates", + "I U", + "ĠP ore", + "oc rit", + "ĠK all", + "Ġchar coal", + "ĠMong olia", + "âĪ ħ", + "ĠEn tity", + "Ġgram s", + "g raphene", + "m ine", + "ent ric", + "ĠP p", + "ĠW elfare", + "ĠJ ets", + "Ġaff irm", + "ĠBel le", + "ĠStrateg ic", + "API ENTR", + "K H", + "rm ann", + "Ġassoci ating", + "ĠSur viv", + "Ġnicot inic", + "ĠWL AN", + "Ð ¿", + "Ġt ears", + "ĠRe vised", + "Ġphosph odies", + "Ġhors eradish", + "ĠL AR", + "to ok", + "ĠDes cent", + "ĠNO x", + "ĠStein er", + "ĠPerm ian", + "ĠVenez uela", + "Ġdesic cation", + "D IS", + "ĠM SP", + "Ġpo pl", + "rel s", + "Ġï£ ½", + "Ġlear nt", + "ĠBi ofilm", + "ĠPC NA", + "ĠAtt ribute", + "ĠGro thendieck", + "ĠAdoles cent", + "n v", + "st derr", + "obal t", + "ĠYam amoto", + "Ġaliqu ot", + "r ater", + "ĠO re", + "ĠK IR", + "ack er", + "Ġïĥ »", + "Ġstrat osphere", + "ĠC ust", + "resp ect", + "Ġglut amatergic", + "Ġencour ages", + "c tic", + "it ched", + "ph ins", + "Ġsub urb", + "Ġhome omorphic", + "hex ah", + "Ġmini atur", + "C AN", + "a head", + "ĠB LE", + "ĠR BF", + "Ġac utely", + "Ġï£ ¾", + "Ġanten n", + "UR N", + "ĠGir l", + "Ġbiore actor", + "ĠLeib niz", + "Ġv ial", + "ĠL ich", + "ob ac", + "ĠWhen ever", + "inhib ition", + "C ast", + "Ġstrip ped", + "ĠAst rophysics", + "pres ence", + "ĠFlo er", + "ipot ent", + "dichlor o", + "C LE", + "f inger", + "on ates", + "st ri", + "ĠS perm", + "ĠD BS", + "op eptide", + "se paration", + "ath ing", + "math p", + "ou ples", + "Ġent ropic", + "Ġsw ollen", + "Ġdon ated", + "Ġsettle ments", + "oven ous", + "P erm", + "ĠS ard", + "eg en", + "ĠAl ph", + "ĠCo operation", + "ĠPD AC", + "F inal", + "l apse", + "Ġre vol", + "ĠI x", + "ĠL ens", + "Ġk th", + "rel axation", + "Cl O", + "ichlor o", + "Ġwrap per", + "ĠSimultaneous ly", + "Comput e", + "ë Ĭ", + "im plantation", + "ĠV LA", + "hem e", + "ĠMay or", + "ĠFac ilit", + "Ġb att", + "im mer", + "Ġcur ated", + "Ġconf luent", + "gener ational", + "star ts", + "Ġgranul osa", + "arboxyl ate", + "ĠRies z", + "Ġtext book", + "Ġconstit utional", + "ĠPe ace", + "ĠComm ander", + "Ġobsc ured", + "v il", + "ad dition", + "ĠW asserstein", + "co ords", + "ĠProb es", + "Ġdeline ated", + "TZ VP", + "ĠIN F", + "Ġdos ages", + "Ġolig omerization", + "ĠNAD P", + "MK II", + "om in", + "Ġl hs", + "ug hen", + "ĠJ ong", + "anc el", + "let ter", + "ĠAN C", + "F UNCTION", + "Ġt ram", + "The ir", + "ĠGen erated", + "Ġpoly cyclic", + "Ġcul min", + "Ġrect um", + "Ġce ft", + "Ġmetam aterials", + "ĠBiot ech", + "Ġmys elf", + "Ġun ifying", + "Ġem an", + "ĠSing er", + "triang leright", + "om el", + "ĠC FA", + "oc ha", + "ĠG SM", + "Ġcent rifuge", + "ĠInd o", + "Ġtransport ing", + "LI B", + "Ġoxal ate", + "ĠDul becco", + "Ġal i", + "arg inal", + "ho o", + "isc hem", + "APIENTR YP", + "A part", + "L DA", + "ens ile", + "set tings", + "Ġep hem", + "amp a", + "Ġdu plications", + "ĠWhe eler", + "Phys ical", + "ĠCom pletion", + "ĠOr dered", + "Log ger", + "Ġinterf erences", + "ĠPoll ution", + "Optim al", + "S v", + "a icin", + "Ġp icks", + "di versity", + "tig ens", + "Ġdim orphism", + "fe res", + "ĠRob otic", + "Ġconfirm atory", + "Ġcath odic", + "Ġspir als", + "Ġspr uce", + "Lag range", + "w at", + "ĠAll an", + "den ote", + "C ID", + "al ways", + "it he", + "ĠCh im", + "con ditional", + "bar rier", + "Ġvisual izing", + "Ġïĥ ¹", + "Sch midt", + "Ġconvention ally", + "ĠQU ANT", + "GRO UND", + "Ġ ug", + "ĠC WE", + "ĠIn spired", + "Ġbu yer", + "Ġtherm ost", + "Ġkin ematical", + "an olic", + "Ġd if", + "Ġï£ ¼", + "ĠGe o", + "Ex amples", + "cons istency", + "ĠPal ace", + "ĠVacc ination", + "Ġnatri uretic", + "Y AG", + "ĠCT Cs", + "Un ivers", + "ĠAcknowledg ement", + "memb ered", + "v v", + "ĠS ession", + "Ġinst ar", + "ĠLe vin", + "AV I", + "Ġprolifer ator", + "olith s", + "ĠTemper atures", + "im ming", + "ĠTo eplitz", + "IC ATIONS", + "ĠIntegr als", + "Ġsplic ed", + "D est", + "res ulting", + "ĠH ope", + "Ġen closure", + "ie ves", + "fl av", + "ĠAbd ul", + "Ġleishman iasis", + "à ²", + "os keleton", + "Ġad duct", + "ĠInflu ences", + "E QU", + "ĠS itu", + "Ġse as", + "ĠRe ich", + "cy st", + "ĠEV OLUTION", + "Ġwith stand", + "ĠG inzburg", + "RNA i", + "ĠNon parametric", + "ĠPr incess", + "Ġintra vascular", + "UT IONS", + "Ġglut ar", + "Ġcoinc ided", + "ĠSa ito", + "pret rained", + "comb ined", + "ĠT AM", + "Ġalarm s", + "Ġcyclo oxygenase", + "Ġb n", + "Ġpl agi", + "Par ticle", + "GG G", + "e tics", + "am ber", + "AB STRACT", + "ĠExt racts", + "ĉĉĉ ĠĠĠĠ", + "ĠPhyl ogeny", + "t ow", + "ĠCon taining", + "Ġend onuclease", + "inc ubation", + "Ġoffic inal", + "Ġexplos ions", + "lay out", + "Ġtouch down", + "ĠReve aled", + "Ġinfiltr ate", + "en ith", + "tim ulation", + "ĠK ind", + "erv ices", + "PD A", + "Ġcere us", + "En v", + "Ġlap a", + "k amp", + "m ult", + "ent hal", + "ĠGold stone", + "si RNA", + "stre pt", + "Q ual", + "m other", + "di o", + "Ġinf requent", + "Ġcycl ospor", + "hep atitis", + "thromb otic", + "G ST", + "ĠL j", + "ĠU R", + "of ect", + "ĠAr row", + "eth nic", + "ĠBarc elona", + "C are", + "ti tious", + "Ġe ta", + "Ġvir ions", + "sm ash", + "ĠâIJ ¤", + "Ġa venues", + "ob arb", + "ĠCom ments", + "Ġany way", + "af il", + "ĠBe a", + "ĠBo ys", + "ĠAutom ata", + "ĠSuperconduc ting", + "P ic", + "k Hz", + "Ġn orepinephrine", + "ĠG PC", + "Ġunder lined", + "bra him", + "Ġelectrosp ray", + "Ġses qu", + "ĠTourn ament", + "A ustr", + "ĠG rowing", + "ĠWe bsite", + "LD H", + "cov ariance", + "sever al", + "st abilized", + "Ġdec arboxylase", + "Ġrem ed", + "rho e", + "ĠSR S", + "ĠTre ated", + "ĠMad agascar", + "ĠMag ic", + "Ġweap on", + "ĠYosh ida", + "Ġhypogly cemia", + "ĠBifid obacterium", + "enti tious", + ":: :", + "ĠSing les", + "Ġnic ely", + "Ġunexpected ly", + "ib les", + "ari ae", + "Ġcent roids", + "Ġbroad ened", + "ĠJoh ns", + "ĠBacter oid", + "Ġfram ing", + "Prim ary", + "ĠPict ure", + "gover nment", + "Ġre q", + "ĠT ry", + "ib o", + "Ġliqu ef", + "osens itivity", + "Ġsla ughter", + "ĠD AR", + "Ġlog it", + "Ġprom ises", + "Ġlaw yer", + "ĠFP G", + "T CP", + "Ġinter calation", + "ĠBo e", + "Ġwide band", + "Ġjudg ement", + "romagn ets", + "Last ly", + "ĠIschem ic", + "I MA", + "f ood", + "m uch", + "Ġa venue", + "Ġschist osomiasis", + "ĠExec ution", + "D QU", + "G IS", + "k ines", + "ak age", + "ech t", + "ĠSc aff", + "ĠStr ings", + "ĠMulti level", + "Ġcum bersome", + "ĠRay mond", + "Ġirregular ities", + "ĠAGN s", + "ĠMetast atic", + "ĠIber ian", + "M b", + "R NP", + "h ong", + "is inin", + "Ġth irteen", + "ĠF AS", + "Ġse aling", + "Ġap atite", + "Ġser ially", + "ĠÅ Ŀ", + "D EL", + "F o", + "ĠS oph", + "ĠB ear", + "ĠJ osh", + "rec k", + "ull er", + "Ġexc ursion", + "Ġemb odied", + "Ġhybrid ized", + "ĠLie utenant", + "Per iod", + "Ġmoll us", + "C VD", + "R en", + "RE AM", + "ĠB ACK", + "Ġacc reting", + "Ġcult uring", + "ĠBur st", + "ĠSeg ment", + "Ġaster isk", + "ĠIde al", + "Ġinter tw", + "ĠAt oms", + "ĠST E", + "Ġïģ ª", + "Ġremark ed", + "Ġhair s", + "â ľ", + "ĠMet ropolis", + "ĠPar tially", + "ĠObs erver", + "Ġhemat ologic", + "obil ization", + "ĠBerg man", + "Ġcart esian", + "Ġclath rin", + "ĠS ung", + "Ġr ation", + "Ġsc oliosis", + "oh l", + "mut ant", + "NN s", + "ĠRah man", + "ĠSpati ally", + "P IP", + "Y b", + "Ġd iaz", + "ver tebral", + "ad zu", + "als ki", + "ans wer", + "Ġge ochemistry", + "Ġstem ming", + "w es", + "ox ys", + "Ġmat s", + "ev a", + "ĠHyper bolic", + "arb age", + "Ġclip ping", + "ĠSug ar", + "ĠC ognition", + "ĠD IV", + "Ġtem pt", + "ĠPath ogen", + "ĠPed ro", + "Ġw ak", + "ent ries", + "ĠG CM", + "pro jective", + "Ġprof iciency", + "ĠKn own", + "Ġlex icon", + "ĠMend elian", + "Ġzoon otic", + "le ans", + "ĠT alk", + "Ġk urtosis", + "NA S", + "ĠNow adays", + "ĠL il", + "ĠW MAP", + "Ġdis perse", + "Ġcoll oids", + "eb ra", + "OM ET", + "ĠD CT", + "ĠR ise", + "Ġinter genic", + "GT H", + "Ġtap ered", + "Mark ovian", + "Prot ocol", + "ĠVeget ation", + "r ats", + "Ġd ivalent", + "ĠCr ust", + "zy g", + "Ġpig mentation", + "grad uate", + "ĠRic c", + "Ġcounterex ample", + "Ġs ativ", + "Ġl s", + "ĠCirc ulation", + "is otropic", + "ĠEN SO", + "Ġtrop onin", + "Ġdissol ving", + "Ġcosme tic", + "H f", + "f urther", + "Ġp anc", + "Ġh ops", + "int ra", + "ĠZ he", + "ĠRel iable", + "ivol umab", + "M X", + "R ab", + "ĠP ES", + "ĠB ü", + "Ġad hered", + "Ġflu ency", + "ĠCl aus", + "Ġdel amination", + "Ġgu anine", + "ĠMulti scale", + "ĠEqu ip", + "ĠIll ustr", + "Ġtetra hydro", + "f el", + "l ists", + "Î ŀ", + "em ulsion", + "ĠN Z", + "Ġwas n", + "ai ra", + "Ġarg uing", + "mi RNA", + "ĠExp ressed", + "Ġspectrophot ometric", + "Ġile um", + "Ġflam es", + "F it", + "G on", + "ĠC ulex", + "Ġun weighted", + "Ġnan ob", + "SH V", + "Ġalign ing", + "Ġshut tle", + "Ġchloro quine", + "Ġpyr ite", + "ĠR ica", + "Ġr ift", + "Ġcathe psin", + "ĠPROC ESS", + "P f", + "R aw", + "ray fish", + "SA L", + "coll apse", + "........ ........", + "at ases", + "Ġwork shops", + "oph ile", + "ĠâĬ ĥ", + "Ġbifurc ations", + "T race", + "Ġp ause", + "Ġorbit ing", + "oli ubov", + "ĠCur tis", + "ĠRevis iting", + "ore t", + "Ġinf used", + "lu ents", + "Ġplas tid", + "Ġïģ ¹", + "Ġexec utions", + "ĠGra ves", + "loc ally", + "ĠAtmosp here", + "diab etes", + "ĠPrad esh", + "ĠCof actor", + "is omorphic", + "Ġb od", + "ĠC BD", + "Ġinc ap", + "Ġret rovirus", + "Ġlip ophilic", + "Ġlin oleic", + "Ġtrav elled", + "c ovalent", + "p ick", + "u pl", + "ĠP ole", + "ĠTh ym", + "ĠTe ich", + "Ġcollabor ators", + "Ġinstant ons", + "ĠMEG A", + "ĠHepat ocellular", + "Ġinfest ation", + "ĠPie zo", + "ĠL ub", + "ĠN Cs", + "Ġnucle oside", + "Ġoste ogenesis", + "E igen", + "R MSE", + "Ġl ax", + "ĠK ost", + "ĠV ero", + "ĠCh ou", + "elect rochemical", + "Ġcompe ti", + "ch ia", + "Ġsub module", + "ĠAl low", + "Ġresol vent", + "Ġswe eps", + "Ġsupercon formal", + "pyrrol idine", + "l ofen", + "å Ń", + "Ġdes erves", + "ĠZ imbabwe", + "az ines", + "ĠCons ult", + "Ġcast le", + "Ġpharmaceutical s", + "Ġparac rine", + "Ġjejun i", + "Ġargu ably", + "Ġe NOS", + "Ġher ds", + "Ġvehic ular", + "Ġtriang ulated", + "Ġî µ", + "ĠGrand e", + "Ġanthocyan ins", + "ĠD uan", + "ĠV ibration", + "Ġtri ad", + "Ġhouse keeping", + "B or", + "Ġp ub", + "Ġmal formation", + "gluc osamine", + "inhib itory", + "Dir ac", + "ĠC SD", + "ĠRot ating", + "ĠHTL V", + "Ġdem ol", + "inf iltr", + "Ġhem olytic", + "Ġcarb apenem", + "Ġlum inescent", + "ĠPlan ets", + "Ġmell ifera", + "Ġcortic osterone", + "ĠAdd ress", + "Ġhub s", + "ometh acin", + "å IJ", + "ĠCh ampions", + "ĠRe vision", + "ĠHer bert", + "Ġambig uities", + "K ERN", + "Ġd é", + "Ġl p", + "Ġen vis", + "ĠCh ol", + "rop in", + "Ġdr one", + "m eyer", + "Ġis otype", + "ĠV u", + "ER C", + "Ġvers atility", + "Sp eed", + "Ġae tiology", + "Ġgonad otropin", + "Ġcogn ate", + "ĠCot ton", + "reason able", + "dis able", + "Ġdevast ating", + "P ier", + "P OL", + "ĠB é", + "inc ter", + "alu able", + "Ġpoly hedron", + "ĠRel ay", + "Ġworkflow s", + "F EM", + "in p", + "Ġm ph", + "soft max", + "m ur", + "v r", + "Ġe rent", + "ĠK N", + "Ġstat in", + "Ġflat ness", + "ĠArchitect ures", + "ĠVeter inary", + "Ġnos ocomial", + "S k", + "X ML", + "ĠF os", + "ĠL or", + "Ġradi ography", + "ĠBl um", + "ĠDiscrim ination", + "Ġp unc", + "Ġex its", + "ĠB ilateral", + "ms strahlung", + "Ġcolon ized", + "ĠFib rosis", + "Ġchaper ones", + "abor atory", + "ĠPers istence", + "Ġlum ped", + "Ġrab ies", + "ĠBurn s", + "D ense", + "on tium", + "acet ylation", + "ĠF ET", + "Ġhand ful", + "bi ology", + "Ġundes ired", + "L imit", + "ĠN BA", + "ĠSe oul", + "AP T", + "ĠTrans genic", + "oxygen ation", + "But ton", + "ĠTreat ments", + "Z V", + "is omorphism", + "oc ta", + "iff e", + "ode oxy", + "Ġorgan elle", + "Ġcoll oid", + "Ġcer amide", + "Ġtq dm", + "G PS", + "ĠI SR", + "oc linic", + "ĠL yme", + "Ġep ig", + "ĠTra il", + "I PS", + "Ġs orts", + "ĠZ ebrafish", + "Ġhydrox ylase", + "Sm irnov", + "B ax", + "ĠD ance", + "ĠH ors", + "Ġreach ability", + "Par allel", + "ĠES BL", + "Ġupl ink", + "Ġpostp randial", + "s olar", + "it abine", + "ord ism", + "Ne asy", + "Ġaband on", + "I MI", + "f ake", + "st atistical", + "ĠC ars", + "ib ia", + "Ġà ĩ", + "sp c", + "MD P", + "tiz ations", + "Intern ational", + "ular is", + "Ġvacu oles", + "K C", + "ĠA PT", + "ĠB t", + "ĠB om", + "ĠG MP", + "Ġpione er", + "ĠChair man", + "ĠT ucker", + "ĠR AF", + "ĠN ASH", + "ĠW IT", + "yn yl", + "Ġsup plier", + "ans ky", + "Ġdecom posing", + "ĠUV B", + "ophen ol", + "Ġb arium", + "ĠS MT", + "ot ocin", + "ly tic", + "ran king", + "ĠDi rections", + "Ġinn ervation", + "sw itching", + "d ac", + "Ġh T", + "Ġdoc tr", + "ĠIncre mental", + "ĠEarthqu ake", + "H as", + "L ee", + "m ates", + "pro line", + "ĠRE E", + "Ġviol ates", + "ð x", + "Ġhomogen ates", + "Bo olean", + "Ġd oxycycline", + "ĠMO F", + "iop hen", + "Ġapprec iation", + "fin als", + "character istic", + "ĠContin ental", + "B us", + "E sc", + "X P", + "Û Į", + "ĠCT A", + "Max well", + "Ġarchae a", + "N ik", + "N ONE", + "T W", + "ter ing", + "ĠP erman", + "Ġrest ores", + "opath ogenic", + "ĠMont gomery", + "Ġglucocortic oids", + "Ġ ud", + "ĠN uss", + "ĠN é", + "ĠSt urm", + "Ġatt aching", + "Ġintra peritoneally", + "las ov", + "Ġst ellate", + "Ġanti proliferative", + "Ġmicro organism", + "Ġvis u", + "Ġjud ges", + "random ized", + "allow ed", + "Ġdepri ved", + "develop ment", + "scrib ed", + "ethe rian", + "ĠFras er", + "R am", + "b ib", + "Ġl iner", + "Ġg uns", + "res net", + "ĠL TR", + "ight ing", + "In iti", + "ĠZ imm", + "ĠGe ology", + "Ġantioxid ative", + "Ġmag enta", + "ĠNiger ian", + "galax y", + "ĠMelan oma", + "F ound", + "Ġb um", + "ĠT rop", + "ĠD os", + "Ġmet ab", + "Ġinv oking", + "ĠSch izophrenia", + "CF G", + "Ġgel ation", + "Ġopi oids", + "p is", + "Ġch urches", + "Ġcan onically", + "Ġj ug", + "Ġaccept ors", + "DM EM", + "Ġobl iqu", + "ĠMedic are", + "arpo on", + "Z IP", + "ore active", + "Ġim printing", + "ĠV inc", + "Ġ ¿", + "Ġrest art", + "Ġdent ate", + "en zymatic", + "Ġin guinal", + "ĠN t", + "Ġun observed", + "uct uation", + "Ġbi asing", + "Ġintegr ins", + "Ġur l", + "FP GAM", + "ĠCL UST", + "omat ology", + "Ġmetallic ities", + "Ġintention ally", + "FPGAM GR", + "T yp", + "Ġal ly", + "Ġcom ic", + "ĠL ions", + "Ġim puted", + "Ġà Ł", + "lex ia", + "ĠJan us", + "Ġbr ass", + "ĠDown loaded", + "BU FF", + "iden tical", + "Ġpsychiat ry", + "C CT", + "if ar", + "ĠMand el", + "Ġopto electronic", + "Ġis omerization", + "ĠF ant", + "ĠL ion", + "ĠL ov", + "ĠN af", + "est a", + "Ġbi ocompatible", + "Ġsec retions", + "sc i", + "ĠRet ro", + "ois omerase", + "ĠSn ap", + "Ġsplitting s", + "Ġscav enger", + "proced ure", + "Daw ley", + "ë ĭ¤", + "un ate", + "ĠD ye", + "ĠN EC", + "Ġnan ocl", + "Ġplan etes", + "ĠTR PM", + "Ġvo ices", + "ĠHierarch y", + "m v", + "Ġl asts", + "Ġh oped", + "Ġmed ians", + "ĠAnd reev", + "Ġheight ened", + "ä »", + "Ġin definite", + "ĠK amp", + "ang el", + "gr ids", + "arch ae", + "Ġtherap ists", + "ĠMi R", + "Ġnegoti ation", + "H SP", + "ĠC ustom", + "Ġst ria", + "Ġun acceptable", + "ret in", + "pen et", + "ĠOR R", + "ĠLife time", + "ĠPhosph ate", + "Ġtrop ics", + "ĠWel ch", + "ĠP yr", + "Ġam putation", + "ĠAr tin", + "ĠCa O", + "Ġconject ures", + "Ġat rium", + "ĠCom plementary", + "ĠAl uminum", + "Ġmic row", + "ili ated", + "ĠImmun o", + "Ġbin ocular", + "ĠWeak ly", + "Ġimmun ogenic", + "Ġbath ym", + "ĠPhen otype", + "Ġsial ic", + "S ix", + "Ġa kin", + "ro tor", + "hel m", + "CC ESS", + "Ġneuro protection", + "ĠFif th", + "Ġconting ent", + "Ġsket ched", + "I mp", + "Ġc ached", + "ure ment", + "ĠB ic", + "ĠK ah", + "ber ation", + "atter son", + "Ġglyc ation", + "Ġinvest ors", + "Ass isted", + "ial es", + "sc ience", + "Ġpil ots", + "us cripts", + "MI CS", + "Ġorth opedic", + "war fs", + "gre ater", + "ĠArter y", + "V ideo", + "Ġar range", + "av ar", + "charg es", + "dial dehyde", + "ĠT PA", + "Ġsp elling", + "ĠSe iberg", + "Ġnavig ate", + "ĠPow der", + "ĠR ings", + "ĠCh ron", + "ĠAt g", + "Ġhom ocysteine", + "ĠIdentif y", + "Ġo ak", + "Ġl iability", + "Ġoper ands", + "ĠCT D", + "Ġallevi ates", + "m A", + "ĠL anger", + "Ġsub manifolds", + "ĠJ ag", + "Ġradi ance", + "const ants", + "ĠMor occo", + "Eng ine", + "á ¸", + "â Ĥ¬", + "re vers", + "PC I", + "uns queeze", + "ocon version", + "Ġintens ified", + "Ġrefin ements", + "ofect amine", + "ay as", + "Ġinc idental", + "ĠTh ur", + "Ġover d", + "Ġbit ter", + "Ġign ores", + "а н", + "ĠOT U", + "Ġs err", + "ab y", + "ĠG CN", + "ĠCons umer", + "Ġconc ordant", + "ĠMR C", + "ĠEcon omy", + "satisf ying", + "Ġbiotin ylated", + "Numer ical", + "ĠRash ba", + "st ochastic", + "ĠL al", + "Ġbur dens", + "All oc", + "ĠGraph ics", + "ĠLRR K", + "A IC", + "ĠT ed", + "ĠS ark", + "ow l", + "Ġhe most", + "ĠAn at", + "Ġhom ing", + "ĠChar lie", + "ĠBr uc", + "ih ara", + "ing en", + "ĠV ern", + "ĠY ers", + "Ġid s", + "Ġcirc RNAs", + "Ġconduc ive", + "ĠBR ST", + "Ġgall ium", + "Ġdich otomy", + "F r", + "e tition", + "Ġc esarean", + "ol an", + "Ġr n", + "ub stituted", + "ĠLe aves", + "ĠLe ader", + "col oring", + "D raw", + "Ġser ous", + "Er r", + "Ġinn ermost", + "ĠHam burg", + "S tor", + "j es", + "Ġto l", + "id ade", + "Ġr v", + "ĠIn version", + "Ġmulti phase", + "Ġpseud or", + "ĠGood man", + "ĠJS ON", + "Ġcorrid or", + "Ġp ork", + "ĠS ale", + "ĠN atal", + "Ġattack ing", + "ĠShe et", + "Ġstream wise", + "Ġatom istic", + "Ġfirm ly", + "ĠAch ie", + "Ġp ir", + "ĠI KK", + "ĠF alk", + "ile ptic", + "ĠTR PC", + "Ġadhes ions", + "HR P", + "Ġpauc ity", + "S plit", + "U DI", + "ĠS end", + "ĠP ine", + "ĠL on", + "ĠL ost", + "ef er", + "con caten", + "Ġlo yal", + "Ġgly cop", + "ĠObserv ing", + "ĠMoh amed", + "Y R", + "ĠFil ters", + "c as", + "p ages", + "Ġd A", + "Ġare al", + "ad is", + "ĠL HS", + "ĠThere by", + "Ġvisual izations", + "Ġtw istor", + "unit ary", + "Ġarch ives", + "Ġphenol ics", + "h ik", + "s son", + "ĠI K", + "ĠStud ying", + "Ġtw isting", + "ĠHydro dynamic", + "Ġsplit ter", + "Ġurothel ial", + "Ġal ken", + "ĠG PI", + "Ġcor tices", + "Ġcrop ping", + "Pati ent", + "ĠChlam yd", + "in berg", + "ĠA ircraft", + "ce le", + "ect ral", + "Ġconf erences", + "Ġcre atine", + "al ty", + "pro portional", + "Ġlept onic", + "Ġov ulation", + "uer re", + "tez omib", + "d le", + "init eness", + "ĠSpecim ens", + "Ġcom a", + "ine phrine", + "Ġep im", + "ĠPer cent", + "Co O", + "ĠLo ading", + "Ġven ue", + "ĠTN M", + "Ġpac emaker", + "ĠHoff mann", + "T ech", + "n ie", + "ĠOr leans", + "Ġmagnet ron", + "Ġhospit ality", + "ĠNord ic", + "oprol iferative", + "Ġundo ubtedly", + "ĠS rin", + "Ġhum ic", + "ĠIntegr ative", + "ĠCamp us", + "Ġplant arum", + "radi ative", + "Ġiter ator", + "ĠMes ozoic", + "AP s", + "car inic", + "Ġcheck points", + "ĠïĤ £", + "ĠmA bs", + "ĠLiver pool", + "ìĿ ´", + "ĠEcos ystem", + "Ġneovascular ization", + "Ġdem oc", + "lo ops", + "ĠSU RF", + "Ġpassiv ation", + "Ġconsec utively", + "ĠAlfv én", + "ĠS SE", + "Ġout s", + "stim ulation", + "Ġphilos ophical", + "ĠS ask", + "Ġfl akes", + "Ġfinger printing", + "Ġbuff alo", + "ĠWik imedia", + "Ġrecons titution", + "Ġepithel ia", + "on k", + "en y", + "ĠM Q", + "ĠF ork", + "end ance", + "Ġgeneral isation", + "Ġpe oples", + "Ġconn ector", + "ges ia", + "inter ference", + "Ġcolor ation", + "calc ulation", + "ĠAx ial", + "ĠDES IGN", + "Ġrecess ion", + "Ġdissol ve", + "ĠPartition ing", + "Qx MD", + "G ES", + "V o", + "k har", + "ĠE AE", + "Ġco arser", + "Ġpost traumatic", + "Ġsynthesis ed", + "sil ica", + "tetra hydropy", + "ĠPor ter", + "v ark", + "ent anyl", + "Ġcon ve", + "Ġra fts", + "bre cht", + "Ġrectif ier", + "Ġo roph", + "ĠC EP", + "Ġhist ones", + "Ġstand point", + "Ġanc illary", + "ĠHur ricane", + "c ro", + "Ġre b", + "Ġi T", + "Ġge ography", + "olar ization", + "ĠMan aging", + "Ġxyl ose", + "uther land", + "ĠTaq Man", + "K N", + "Ġt m", + "ĠT AS", + "ist le", + "âĢ «", + "Ġmy corrhizal", + "ĠTer restrial", + "haus en", + "observ able", + "Bri en", + "Ġneutrop enia", + "T aken", + "ĠS MI", + "Ġpol ishing", + "Ġphot op", + "Ġthermal ization", + "Ġpseud oscalar", + "ĠDom inic", + "romy algia", + "Ġechocardi ographic", + "Ill umina", + "ĠI PC", + "ĠH uss", + "ess ive", + "up take", + "Ġweek end", + "Ġcorrobor ate", + "ĠTas man", + "her ty", + "Ġper ine", + "Ġtrans ports", + "Ġgl ance", + "ret inal", + "Pro to", + "igen es", + "Ġprohib ited", + "behavi oral", + "ophe rol", + "ë ¡", + "ĠN ecess", + "ob iology", + "ok k", + "Ġtra versal", + "ĠAnd es", + "Res ource", + "oli tic", + "ç a", + "i rie", + "arc tan", + "Ġmorph ogenetic", + "ĠHu i", + "loss es", + "Ġfulf illing", + "Ġhur ricane", + "om bo", + "Ġg s", + "ĠL v", + "ĠN erv", + "ell osis", + "Ġconf ront", + "Ġorth ologous", + "Ġwet tability", + "Ġcyan obacterial", + "Ġcass ava", + "A UT", + "a vi", + "h len", + "ĠS LA", + "Ġcon vol", + "Ġinter metallic", + "ins ide", + "Ġpolar izability", + "Ġens uing", + "Ġchlor oplasts", + "l id", + "l ips", + "Ġre bound", + "ĠC ary", + "ĠL ambda", + "ĠV iv", + "Ġcalc ination", + "ĠÌ Ĩ", + "Ġcounter factual", + "ĠSil ica", + "Ref eree", + "Ġhomolog ues", + "ĠSpati otemporal", + "ĠArr henius", + "Ġinf lamed", + "ĠZ ambia", + "Ġanti psychotic", + "hel per", + "Bl ood", + "Ġpurch asing", + "ĠSchw inger", + "ĠWilk inson", + "Ġfain ter", + "Ġr ash", + "ĠJ ang", + "ĠCon ductivity", + "rop oda", + "ĠSe q", + "Ġprop olis", + "Ġtub ule", + "ĠLie b", + "optim ization", + "m ounted", + "em es", + "can ic", + "oradi otherapy", + "ĠJen kins", + "N c", + "T ogether", + "Ġf ove", + "Ġm v", + "ĠDef ect", + "ä t", + "ĠFin ance", + "umar in", + "mitt ance", + "ere l", + "ĠF ren", + "ĠR hyth", + "ram ified", + "Ġhyper cholesterolem", + "Ġstim ulatory", + "ĠRich mond", + "Ġadvance ments", + "b les", + "x u", + "all ation", + "Ġint ral", + "iter pene", + "Con cerning", + "Ġbul ky", + "Ġá ¾±", + "comput ation", + "ĠAgar wal", + "C entral", + "X PS", + "Ġt alks", + "ĠT ap", + "im ilar", + "ĠN CI", + "Ġacc used", + "Ġtranscript omes", + "Ġprovision ing", + "ĠEt OH", + "g m", + "Ġt id", + "ĠP OC", + "ff man", + "ĠIn er", + "ĠU B", + "inc ubated", + "ĠAt rial", + "Ġfour teen", + "ĠAstr onomical", + "ĠMig uel", + "ĠK ov", + "Ġsc ipy", + "Ġtherm oplastic", + "ĠMan uel", + "ĠProm otion", + "ĠAccess ed", + "Ġterr itorial", + "in as", + "ĠM Ps", + "mon itoring", + "ĠSim ulating", + "Ġpan or", + "Ġrhe umatic", + "select in", + "ĠLap aroscopic", + "H LA", + "ĠY ale", + "sp read", + "ET S", + "Ġglyc ans", + "Ġimmig rant", + "D onald", + "ĠC ASE", + "ĠH II", + "gl omer", + "Ġïĥ İ", + "ĠExper iences", + "ĠViet namese", + "Hod gkin", + "o ader", + "he art", + "Ġrem edy", + "Ġfacilit ators", + "open hagen", + "d odec", + "ĠF riend", + "ĠTo uch", + "arm s", + "CR s", + "Ġultra high", + "ĠDri ver", + "GEM ENTS", + "ĠO u", + "Ġend ocarditis", + "Ġauto encoder", + "Ġ ich", + "Ġf etch", + "ur ian", + "ĠOR Fs", + "Ġperme abilized", + "ĠWi Fi", + "ĠLith uan", + "Struct ure", + "L n", + "h ouses", + "Ġo ught", + "ĠConcl uding", + "Ġann iversary", + "ĠCre ation", + "Ġblind ness", + "Ġpc DNA", + "ĠSus an", + "ĠBenjamin i", + "ĠSent ence", + "Ġs nd", + "Ġf ins", + "ph is", + "ĠMod ules", + "Ġneuro psychiatric", + "ĠPot assium", + "Ġsacrific e", + "Ġdysp nea", + "Ġdeliber ately", + "omeg aly", + "M edia", + "T emporal", + "Ġsh ark", + "SC AN", + "split ting", + "Ġmis use", + "Ġbirefring ence", + "ĠÖĴ âĨĴ", + "Ġp ier", + "Ġn urs", + "ĠS clerosis", + "ad hy", + "Ġund etermined", + "Ġcomple mentation", + "ĠAff ect", + "ĠHam ps", + "Ġg ob", + "ĠF ate", + "ĠH AL", + "ĠK iss", + "Ġmicro be", + "Ġcarbon aceous", + "Ġlip osome", + "ĠUs age", + "Ġquasipar ticles", + "Ġc asp", + "ĠN arrow", + "Ġout look", + "ĠCh ord", + "Ġclaim ing", + "Ġdiver ging", + "ĠBio informatics", + "ĠPsy chiatric", + "ĠMas ters", + "Ġll vm", + "ĠI QR", + "ph ases", + "ĠTh y", + "erg er", + "ĠDi pl", + "SF R", + "Ġcred ited", + "ĠTet ra", + "âĭ ¯", + "Ġamn iotic", + "ĠCharlot te", + "C ox", + "H ard", + "ar ticle", + "ĠD EA", + "ĠE clipse", + "ĠL MP", + "Ġim prison", + "ĠV arying", + "ES Cs", + "ĠTHE O", + "Ġnerv osa", + "Ġpreced es", + "Ġgy ro", + "ĠWOR DS", + "ĠDak ota", + "ut ory", + "ĠE mer", + "ad am", + "ĠN ah", + "ĠVir go", + "Set ting", + "P Q", + "å ®", + "er us", + "Ġc ep", + "Ġb d", + "di er", + "Ġim balanced", + "Ġtimes tep", + "ä n", + "ĠRab bit", + "Ġham sters", + "Ġmedull a", + "ĠChromat ography", + "IN PUT", + "Ġloss y", + "P seud", + "ĠP BL", + "ĠD omestic", + "ia u", + "anc ell", + "Ġmulti layers", + "Ġsubs idi", + "ĠUtil izing", + "t une", + "re hend", + "ar te", + "Ġb urs", + "ĠN HE", + "Ġclos eness", + "ĠCol our", + "ĠHom o", + "Equ ations", + "Ġsut ures", + "ac us", + "Ġknock ed", + "Ġsecret ary", + "Ġascer tained", + "Ġin patients", + "ir ts", + "Ġpl ut", + "ans son", + "ram i", + "Ġoste otomy", + "ĠPrim ers", + "ĠLeg islative", + "ĠCardi ology", + "Ġadmit ting", + "Ġexcav ation", + "ĠHedge hog", + "W G", + "f rozen", + "Ġl iber", + "ĠI CE", + "ch osen", + "ĠK ohn", + "St op", + "Ph il", + "phag ia", + "ĠB CA", + "Ġem pt", + "Ġz z", + "oper s", + "ĠSi xty", + "eck man", + "Ġtransf errin", + "Ġpenal ized", + "Be ing", + "Ġextr uded", + "Ġmini ature", + "Ġeditor ial", + "Ġinterconn ect", + "g ro", + "k v", + "ol en", + "ĠSY STEMS", + "ĠColon el", + "ĠMedi ated", + "ĠE MD", + "Ġkn ife", + "Ġcyt ogenetic", + "Ġdig itized", + "abin oids", + "arter ial", + "Ġdiar rhoea", + "b ag", + "Ġb uccal", + "st ay", + "ĠL AMP", + "ok o", + "ĠPol yt", + "mask ed", + "ĠTun able", + "Ġco agul", + "par as", + "Ġterm inating", + "IC Ag", + "ĠExcell ence", + "Ġregurg itation", + "DQU FD", + "J ack", + "Ġa pertures", + "ĠI p", + "ĠH CMV", + "ĠG om", + "Ġnucle ophilic", + "Ġparen teral", + "T IM", + "o ine", + "Ġn T", + "ĠS ense", + "ĠF ocal", + "ran ges", + "Ġhe pt", + "ĠPl at", + "Ġmy x", + "Ġcode book", + "Ex pl", + "ĠRho A", + "Ġrhin itis", + "ĠErr atum", + "Orient ed", + "W ell", + "d oping", + "Ġb up", + "ĠIm pedance", + "Ġsubstit utes", + "actor ily", + "Ġcollabor ations", + "ĠWay ne", + "Ġvow els", + "ĠSh adow", + "Ġphen ology", + "Ġconcur rency", + "h aving", + "ĠC ES", + "ĠF IN", + "ĠL oh", + "ox a", + "ĠAl N", + "ĠAl varez", + "ins tit", + "Ġgerm plasm", + "ĠBol iv", + "ĠR CP", + "ass ador", + "Ġes p", + "Ġphen otyping", + "Ġskip ping", + "ĠFract al", + "ĠPED OT", + "w ake", + "ĠF IT", + "ĠE SD", + "ĠAn tif", + "ubiqu itin", + "ĠAer ial", + "ĠProgn osis", + "ĠREL ATED", + "Ġstratig raphy", + "vat ron", + "ĠPROPERT IES", + "Ġ icon", + "is ers", + "Ġw al", + "Ġst amp", + "ĠOptim um", + "Ġolig omeric", + "Ġinn erv", + "Y A", + "Ab cam", + "Ġv ials", + "ĠG rig", + "Ġun aware", + "Ġoper a", + "ĠWar ner", + "Ġproton ated", + "ĠDR G", + "Ġtro ubles", + "Ġproposition al", + "ĠAfghan istan", + "ĠHamps hire", + "G d", + "l ung", + "Ġa viation", + "Ġap artment", + "Ġinf usions", + "Ġbro ilers", + "ĠDis ability", + "ĠRob ots", + "Ġdeb ugging", + "Ġì Ŀ", + "Wil son", + "upro fen", + "obarb ital", + "J B", + "is ance", + "iti zer", + "MI S", + "ĠAR F", + "Ġprost heses", + "Ġdichlor omethane", + "m Cherry", + "ĠS SS", + "ĠL PA", + "SC F", + "att ract", + "Ġcalibr ations", + "Ġfibr il", + "Ġhapl oid", + "usal em", + "ĠN ut", + "Ġde ut", + "ch ronic", + "NA P", + "ĠCytok ines", + "rage en", + "ĠC ategories", + "rain s", + "Ġsumm ands", + "Ġprolif erate", + "ryl ov", + "Ġple asure", + "Ġdens it", + "ĠSUR VE", + "H IP", + "h all", + "ĠF US", + "Ġwas ting", + "ER Y", + "Ġstat ins", + "Ġeast ward", + "some times", + "Ġwrap ping", + "ĠTW O", + "v ine", + "Ġs acchar", + "Ġam ateur", + "Ġà Ľ", + "Ġmy ster", + "ĠMy o", + "Ġrh abd", + "ĠProte ase", + "Ġchol era", + "ĠG ov", + "ĠG CC", + "Ġcl ays", + "trans mission", + "ĠHol lywood", + "Ġxen ob", + "FLO AT", + "Ġas cent", + "Ġsh arks", + "Ġinter feres", + "ĠForm er", + "ĠHart mann", + "s ha", + "ĠS ave", + "Ġpar ks", + "ĠV enn", + "Ġun ions", + "Ġdisc our", + "Ġsuper lattices", + "Ġcou pler", + "protein s", + "ĠStation ary", + "ĠEther net", + "ĠFré chet", + "Ġk ines", + "Ġj azz", + "As n", + "Ġextension al", + "Ġtel omeres", + "Ġpermit ting", + "Ġexha usted", + "ĠSph ing", + "T urn", + "m ind", + "Ġs f", + "ĠH ak", + "ran olol", + "port ation", + "Cons istent", + "Ġventi lated", + "ĠDIST RIB", + "Ġt elling", + "Ġman nose", + "ÃŃ az", + "Ġbor ne", + "Ġintens ification", + "Ġenjoy ed", + "ĠBrun o", + "ĠSatur day", + "Ġc ocycle", + "it ate", + "Ġg olf", + "appro ved", + "ĠNik ol", + "it ri", + "ĠS entiment", + "Ġg low", + "Ġg yp", + "ĠP CT", + "ab er", + "ĠW is", + "por um", + "Ġhy phae", + "fe as", + "ĠTra its", + "ĠConfl icts", + "degrad ing", + "R aman", + "ph armac", + "Ġimmun ocyt", + "ĠBl ake", + "Ġpseud oc", + "ĠCharacter isation", + "ĠGalile o", + "E nabl", + "J y", + "Ġcl av", + "ĠÏ ³", + "Ġcommun icated", + "eu tical", + "Ġnanot echnology", + "ĠHass an", + "ĠT ec", + "Ġh anging", + "ĠB SD", + "ĠCont our", + "Ġfrag ility", + "Ġdisrup tions", + "Ġfinit eness", + "ĠPhilipp ine", + "n icity", + "Ù ĩ", + "ĠC rim", + "ĠC NF", + "ĠI SI", + "ad apter", + "ĠU CP", + "Ġtext ured", + "AA V", + "ket o", + "N p", + "c ounting", + "h ynchus", + "Ġpro sec", + "ĠAn not", + "ĠHar bor", + "deg rees", + "ak ar", + "ĠV ik", + "bf d", + "Ġdri p", + "ĠCauc as", + "Ġtren ch", + "Ġwe ed", + "Ġdist ractor", + "gen etic", + "spec ifically", + "ulf ite", + "ĠCons istently", + "Ġbreak fast", + "Ġbul let", + "Ġleg isl", + "ĠTra umatic", + "Ġcollect ors", + "ĠBul let", + "ĠMY B", + "ĠP ink", + "vers ive", + "ĠAt tem", + "Ġcult urally", + "B ell", + "und ef", + "vi i", + "Ġhist ocompatibility", + "let cher", + "ĠSte f", + "A mp", + "ĠR id", + "ĠE ucl", + "Ġdec ryption", + "ĠSp encer", + "ĠBit coin", + "w ic", + "Ġcom plicate", + "ĠPro posal", + "ĠÄ Ī", + "avirus es", + "ĠF ay", + "ĠR d", + "ĠG ale", + "ĠMetast asis", + "ĠImprove ments", + " ©", + "Ġpoly ester", + "Ġstrat ospheric", + "ĠSA H", + "Ġamph ip", + "ĠA FP", + "ĠH air", + "ĠE PI", + "ĠUl trast", + "Ġâĭ ¯", + "Ġga pless", + "H am", + "et to", + "Ġth reonine", + "ĠE CO", + "Ġi a", + "Ġund ist", + "Ġradi ology", + "Ġsuper lattice", + "ibr aries", + "Ġturb id", + "ĠPot entials", + "ĠPip eline", + "Ġwarf arin", + "W ISE", + "ĠL id", + "Ġrec urring", + "ĠMon o", + "ĠGover n", + "ĠAware ness", + "ol ab", + "if lora", + "str is", + "IN DEX", + "ĠDem entia", + "Do es", + "w right", + "Í ī", + "Ġs b", + "ĠD OM", + "ĠH BsAg", + "cl inic", + "ĠEx ped", + "Ġprote as", + "Ġster ilization", + "ĠBan erjee", + "ĠPerson nel", + "âĮ ĭ", + "oneph ritis", + "om ite", + "ĠC CF", + "os iti", + "ĠE ucalyptus", + "ĠIs otope", + "col i", + "poss ibility", + "Ġstr ontium", + "Ġra ref", + "ĠInter stellar", + "kin in", + "yleth anol", + "J T", + "n orth", + "Ġc ensored", + "is tive", + "Ġno ticing", + "Ġship ping", + "Em bed", + "Obs erv", + "Ġze olites", + "ub it", + "Ġfl aps", + "Ġdr ifts", + "Ġtherap ist", + "Ġpoll ination", + "ali platin", + "Joh nson", + "Ġimperf ections", + "N Y", + "Ġth alamic", + "oc arb", + "oz otocin", + "Ġtet ramer", + "Pl as", + "Ġmultic hannel", + "ĠIns ight", + "op ods", + "ĠN acional", + "Ġim atinib", + "act ual", + "ĠX OR", + "Ġbl ight", + "ĠLe ading", + "ames e", + "ĠAm plitude", + "ĠMon itor", + "ĠNeu rological", + "propag ating", + "Ġp addle", + "ĠHar vest", + "Ġod ont", + "BU F", + "Ġtac tics", + "ĠAnis otropy", + "ad ip", + "ĠAl pine", + "Ġfe els", + "Ġmed ieval", + "Ġel ucidation", + "Ġheter otrophic", + "Ġrelax ing", + "Ġhapp iness", + "ĠCyt otoxicity", + "ĠRAN KL", + "Walk er", + "m ig", + "ĠS SL", + "ĠS epsis", + "ĠG es", + "Ġhydro chloric", + "Ġclar ification", + "Ġdispar ate", + "t ested", + "Ġdat ap", + "Ġnovel s", + "ĠMicro c", + "á l", + "ĠAR C", + "ĠYang tze", + "etom idine", + "ĠMat rigel", + "ih ilation", + "ĠcDNA s", + "Ġprost at", + "ĠRail road", + "UB LE", + "ĠPART IC", + "ĠS ax", + "Ġins ecurity", + "Ġcr ushed", + "Ġhal ves", + "gi ant", + "ĠCro atia", + "icycl o", + "ĠUne xpected", + "Ġlon eliness", + "an u", + "Ġch ampions", + "ub erculosis", + "Ġequ i", + "Ġacc reted", + "Ġinv ading", + "Ġaff erents", + "Ġaltern ation", + "Ġkin et", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠ", + "ĠMAG NET", + "ĠFIF A", + "z adeh", + "ip henyl", + "ĠK ro", + "ĠEval uate", + "illi ant", + "cur vature", + "ĠPier ce", + "b etter", + "n os", + "à ¥", + "ĠK CN", + "ĠSt rand", + "ca emic", + "ĠHo echst", + "ĠEX T", + "ĠLL VM", + "B Z", + "t gt", + "on dialdehyde", + "ĠE vid", + "ĠG ul", + "Ġmulti plications", + "Ġaut h", + "ĠAustr al", + "Ġstay ing", + "ĠGlut amate", + "Ġst ray", + "ĠI SA", + "Ġlow land", + "Ġparallel s", + "Ġattrac tiveness", + "Ġelectrosp inning", + "Ġportray ed", + "ospec ific", + "f olate", + "Ġcoe ff", + "ĠEst rogen", + "tum our", + "Ġhystere ctomy", + "Ġin ositol", + "ĠB az", + "ist ein", + "Ġcruc ially", + "Ġdin oflag", + "ÍĶ ÍĴ", + "ĠDrag on", + "ĠS por", + "ĠM ater", + "ĠH ero", + "plic ing", + "ĠAN T", + "ĠForm ic", + "Que ue", + "ocarcin omas", + "U PS", + "ĠP c", + "enc oders", + "Ġinv aded", + "ĠPh ases", + "Ġpost mortem", + "Ġslow s", + "ĠMc L", + "ĠVer ma", + "ĠVi ability", + "Ġcompens ating", + "Ġclamp ed", + "j m", + "ĠR iv", + "up on", + "ĠDick inson", + "initi ated", + "Ġs ider", + "ĠS elen", + "ĠA ka", + "idel berg", + "Ġqual ifying", + "Ġenfor cing", + "otroph s", + "ĠSNA P", + "Ġr ust", + "imb urs", + "Ġimmunocomp romised", + "ĠFlem ing", + "Ġl izards", + "di alysis", + "ĠUn ivariate", + "Ġgas oline", + "Ġten ure", + "Ġsustain ing", + "Ġmot one", + "b ay", + "w ani", + "ore station", + "ĠX II", + "Ġradi ofrequency", + "ĠGu ided", + "Ind ividual", + "ĠSpect rometer", + "ĠGo ing", + "ĠMart ins", + "Ap proxim", + "am ak", + "ĠâĪ ı", + "ĠO mn", + "Ġout patients", + "Ġhyper bol", + "ĠPer ceptual", + "ĠBur ke", + "Bol tzmann", + "ĠM d", + "Ġpa w", + "ĠCat hedral", + "Ġhyal uron", + "Ġbrach ial", + "Ġaflat oxin", + "im o", + "Ġen rol", + "Ġdet onation", + "Ġover ly", + "the st", + "Ġsecond ly", + "ĠSch iz", + "ĠIGF BP", + "atech in", + "Ġs aves", + "ti ers", + "ĠB ates", + "Ġall iance", + "Ġatt ri", + "Ġast ro", + "ĠPath ological", + "Ġgamb iae", + "P ark", + "id able", + "ĠN il", + "ĠJ as", + "Ġneed ing", + "me ier", + "Ġferro ptosis", + "ĠGuid ance", + "A Z", + "i ol", + "Ġac knowledg", + "ex ual", + "Ġmen opause", + "Ġadj unct", + "cap ture", + "ĠDep uty", + "Ġb ial", + "if a", + "ĠCh itosan", + "ĠTop ics", + "ĠPlas mid", + "calc ulations", + "g ive", + "respond ers", + "ull a", + "ĠMore no", + "Ġcomment ary", + "ĠMah m", + "ï£ ±", + "on acci", + "ĠC ould", + "ĠTR P", + "second s", + "Graph Pad", + "L ittle", + "he y", + "Ġal ike", + "ĠDi as", + "aro o", + "ĠÄ ±", + "Ġtax es", + "phen anth", + "ĠChe ung", + "ĠPi et", + "D f", + "G U", + "m ectin", + "z ee", + "Ġd λ", + "Ġsynt heses", + "Ġá Ī", + "Sim ulation", + "ĠEle ven", + "w orms", + "lymph ocyte", + "Ġhaemorrh age", + "ĠO wn", + "ĠK ant", + "Ġover se", + "Ġide ation", + "ĠHar per", + "Acknowledg ments", + "v ili", + "yn a", + "ĠRec urrence", + "oz a", + "Ġhence forth", + "ze es", + "Ġquas ic", + "Ġchor oidal", + "Ġantim alarial", + "Ġcoars ening", + "D eb", + "di am", + "ĠWe ights", + "Ġbu ying", + "Ġmess aging", + "Fe bruary", + "Ext ended", + "ĠRoss i", + "Ġmist aken", + "Ġut ero", + "j as", + "ic itis", + "ĠT idal", + "Ġph aryngeal", + "cl ick", + "Ġmy o", + "kn ock", + "Ġpromin ence", + "Ġamphi philic", + "c orn", + "Ġon board", + "ĠD ud", + "ĠW oman", + "ĠOut break", + "Ġprefer ably", + "Ġsket ches", + "S at", + "f ixing", + "ĠM ey", + "ĠLet ters", + "IT IES", + "ĠSD P", + "ĠLNC aP", + "D X", + "F luor", + "R v", + "S ect", + "ĠI ons", + "Ġtrac hom", + "Ġult rastructure", + "qv ist", + "rop he", + "Ġrece ipt", + "ĠQu int", + "Ġsw apping", + "amin idase", + "Ġarch ival", + "ĠCre ating", + "ĠBart on", + "diagn osed", + "at ological", + "ol ph", + "ĠP FA", + "ĠL AP", + "Ġun physical", + "eq n", + "Ġquar tiles", + "olytic a", + "ĠFre ed", + "Ġventil ator", + "Ġkary otype", + "S ta", + "s till", + "ĠT ate", + "ur ability", + "ĠG ron", + "Ġtr imer", + "IP A", + "adec a", + "ĠImplement ing", + "s ity", + "it r", + "Ġb om", + "Ġnon relativistic", + "Ġmic elle", + "ĠAd minist", + "Ġelectro lysis", + "har mon", + "OLOG ICAL", + "L iter", + "ĠG UI", + "ĠQ L", + "mon ths", + "Ġsuper flu", + "cut s", + "Ġelic its", + "Ġmultiplex ed", + "overl ap", + "Ġcada ver", + "Ġo u", + "ĠS heng", + "ere a", + "ĠN BC", + "Ġdet er", + "ty rosine", + "ĠPar ts", + "Ġess ay", + "k as", + "it ted", + "ĠP ZT", + "ess ler", + "Ġsim ulators", + "Ġradi ating", + "cut ting", + "ĠCalc ulating", + "TH ER", + "ĠROC K", + "commun ic", + "Ġbon us", + "ĠC PA", + "ĠP UR", + "ult on", + "ĠZ hi", + "Ġcal oric", + "Ġinterp olate", + "ĠSec retion", + "Ġneuro cognitive", + "Ġgad olinium", + "f requencies", + "ĠT ract", + "Ġminim ax", + "ĠBro ck", + "ryp sin", + "ĠReson ant", + "ĠACKNOWLED GEMENTS", + "D om", + "Ġhol otype", + "Spec ial", + "Ġimmunore active", + "ARN ING", + "Pan el", + "ĠJohann es", + "R FP", + "z zi", + "ĠP omer", + "Ġtrans ects", + "Ġpo ured", + "ED s", + "ĠCirc um", + "Ġabnorm ally", + "ĠPun j", + "G ol", + "H op", + "H ex", + "I LE", + "Ġsour ced", + "ocl ase", + "prot obuf", + "Ġfro gs", + "ĠOt tawa", + "Ġbioge ochemical", + "Ġlenti virus", + "Y oung", + "ĠI PS", + "ass en", + "Ġun restricted", + "Ġmat plotlib", + "Ġchlor amphenicol", + "ĠContext ual", + "ĠHawai ian", + "Leg end", + "S parse", + "b ore", + "g aussian", + "u ke", + "ĠâĢ °", + "ret est", + "SS E", + "pre ting", + "ĠPan ama", + "ĠBroad band", + "conjug ate", + "B ytes", + "G SH", + "U ns", + "r ina", + "Ġd rained", + "Ġsc ap", + "Ġinves ted", + "Ġsatisf actorily", + "Ġherbiv ores", + "Ġarachid onic", + "ymet rix", + "Ġn ect", + "Ġcon ges", + "ĠM err", + "ĠM ai", + "Ch ain", + "Ġretrie ving", + "Col lection", + "ĠMT X", + "ĠFernand o", + "h g", + "ĠR ams", + "th resh", + "aps ules", + "Ġcond uit", + "sw ap", + "Ġblow ing", + "ĠNy quist", + "Ġuncons cious", + "ĠDIFFE RENT", + "T echn", + "h iz", + "î Ĥ", + "Ġd ξ", + "ĠSt o", + "ĠFlav on", + "Dav id", + "Ġfiltr ate", + "l ith", + "ĠW ool", + "ĠK not", + "Ġhal ide", + "Ġbio assay", + "ĠGold berg", + "ĠTrich oderma", + "Ġintras pecific", + "c rystall", + "ĠR end", + "our g", + "Ġunder take", + "ĠEn um", + "inf ect", + "Ġmid gut", + "att ack", + "ĠCirc le", + "Ġplei otropic", + "es cent", + "ĠF ri", + "ph ilis", + "ast ings", + "Ġbi ogas", + "ĠÄ ľ", + "Ġaccomp any", + "Ġroll ed", + "Ġchir p", + "Ġsomat ostatin", + "vark appa", + "S cal", + "Ġd row", + "rom ed", + "ĠL up", + "ĠL uminosity", + "ĠN ig", + "fer romagnetic", + "ĠTo y", + "Ġcann abinoid", + "ĠH OX", + "ie le", + "ĠCT X", + "Ġhyd rop", + "Ġfavor ite", + "Ġstret ches", + "eval uated", + "ogroup s", + "ac al", + "ol lo", + "Ġg enders", + "ĠG raft", + "Ġinc idences", + "Ġreplac ements", + "ĠTR UNC", + "CR F", + "Ġequal ization", + "ĠRen ew", + "Ġple thora", + "ĠEnc oder", + "M it", + "Ġc aches", + "or ate", + "end ors", + "ĠCa ution", + "ĠAb el", + "comp ression", + "ĠLars en", + "ĠElim ination", + "Ġt ester", + "Ġn inth", + "ĠL ö", + "Ġsp iders", + "Ġpo em", + "Ġeduc ators", + "ĠEnh ances", + "dest ructive", + "Four ier", + "Ġseism icity", + "ĠYun nan", + "Riemann ian", + "W ID", + "v ular", + "ĠB order", + "Ġcomb in", + "sing let", + "ĠEd dington", + "ĠTem plate", + "ĠPA X", + "Ġbasal ts", + "En h", + "Ġassist ants", + "ĠCasc ade", + "Ġin breeding", + "ch ini", + "Ġup graded", + "ĠTrans it", + "sur vival", + "Ġinject or", + "ĠPas cal", + "DEV ICE", + "Ġf ost", + "ĠK and", + "Ġext ragalactic", + "epend ently", + "Ġexc ite", + "Ġfulf il", + "Ġrip arian", + "Ġuplo aded", + "a un", + "l od", + "s aving", + "ĠH ib", + "ĠE ra", + "ob ese", + "Ġu i", + "Ġspect rally", + "ke V", + "xx x", + "ĠOt to", + "Ġé tale", + "L AT", + "d ermal", + "di az", + "ĠPl i", + "Ġleg ume", + "Ġinsp ect", + "Ġthym ic", + "ĠHorm one", + "á Ģ", + "in ot", + "ĠS hib", + "ĠB CC", + "ĠV ital", + "Ġprof its", + "ĠFed erated", + "Ġflip ped", + "Ġpropri etary", + "incor porated", + "Ġbact eremia", + "Ġáŀ ĩ", + "f ins", + "ä ½", + "es ia", + "ĠH ollow", + "ge ons", + "Ġtre halose", + "ER O", + "oster ol", + "om us", + "ĠC rystall", + "Ġcur ation", + "Ġmagn on", + "ĠAm end", + "Ġhar b", + "Ġneutral ity", + "ĠDel phi", + "Ġnons ense", + "ĠHome ostasis", + "Ġexpendit ures", + "Sequ ential", + "imod ular", + "Ġz enith", + "ĠMor an", + "Ġbootstrap ping", + "i omy", + "l actic", + "it ure", + "Ġn at", + "Ġg ab", + "Ġch at", + "reg ional", + "Ġcr ashes", + "ĠAF B", + "Ġcrow ded", + "Ġtwe et", + "engine ered", + "ĠCharg ed", + "S che", + "IT IONS", + "ĠCor al", + "ĠEl i", + "Ġinver ting", + "Ġped ag", + "ĠSand ers", + "Mean while", + "ĠGriff iths", + "P SCs", + "ti ze", + "ĠM ail", + "Ġund ec", + "Ġher mitian", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "ĠExpl os", + "Ġwest ward", + "ĠConf irm", + "B egin", + "Ġfactor ies", + "ĠPR L", + "she ar", + "Head er", + "ĠFLAG S", + "an omal", + "ĠQ W", + "ĠÌ ħ", + "oin ositi", + "Ġmamm ography", + "Ġdeposition al", + "EX P", + "resid ue", + "Ġunsatisf actory", + "A β", + "M UX", + "Ġst aged", + "ĠM MT", + "ĠK us", + "ll o", + "Ġtrain er", + "add en", + "Ġpin ch", + "WA RE", + "Ġcab inet", + "C SP", + "ec um", + "ot eric", + "ĠH av", + "Ġres ume", + "Ġnetwork ed", + "sh are", + "ĠCol le", + "Ġchem otactic", + "ĠGly c", + "olk it", + "Ġbot ulinum", + "ĠNeighbor hood", + "m V", + "ĠH Q", + "ef aciens", + "get t", + "Ġge ost", + "ĠCD W", + "ĠÌ §", + "Ġflo ors", + "represent ing", + "odi ode", + "ĠInst ance", + "Ġmonod is", + "d rying", + "re asing", + "ig i", + "Ġg out", + "ĠI EC", + "Ġfl ush", + "Ġtra ded", + "Re view", + "ĠïĤ ¢", + "Ġà ¤", + "Ġabbrevi ations", + "otherap ies", + "Ġindeterm inate", + "Ġglutar aldehyde", + "Ġattri tion", + "j ump", + "in de", + "ĠG ri", + "arc tion", + "TRA IN", + "Ġescap ed", + "at ement", + "ĠP am", + "ĠG AM", + "pro ductive", + "ĠAmeric as", + "agen esis", + "ĠMi xtures", + "ĠHo oft", + "ĠWind ow", + "Ġnod ular", + "Ġech in", + "D OF", + "ĠD DT", + "elect rical", + "ĠDec entralized", + "Ġcontrad ict", + "F rench", + "Ġa ustr", + "ĠA PD", + "ĠD IM", + "ĠSt en", + "ron omic", + "ĠPolym orphism", + "Ġc occ", + "it ings", + "Ġsub critical", + "ĠUn iqueness", + "OP EN", + "rot oxicity", + "Gen Bank", + "atab ases", + "N ets", + "u istic", + "y ric", + "ĠS ID", + "Ġco oked", + "ĠJ udge", + "Ġparameter izations", + "Ġenum erated", + "ĠAst hma", + "De velop", + "Ġc ake", + "ĠA ges", + "ven ile", + "Ġfl or", + "Ġcould n", + "det ach", + "Ġpip ette", + "ĠInst ant", + "Ġtent atively", + "ĠINT EGR", + "H Q", + "M apping", + "c q", + "å Ī", + "SU M", + "frac tions", + "ĠCl aud", + "Form ula", + "Ax is", + "ĠBil ly", + "ĠMeth ane", + "ĠI GM", + "c annot", + "Ø ³", + "Ġc iting", + "ĠD ynam", + "Ġle tt", + "eg ler", + "ĠPhysic ians", + "x FF", + "Ġo yster", + "ĠT OC", + "Ġsub arachnoid", + "ĠCO M", + "IT ER", + "Ġbenz odiazep", + "Ġuncom plicated", + "till o", + "Car bon", + "at em", + "Ġs el", + "ing o", + "IV ITY", + "Ġca vern", + "Ġspac elike", + "ĠColl isions", + "stra int", + "Ġmyc obacterial", + "Ġtrachom atis", + "A i", + "m f", + "ĠT ric", + "tic o", + "ĠE lection", + "ĠK DM", + "ĠEx osomes", + "af luor", + "Ġformal ized", + "ĠEL F", + "v phantom", + "ĠS ME", + "ich uan", + "ĠV Ms", + "Ġro stral", + "of er", + "ram anian", + "inter cal", + "Mer ck", + "ĠFerg uson", + "H U", + "l j", + "Ġr ack", + "Ġmicro graph", + "CT S", + "Ġpass ively", + "ĠMass es", + "rang ians", + "ĠAD M", + "ĠProvid ed", + "ĠVeter ans", + "s ound", + "ge x", + "ĠSp iral", + "Ġfoss a", + "Ġthermod ynamically", + "ĠS taining", + "Ġk ar", + "ef lon", + "ĠBr uns", + "VA E", + "olytic us", + "Ġintran asal", + "ĠProsp ects", + "at hers", + "Ġnumber ing", + "ĠRe placement", + "ĠNon commutative", + "quis itions", + "ĠSIM D", + "ĠArter ial", + "ĠH GF", + "ĠG PP", + "Ġflu vial", + "ner i", + "ĠComp ressed", + "VID IA", + "Ġshock ed", + "d ys", + "in variance", + "en stein", + "ĠS CM", + "ĠD od", + "Ġsh o", + "Ch lor", + "du ino", + "Ġurg ently", + "s oc", + "et ching", + "Ġdiff ractive", + "ĠZ F", + "Ġhyper planes", + "Ġmy ri", + "Ġfer romagnetism", + "fil ament", + "Ġjustif ies", + "f ault", + "ĠH TS", + "ĠE PC", + "to o", + "ĠTR AP", + "i ón", + "r v", + "ĠB PD", + "ĠN od", + "pos it", + "ĠCon vers", + "Ġzero es", + "ĠGl en", + "ĠDist urb", + "Ġtable au", + "Ġpseud ot", + "ĠColl ider", + "Ġadsorb ents", + "ĠGro ve", + "Ġking dom", + "E st", + "X s", + "c zyk", + "ĠW ille", + "ĠV OL", + "sc ar", + "ĠAd ler", + "ĠOr chestra", + "Ġspars ely", + "glycos ylation", + "L ac", + "o tions", + "ĠI le", + "Ġbe acon", + "ĠR n", + "ull ah", + "Ġtim elike", + "ĠFore sts", + "Ġupl oad", + "j it", + "ĠE DM", + "Ġtrans plants", + "mark er", + "ĠBre eding", + "ÎĶ ÎĶ", + "Ġfavor ably", + "ĠTransform ations", + "abel ed", + "ĠPoli tics", + "epis ode", + "Ġf ut", + "Ġd ithi", + "ĠM w", + "Ġtrans piration", + "Ġun limited", + "ĠAn tiv", + "PP V", + "Ġnom ogram", + "Ġinvent ed", + "ĠSched ule", + "all ows", + "Ġtrans vers", + "Ġwork piece", + "black square", + "call back", + "ĠAth letic", + "h ans", + "p oles", + "Ġe avesdrop", + "ĠC one", + "oc lim", + "ĠG host", + "iter ations", + "Ġweak en", + "Ġalkal oid", + "Ġveter ans", + "Ġprostat ectomy", + "Ġb og", + "ĠC ed", + "ĠF ever", + "yl an", + "arch ive", + "Ġattack ers", + "M aking", + "b ane", + "ĠP ull", + "ĠF LO", + "Ġco aches", + "ĠV SM", + "ok h", + "ĠSp o", + "amil ial", + "princ iple", + "Ġaggress iveness", + "Ġgard ens", + "S IG", + "Ġm bar", + ".. ...", + "Ġoptim izes", + "Ġmorph ologic", + "han i", + "Ġgerm anium", + "Enabl ed", + "w b", + "Ġfor amen", + "ĠS PA", + "Ġmagn ified", + "ĠSl ater", + "ĠSy rian", + "Ġt ert", + "Ġtra ditions", + "Ġoff ensive", + "Ġhyd rology", + "erge tics", + "Ph ot", + "Ġperovsk ites", + "Ġwaven umbers", + "Ġosteocl asts", + "imed ean", + "ĠBasket ball", + "benzodi ox", + "ĠTRUNC ATED", + "Ġb ishop", + "ĠS gr", + "ĠS atisfaction", + "agn ostic", + "num eric", + "Ġnorm als", + "Ġhum or", + "Ġcontin ents", + "NAT ION", + "Lag rangian", + "Ġkne es", + "ĠI DE", + "ad as", + "ad ia", + "ĠO U", + "ond s", + "ĠCh aud", + "Ġsl icing", + "ĠAc tor", + "Al t", + "Ġbroad casts", + "osa urs", + "Ġpick le", + "Ġunf amiliar", + "all us", + "Ġhas hing", + "inc idence", + "Ġmetabol ized", + "Ġhomogeneous ly", + "ĠFal con", + "Ġ Ñģ", + "ĠC ere", + "ĠC LA", + "ĠP aste", + "ĠF ry", + "ĠD re", + "ad ult", + "Ġdisc ounted", + "sens itized", + "ercul ous", + "ĠP ixel", + "ĠB ram", + "all o", + "ip ative", + "ip ality", + "ĠSt rict", + "ĠTr inity", + "ĠClass ifiers", + "ĠBas el", + "ĠCur cumin", + "ĠLU MO", + "Ġmediast inal", + "ĠF FA", + "Ġpl enty", + "pr ised", + "Ġpr inter", + "Ġcalc are", + "ins n", + "ont ology", + "Ġground ing", + "ĠAL DH", + "STR ING", + "ĠFem ales", + "ĠFocus ing", + "assess ment", + "ĠBlu etooth", + "ëĬ Ķ", + "Ġe go", + "ĠD AC", + "ond ing", + "rand a", + "ĠLud wig", + "Ġanteced ent", + "ĠErn st", + "d X", + "od eling", + "âĢ ĭ", + "In ser", + "ogn ormal", + "ĠTe vatron", + "Ġcovari ances", + "rig ing", + "ĠMg SO", + "carbon itrile", + "ĠLore n", + "Ġpolyt opes", + "ĠParent al", + "Ġun healthy", + "ither to", + "ĠMo tif", + "Data Type", + "ĠMI PS", + "ĠPhosph orus", + "Mo O", + "ĠPerturb ations", + "Ġaph ids", + "Ġanhyd ride", + "id eration", + "ĠM its", + "gra vit", + "Ġdest inations", + "Com mun", + "Ġtetra hedron", + "im plicit", + "Ġass ort", + "ĠSub t", + "ĠAcet yl", + "ec ium", + "ĠN ie", + "Ġoper and", + "ĠSc her", + "az oles", + "tle ment", + "ĠBlock ing", + "Ġbottlen ecks", + "ĠOccup ational", + "H AS", + "T eller", + "Ġv ague", + "est ing", + "SN E", + "Ġphoto ionization", + "Ġcompl aint", + "us pid", + "ow ler", + "Ġend ocytic", + "Ġfl ocks", + "eps in", + "col ors", + "otop es", + "ĠDep letion", + "ELL AR", + "ar med", + "ĠT IR", + "Ġbul lying", + "Ġâİ §", + "ospor idium", + "M r", + "ĠC ic", + "og al", + "Ġsection ed", + "Ch apter", + "ĠCont ents", + "ĠPath s", + "ĠExpl ain", + "comput ing", + "Ġshr ub", + "ĠMalays ian", + "B eta", + "M ad", + "R os", + "Ġe yel", + "ĠA CF", + "ĠM m", + "text ure", + "Ġinterpret ability", + "ĠTop ic", + "Ġbad ly", + "ĠmA h", + "E g", + "R Q", + "p ins", + "et c", + "ĠV ogel", + "Ġhyp oc", + "Ġrun away", + "Ġperson ally", + "Ġbind ers", + "sens ory", + "ĠIP v", + "rank ed", + "Ġfibr ations", + "Ġstraw berry", + "arot omy", + "F LI", + "r ator", + "od ys", + "ir an", + "ĠB ead", + "ĠD AM", + "âĪ ĥ", + "Ġill usion", + "pid ium", + "Pl ace", + "Reg ion", + "Ġalloc ations", + "Ġoh mic", + "Ġn f", + "im ino", + "ĠB ris", + "iti zing", + "pro per", + "sub group", + "Ġsal ience", + "rang ement", + "ĠMean ing", + "Ġbarc ode", + "Ġneurop eptide", + "Ġendos perm", + "im ab", + "Ġnan od", + "ĠMet z", + "Ġcoll ocation", + "ĠInf ected", + "Ġpack aged", + "ĠAD A", + "ĠBar th", + "ĠCN C", + "Ġcasc aded", + "ĠStock holm", + "it as", + "ĠM MR", + "ĠD rought", + "Ġper missible", + "Ġsc iatic", + "Ġfr inges", + "Ġexec utable", + "Ġstem ness", + "ĠEnd oscopic", + "apor in", + "T OP", + "e B", + "t ur", + "ĠSt ages", + "anc hes", + "Ġnon perturbative", + "Ġmar itime", + "Ġcovers lips", + "Ġlag oon", + "Experim ents", + "Ġcodew ords", + "Enc oder", + "d as", + "p rac", + "Ġp addy", + "Ġd raining", + "Ġk ids", + "Ġen emies", + "Ġmo tile", + "Ġsl ack", + "be es", + "ĠSup pl", + "ĠBar ber", + "ĠSP H", + "Ġcrystall ite", + "fit ted", + "cycl opent", + "ĠRMS D", + "Ġpark inson", + "Ġuncor rected", + "ĠSynt ax", + "Ġmultin omial", + "ĠIncor porating", + "akrish nan", + "J L", + "N ESS", + "m im", + "ĠT ET", + "ĠP orph", + "ĠSch we", + "Ġcatalog s", + "ĠAuthentic ation", + "B ro", + "ug ar", + "ĠAm pl", + "Ġsap iens", + "ĠGAN s", + "Ġnecessit ates", + "t g", + "ed al", + "ĠR ear", + "op eptidase", + "ĠIn formed", + "Ġtail or", + "ĠNN LO", + "Ġhemod ynamics", + "S y", + "d ating", + "ac hers", + "ĠT odd", + "ĠM ario", + "ĠU GT", + "ĠVal ent", + "Ġstream lines", + "Ġwar rants", + "Ġre w", + "ĠM ud", + "ĠG K", + "Ġco ke", + "ĠU ran", + "Ġgro oves", + "ron ate", + "ĠRad ius", + "ĠSu ite", + "atum oral", + "Work space", + "ĠSynerg istic", + "ĠAtheros clerosis", + "ma z", + "arg max", + "sh ield", + "ont in", + "Ġlist ener", + "ocyt oma", + "ĠGra v", + "ĠJer usalem", + "pyrrol idin", + "ĠSpr ings", + "Ġseaf loor", + "Ġd ips", + "ist ani", + "ob is", + "Ġphot odynamic", + "AD O", + "Ġion isation", + "Ġbar n", + "igene tics", + "Ġeconom ies", + "ĠGlac ier", + "Ġ ç", + "im es", + "ĠS asaki", + "ch io", + "Ġass isting", + "ost in", + "Ġind iff", + "ĠSh ot", + "ĠNe uron", + "CD D", + "ĠCON ST", + "ĠBS s", + "t as", + "ass ociation", + "par g", + "Ġes cal", + "ex ercise", + "ĠAd ela", + "Ġmy ogenic", + "ĠNO AA", + "ycl o", + "l inal", + "ĠH ut", + "Ġintro ductory", + "Ġheter ochromatin", + "Ġchem oresistance", + "Ġsimpl ifications", + "pyrid in", + "Ġamyloid osis", + "Ġnanof iber", + "ĠSut ton", + "ĠResil ience", + "P arent", + "ĠL MS", + "Ġle ts", + "ĠEl derly", + "Ġirre vers", + "she ets", + "Eff ects", + "Ġellips es", + "ĠPhilos ophy", + "Ġphot ographic", + "HE AD", + "Ġrevers ibility", + "Ġfed erated", + "ĠPhosph oserine", + "estim ation", + "ĠHum ph", + "J son", + "Ġf ills", + "Ġv erm", + "ĠSe if", + "with standing", + "ĠYam ada", + "er ia", + "ĠF LA", + "ĠV ick", + "to id", + "ann ier", + "Ġcancer ous", + "PR INT", + "ĠMechan istic", + "Ġdust y", + "ĠApp end", + "y cin", + "Ġa zo", + "Ġs izing", + "Ġc rayfish", + "av is", + "ĠAd vent", + "ĠCommun ist", + "ĠIM U", + "pix els", + "H all", + "p ast", + "ĠR ous", + "ression al", + "air d", + "ĠAD D", + "Ġsummar izing", + "Ġelect rol", + "St ation", + "ĠLy α", + "ĠTM EM", + "Ġpeptid ase", + "D ual", + "g it", + "ĠB OD", + "ĠR ham", + "ĠK ak", + "Ġread iness", + "ĠComp are", + "ĠRam os", + "sign ificantly", + "Ġhair y", + "Ġvas opressin", + "ĠGuid eline", + "B NP", + "Ġd irty", + "Ġinf imum", + "ĠAl ess", + "ĠVol cano", + "M agn", + "Y Y", + "ugh lin", + "bo platin", + "ĠCant or", + "Ġclot hes", + "ĠR w", + "Ġus eless", + "ĠK dV", + "oper oxidase", + "ĠCor rect", + "Ġfat ality", + "ĠRest riction", + "Comput er", + "Dep artment", + "I l", + "g ang", + "ĠElect roc", + "obar ic", + "P hen", + "Ġn ed", + "ad h", + "iss ing", + "to oth", + "Ġman uscripts", + "Ġbi otechnology", + "Sup p", + "ĠPair wise", + "ĠPars ing", + "d H", + "m elt", + "r z", + "ĠC atalyst", + "em ption", + "Ġshow ers", + "BL EM", + "ĠBro thers", + "ban on", + "Ġbrac hy", + "metall icity", + "ĠC IS", + "ĠC openhagen", + "Ġel der", + "Ġfin anc", + "odes ic", + "Ġdev ise", + "Ġsurv ives", + "Ġð tÃŀ", + "Ġfasc inating", + "Ġparall ax", + "H OR", + "y th", + "on ins", + "ĠE HR", + "ĠG ates", + "ob ase", + "ĠCon way", + "oper ations", + "man uel", + "ĠAb dominal", + "ĠAR G", + "ĠGr ö", + "Ġphotos ens", + "ĠCoul ter", + "ĠJul ian", + "ĠLev ine", + "Ġsarc oidosis", + "Ġp illars", + "Ġd R", + "ĠW G", + "Ġspec ulation", + "ans ki", + "ĠGaussian s", + "Sch w", + "ĠNam bu", + "paren ts", + "intr insic", + "ĠKend all", + "ĠR g", + "Ġprot otypical", + "bre lla", + "Ġtet rap", + "ĠPath ophys", + "nm t", + "Ġerg odicity", + "ĠYers inia", + "Q O", + "ĠI AV", + "Ġch ocolate", + "Ġconf erring", + "Cl NO", + "oti a", + "Com plete", + "ĠAMP A", + "ïĢ Ń", + "ĠḠ¡", + "ĠiP SCs", + "ĠApparent ly", + "Ġintox ication", + "ĠF ather", + "per cent", + "Ġsh aker", + "Ġfin ancing", + "Ġgenital ia", + "memb ers", + "Ġstagn ation", + "h matic", + "ro red", + "Ġcon idia", + "atal oader", + "ĠNe il", + "Ġliter atures", + "ĠGl c", + "ĠDevelop ments", + "differenti ation", + "ĠRevis ited", + "n il", + "t om", + "di ol", + "ĠAb ell", + "Ġplastic s", + "ĠLu ke", + "adj acent", + "ĠBH s", + "ĠPosition ing", + "ø r", + "overex pressing", + "E c", + "P ref", + "or ting", + "Ġin ch", + "ĠC atherine", + "ĠD MP", + "ĠO e", + "end othelial", + "IC ES", + "ĠHad ron", + "Ġrevis it", + "ĠPict ures", + "ĠKnock down", + "il ian", + "ĠA LA", + "op amine", + "ĠL ah", + "cl imate", + "Ġdist raction", + "ars ki", + "ĠAcc ount", + "ref lex", + "Ġelong ate", + "ĠAmb ient", + "C x", + "M achine", + "ĠJ PEG", + "Ġclass ifies", + "ĠReg ulate", + "oplas ia", + "inj ury", + "neigh bors", + "ĠFORM ATION", + "F IS", + "S z", + "ĠO SC", + "Ġassemb ling", + "Ġintrac erebral", + "su pers", + "Ġp F", + "Ġhe al", + "ĠV ries", + "arc he", + "ĠDec om", + "ĠDiff ic", + "agent a", + "ĠSpir it", + "ĠInters ection", + "Ġendors ed", + "ĠNob el", + "i Ïī", + "w u", + "ph aly", + "Ġqu eu", + "ĠFor um", + "land er", + "Ġspectrom etric", + "ĠHank el", + "ĠC SE", + "Ġres umed", + "ĠG RE", + "AC ES", + "CT A", + "Ġbeh aved", + "Mon itor", + "ĠNik on", + "ĠCHAR ACTER", + "ĠS AL", + "ĠI ch", + "ĠH SF", + "Ġgen otoxic", + "ific ance", + "ĠCh iang", + "ĠZ en", + "ĠAr rows", + "ĠPD T", + "ĠFL ASH", + "ocor tex", + "onstruct ing", + "T reatment", + "ĉ ĠĠĠĠĠĠ", + "ed ullary", + "il ty", + "ind entation", + "Ġam ended", + "Ġfl ed", + "roph ication", + "ĠGL M", + "ĠOper a", + "HL H", + "L ite", + "b mod", + "Ġa version", + "ĠS weet", + "Ġst reptavidin", + "ĠP airs", + "ug os", + "ep oxy", + "Ġun specified", + "Ġmicro channel", + "ĠVictor ian", + "C ould", + "in formed", + "Ġs its", + "Ġr x", + "Ġne p", + "to uch", + "RO I", + "Ġhead ers", + "fl ush", + "ĠPath ogenic", + "Ġspac ings", + "het ti", + "Ġmotiv ating", + "Ġstake holder", + "ĠSymbol ic", + "ĠC rani", + "Ġdis pute", + "Ġass ists", + "ind ler", + "ĠSp atio", + "oh m", + "Ġextrap olate", + "Ġelabor ation", + "ĠGTP ases", + "Ġcellul ase", + "ĠT uc", + "ol ide", + "ĠA IM", + "pl ast", + "ĠB ible", + "op oly", + "ub o", + "ace an", + "ĠPen rose", + "ĠMap Reduce", + "ĠKw on", + "W all", + "Ġg cd", + "ĠAr bitrary", + "Pro duct", + "ĠGit Hub", + "F n", + "Ġc k", + "ĠA us", + "Ġgra ve", + "Ġmetabol ically", + "Ġlist en", + "Ġextrac tions", + "ĠTr unc", + "ĠRad iology", + "cons erving", + "ĠComposition al", + "report ing", + "s ustain", + "î Ģ", + "ĠO bl", + "Ġk N", + "St re", + "ĠSuper gravity", + "ĠPV P", + "Ġcivil ian", + "ĠTun nel", + "Ġhelic opter", + "ĠCamb rian", + "Ġr g", + "ĠU PF", + "Ġpol yd", + "Ġobserv ability", + "con tainer", + "nit ros", + "ĠCut ting", + "Ġdeco uple", + "Ġcarbox y", + "c row", + "Ġc x", + "ĠK ell", + "Ġproject ors", + "Ġmyocardi tis", + "itone um", + "condition ing", + "ĠE TH", + "oy ama", + "Ġphosph ates", + "ĠSub jective", + "ĠSer re", + "Ġcollagen ase", + "Ġvibr ating", + "strept omycin", + "z hen", + "Ġc res", + "Ġc ull", + "Ġh aven", + "ĠG PL", + "less ness", + "Ġview points", + ",, ,", + "ochrom ic", + "uy ama", + "Ġpartnership s", + "L ICENSE", + "ĠS IFT", + "res ources", + "ĠG os", + "iv ac", + "Ġneuro genic", + "Ad j", + "Ġaqu ifers", + "ĠGly cos", + "ĠMatthe ws", + "ĠFrid ay", + "Ġp X", + "Ġan te", + "ĠF enton", + "ĠE ukary", + "ib al", + "ide ae", + "At tention", + "ĠPolymer ization", + "Ġflip ping", + "ĠMedi ates", + "Ġstation arity", + "Ġecho es", + "alid omide", + "Ġdeline ation", + "Ġn aval", + "ĠS omatic", + "Ġst ub", + "ĠB ever", + "ĠR iz", + "Ġres ummation", + "Ġass ault", + "Ġpre existing", + "Ġhyper methylation", + "Ġconserv ing", + "record ed", + "am n", + "Ġch ow", + "ĠK ill", + "ĠPro duced", + "Ġref s", + "ĠEn zymes", + "Ġdeep est", + "&& &", + "ĠFR P", + "Ġmil ieu", + "Ġirrig ated", + "ĠAn atomical", + "Ġdiss ect", + "ili ensis", + "raz olo", + "ĠProb able", + "sol ve", + "conf irmed", + "ohydro dynamic", + "l ibrary", + "ĠC iti", + "ĠP HA", + "its ky", + "Ġelect rone", + "na ive", + "Ġrib s", + "ĠPhot onic", + "Ġsubstanti a", + "ĠEST IM", + "Ġduoden um", + "ĠChag as", + "ĠSURVE Y", + "P ress", + "b ian", + " ¤", + "he i", + "ĠV AR", + "Ġcol ocalization", + "Ġpol yl", + "Ġdo ugh", + "Ġmicro controller", + "Ġinternal ized", + "Ġdischarg ing", + "ĠChlamyd omonas", + "or ad", + "it el", + "ĠW end", + "Ġlog its", + "Ġelectro cataly", + "ĠAm ar", + "Ġappreci ably", + "Ġneurotrans mitters", + "former ly", + "c ul", + "r ata", + "ĠB alk", + "ĠO sm", + "Ġsympt omatology", + "ĠFI ELD", + "ĠA Ps", + "Ġg ymn", + "ĠM MS", + "Ġref resh", + "ĠInd ices", + "Ġimplant able", + "sh uffle", + "ĠHe ath", + "Ġcr isp", + "Ġdiss ertation", + "ĠUl t", + "Des cription", + "ĠOrig inally", + "ĠF n", + "ĠF LOW", + "ub ility", + "Ġexam s", + "ĠSh or", + "ĠCd Te", + "psy cho", + "Ġdict ates", + "Ġparench ymal", + "ĠPret reatment", + "Ġrememb ered", + "Ġb ras", + "oti d", + "Ġrecomm ender", + "Ġfles h", + "p itch", + "in ist", + "Ġb title", + "Ġl c", + "ass igned", + "ĠAd visory", + "ĠGene va", + "weight ing", + "ĠAB TS", + "Ġhex agon", + "ovsk ite", + "ĠAPI s", + "Ġbol ometric", + "Ġmultif aceted", + "i ak", + "Ġt n", + "ĠB ibli", + "pro sy", + "ĠJ ama", + "Ġinf rastructures", + "ĠSh are", + "Ġintro gression", + "trans forms", + "Re port", + "ĠTR ANS", + "ĠEX P", + "ĠCB T", + "ĠUbiqu itin", + "ĠThick ness", + "p ub", + "t oxin", + "ĠF riction", + "ĠL AG", + "ma ils", + "ĠIm mediately", + "Ġweak est", + "ĠMR S", + "Ġcalcare ous", + "b ath", + "Ġc g", + "ur ational", + "ter o", + "ĠIn oue", + "Ġinstruct or", + "ac ceptor", + "ĠE volving", + "ĠL uther", + "Ġres igned", + "ĠCh ond", + "ER F", + "Ġselect or", + "Ġnewsp apers", + "G RA", + "S pe", + "V H", + "r A", + "ot ine", + "ĠF ACT", + "com position", + "rid ing", + "PC M", + "Ġmiddle ware", + "ĠGR P", + "Ph osph", + "ĠEP IC", + "spe ech", + "vor tex", + "ĠHers chel", + "am is", + "ot ube", + "ĠG omez", + "com yc", + "ĠPh yto", + "ĠCons erv", + "Ġcav a", + "arr hyth", + "ĠRestric ted", + "il icity", + "og ap", + "CT P", + "ĠLat ino", + "atten uated", + "m obility", + "an en", + "Ġn if", + "ĠV ideos", + "ĠSch ubert", + "Fe atures", + "oprop anol", + "ĠThird ly", + "at ula", + "ĠC emetery", + "enti st", + "Ġdel i", + "tri als", + "Ġgran ulation", + "TT G", + "Ġtele ost", + "mor ill", + "or se", + "otyp ically", + "ĠAb ility", + "Amin o", + "a queous", + "Ġp CO", + "ec on", + "ĠL ign", + "ess els", + "Ġform ulating", + "ĠTo o", + "ĠTrans lational", + "ours es", + "ubiqu it", + "stat istic", + "Ġburst ing", + "Ġestu aries", + "ĠNanoc om", + "Ġex ports", + "Ġà ª", + "cont aminated", + "Ġtub ing", + "Ġautom obile", + "Ġmiss ile", + "Ġhierarch ically", + "Ġrepair s", + "ĠImpro ves", + "ĠEFFECT S", + "Q Ds", + "ro z", + "ar ic", + "Ġpar sed", + "ĠBr ink", + "Ġprogress ing", + "Ġperm Neigh", + "A gg", + "Z X", + "s ink", + "Ġw ise", + "et ence", + "ĠI c", + "lo o", + "me ida", + "Ġpolar iton", + "ĠConn ections", + "Ġhall marks", + "Long rightarrow", + "Ġthe ater", + "es ar", + "Ġre imburs", + "Ġlog o", + "Ġexc reted", + "ĠNo isy", + "Ġleak s", + "ĠDa ph", + "Ġparagraph s", + "Ġlandsl ides", + "Ġprecl ude", + "Ġcoerc ivity", + "ĠBurkholder ia", + "ĠGó mez", + "p rice", + "The ory", + "sur gery", + "f name", + "f ailure", + "l iness", + "re fer", + "ri que", + "ĠD ogs", + "ĠE UV", + "ĠV apor", + "CS R", + "Big gl", + "Con straint", + "gra vitational", + "Ġcombinator ics", + "Ġartic ulated", + "ĠBax ter", + "ĠUltrason ic", + "L TE", + "l op", + "Ġinter atomic", + "int uitive", + "sim plex", + "Ġexperiment ed", + "organ izing", + "ĠOs aka", + "had ron", + "Ġdendrim ers", + "ĠElse vier", + "C IP", + "ĠB AP", + "ĠAl onso", + "art et", + "anti s", + "Ġextrac orporeal", + "Ġpow dered", + "ĠSet tings", + "et allic", + "ĠT EC", + "ĠA rena", + "Ġan od", + "ĠRe agents", + "lic enses", + "ĠRem ove", + "Ġpron unciation", + "thin space", + "ĠClin ically", + "g ative", + "Ġw age", + "ĠH ap", + "ĠG rac", + "ff t", + "Ġform ate", + "inf eld", + "ĠQu in", + "Ġglomer ul", + "W ay", + "Ġk ills", + "Ġtrans versely", + "vari ation", + "enn as", + "ĠPL L", + "Ġinstrument ed", + "ĠSpar k", + "Ġp illar", + "ĠC aval", + "ad ers", + "iss en", + "sc ene", + "other m", + "é es", + "Ġprac ticing", + "ĠBM SCs", + "ĠFernand ez", + "Ġbes ide", + "f ew", + "ĠC ru", + "Ġpro d", + "and ers", + "az oline", + "Ġleg islative", + "bal ances", + "UR L", + "Ġstere otactic", + "Ġtrib es", + "Ġá¹ ¼", + "ĠPAN I", + "adren o", + "got ten", + "c ranial", + "ĠM ick", + "ĠM MC", + "ad iazole", + "enti ation", + "ĠGl n", + "ĠHol stein", + "ĠExpl orer", + "Ġos se", + "arth y", + "ĠEV ALU", + "adrenal ine", + "J J", + "ĠC MA", + "ĠIn activation", + "AB S", + "ĠST Z", + "Con figuration", + "ĠOl factory", + "ĠSulf ur", + "symbol s", + "ĠA STM", + "di vergence", + "ĠO CR", + "med ical", + "Ġview er", + "Ġbomb ardment", + "f air", + "n ice", + "el berg", + "ĠG PT", + "ĠK ow", + "Ġphot osphere", + "Ġlab ile", + "ĠSh ang", + "Ġhom otopic", + "SV D", + "bec omes", + "Ġgon or", + "Ġdeuter on", + "Ġphylogen ies", + "ĠS AF", + "rap ment", + "ĠCH F", + "Pl an", + "ĠLeg al", + "ĠFred holm", + "Ġshar per", + "Ġnanor ib", + "ĠBuff alo", + "B MD", + "Ġl g", + "os up", + "ĠO PC", + "Ġend ophytic", + "AT R", + "ĠExpression s", + "ĠMus ical", + "Int roduction", + "ĠSL M", + "ç ois", + "ogly cos", + "agl ia", + "m ussen", + "form ans", + "Ġsub structures", + "ym pan", + "ha e", + "sh i", + "ĠInter pret", + "Ġcat abolic", + "Ġoccup ations", + "ĠBif urc", + "Hydro xy", + "ĠKau f", + "s leep", + "am as", + "ĠS f", + "ĠM BP", + "Ġnon alcoholic", + "Ġdisc ordant", + "Ġep igen", + "PR I", + "ĠRed shift", + "war n", + "Ġlap top", + "Ġabras ive", + "îĤ Ŀ", + "l h", + "ĠK nee", + "Ġsc rat", + "Ġpol oidal", + "ĠUn iv", + "omy osin", + "ĠAug mented", + "Ġtaxon om", + "Zr O", + "Ġphytochemical s", + "it en", + "ĠP atterson", + "th ym", + "di hydropy", + "Ġk y", + "ĠMeta zoa", + "ALL Y", + "Ġretin oblastoma", + "concaten ate", + "M ale", + "Ġo mission", + "ic her", + "ĠA zer", + "op p", + "ple asant", + "ning ham", + "Ġax ially", + "HD FS", + "Ġfic tional", + "Ï «", + "Ġn arc", + "Ġunder took", + "Ġmicro circ", + "ON LY", + "IV ER", + "ĠCy cles", + "Me as", + "ĠGriff in", + "ĠPli ocene", + "Ġp I", + "ĠA viation", + "ĠC ategorical", + "ĠN ils", + "Ġresid ency", + "ĠLa ur", + "Ġpref ers", + "Ġassert Equals", + "Ġliqu or", + "d M", + "os perm", + "ĠF UT", + "Al O", + "Ġcyt ometer", + "Ġstabil izers", + "Ġprem ium", + "Ser ial", + "ĠWalk ing", + "íķ ľ", + "Ġconfron ted", + "encaps ulated", + "C ard", + "ĠS eeds", + "ab ular", + "uk ov", + "List ener", + "Cho ose", + "ĠSj ö", + "M ake", + "Ġis oc", + "am ount", + "AT C", + "ij a", + "Ġsul cus", + "ĠMö bius", + "ĠPren atal", + "Ġ ß", + "Ġis ochron", + "Ġbe ans", + "ĠD ens", + "ĠW elling", + "ĠO man", + "St ats", + "ĠVal id", + "ĠRew ard", + "G K", + "Ġâ ©", + "Ġelectro poration", + "ĠSNR s", + "Ġgar lic", + "ĠParticip ant", + "ĠSplit ting", + "ĠMeteor ological", + "morill onite", + "Ġo edema", + "ĠD ots", + "ĠCl are", + "Ġstar ter", + "Ġclim atology", + "Ġcomm ence", + "Ġfall en", + "ĠAu NPs", + "attr s", + "Ġconsult ant", + "tw isted", + "Sol ving", + "Ġcoerc ive", + "ë¡ ľ", + "K ar", + "Ġs tit", + "ĠS SB", + "ĠI W", + "Ġcan vas", + "py ruvate", + "methyl sulfanyl", + "Ġast rophysics", + "ĠTra ditionally", + "Ġexcit onic", + "w ear", + "ĠT in", + "ros h", + "ĠCl ient", + "ĠCor rections", + "ĠPop ular", + "ĠLiqu ids", + "f inder", + "Ġst ran", + "pl ine", + "ore lla", + "Ġinc ur", + "Ġar che", + "Ġmed ically", + "M ur", + "p eter", + "Ġbe verage", + "ĠN Ws", + "Ġfol ic", + "Ġspec ulative", + "Ġà ±", + "Ġrib bons", + "ĠPri est", + "Qu anti", + "Ġundist urbed", + "at che", + "ass i", + "ĠPer forming", + "ĠEl ong", + "Ġmatch ings", + "Ġfranch ise", + "g io", + "ĠS arg", + "Ġab oard", + "cycl odextrin", + "ĠTH ER", + "Ġsatur ate", + "ĠKin ematics", + "Ġpeptid oglycan", + "ĠShel f", + "toc opherol", + "B ottom", + "m ith", + "r dx", + "z os", + "Ġt RNAs", + "ut f", + "EN A", + "Ġless on", + "Ġpolar on", + "br aska", + "Ġath letic", + "Ġscram bled", + "Ġpursu ing", + "Ġbod ily", + "Ġc ac", + "im en", + "ĠI κB", + "ĠR ö", + "ĠR FC", + "ĠL PC", + "Ġi Ïī", + "Ġdi ary", + "Ġqueue ing", + "ĠDiver gence", + "ĠShig ella", + "ĠUltrast ruct", + "Ġtri phosphate", + "ĠIm plant", + "Ġfer rous", + "ĠBur ton", + "ĠHert z", + "f abric", + "t uring", + "ĠS SM", + "og rad", + "Ġmet azo", + "Ch ang", + "Ġadip ogenesis", + "Ġnu isance", + "Ġanonym ity", + "Ġrefriger ator", + "ì ľ", + "oc tion", + "Ġsp aring", + "Ġch alcogen", + "Ġobserv atory", + "Ġbo oster", + "ĠAnd ré", + "ĠST O", + "yr yl", + "ĠED X", + "ĠDen ver", + "Ġhomogen ate", + "Call back", + "a C", + "h ours", + "k ova", + "ĠA UD", + "Ġsp are", + "Ġpart ons", + "ĠInt ake", + "Ġrecogn izable", + "ĠGold stein", + "Ġstriking ly", + "Ġsan itation", + "F inder", + "G eneration", + "b oy", + "t am", + "ĠR PM", + "iv ious", + "yl ak", + "oph iles", + "Ġpri est", + "Ġeas iest", + "Ġdeliver ies", + "El mer", + "Ġzircon ium", + "ĠMish ra", + "Ġâ Ķ", + "ĠW DM", + "Ġper id", + "ĠZ T", + "Ġlocal izes", + "ĠOR s", + "ĠID O", + "Ġple asant", + "ĠMW CNTs", + "ĠJim my", + "ĠYe h", + "g athered", + "k il", + "ĠK appa", + "Ġcar toon", + "ĠHe uristic", + "Ġs z", + "Ġor ifice", + "Ġman nit", + "ĠCO MM", + "IC K", + "Ġfar mer", + "ĠSil encing", + "Ġprefix es", + "q c", + "ine urin", + "Ġinf lated", + "ĠRe z", + "Ġhydro dynamical", + "Ġoscill ate", + "Ġpedest rians", + "ĠAngi otensin", + "ĠVisc osity", + "Ġoligodend rocytes", + "Ġparo tid", + "Lay out", + "rageen an", + "Ġ è", + "Ġm N", + "Ġdo zen", + "ex clusion", + "Ġpan ic", + "ĠPD I", + "Ġtw entieth", + "ĠElect roph", + "Ġmicrobi ology", + "Ser ver", + "ĠParticip ation", + "D ET", + "P oss", + "ĠN emat", + "ĠN RF", + "arg uments", + "Ġam ylase", + "Ġarg v", + "Ġresol ves", + "Ġrevis ions", + "Pack et", + "T ools", + "Y E", + "Ġt ire", + "in duction", + "as ive", + "ton ic", + "é m", + "car rying", + "ĠImmun oblot", + "ĠIP F", + "Ġdeterior ated", + "Ġjuris diction", + "rele ased", + "osm otic", + "Ġrestaur ants", + "ï ¸", + "ĠN m", + "Ġfl ips", + "Ġsepar ability", + "ĠRec ursive", + "Ġpast ure", + "ĠÄ ī", + "Ġblast ocyst", + "M CP", + "T b", + "u ene", + "es ulf", + "ess im", + "Ġhe n", + "ĠK ull", + "yl um", + "are v", + "ues ts", + "ĠZ ip", + "Ġbo ats", + "Com mand", + "Cont inu", + "ĠBog oliubov", + "Ġmannit ol", + "K now", + "Ð ³", + "ĠH ack", + "Ġmass ively", + "ĠAll oys", + "ĠCD P", + "ĠStere o", + "ĠElectro de", + "Ġisofl av", + "Ġinteroper ability", + "ĠAdela ide", + "ĠP PD", + "ĠK ou", + "Ġdi ap", + "Ġcons erve", + "Ġaggreg ating", + "Gl uc", + "Ġî ģ", + "Ġg ust", + "ĠLe b", + "ET IC", + "ĠCons ol", + "ĠMor ita", + "Rel ative", + "Ġpale o", + "Ġwitness es", + "ĠLaure n", + "azep ine", + "ĠT Y", + "ĠI di", + "ĠM ent", + "ĠR CA", + "igen in", + "ĠDef ence", + "Ġpy rimidine", + "ĠTi N", + "Ġendot helin", + "Ġpand as", + "Ġswallow ing", + "Ġconges tive", + "Ġv inc", + "ĠD IP", + "ĠH ough", + "Ġz w", + "ĠKim ura", + "represent ations", + "ĠProm ote", + "ĠTer ry", + "Ġhat ched", + "look up", + "Elect ron", + "Ġdorm ancy", + "Ġres ign", + "Ġval uations", + "Ġmake up", + "ĠAm y", + "CL UD", + "SE P", + "tub ule", + "Ġsoldi er", + "ĠT z", + "ĠT rump", + "ĠK ramer", + "con i", + "Ġeng raft", + "Ġvacu ole", + "Ġreplic ating", + "iton itis", + "ĠBacter i", + "vacc inated", + "ol t", + "ĠA hn", + "Ġan em", + "ĠB IT", + "ge o", + "Ġmicro gravity", + "ĠSh ir", + "ĠWorld wide", + "Ġign or", + "ĠË ĩ", + "Ġlubric ation", + "j ava", + "v t", + "Ġ yl", + "Ġh ills", + "ĠF OL", + "Ġbasal tic", + "Ne ill", + "ĠEthiop ian", + "ĠNOT CH", + "ĠMOS FET", + "le aving", + "ĠP ter", + "ĠW eld", + "ap le", + "Ġsand wic", + "Ġaz ide", + "ĠStim uli", + "Ġl izard", + "ĠC inc", + "ĠH ain", + "ical s", + "Ġcontact ing", + "ĠMar x", + "Ġpsych otherapy", + "ĠRet in", + "Ġcatheter ization", + "ĠNanopar ticle", + "ĠT CC", + "ver mectin", + "ĠB ASE", + "Ġnot or", + "Ġelectron ically", + "ster oid", + "Ġbil aterally", + "Ġneph ritis", + "Ġirr itation", + "ĠProlong ed", + "Y our", + "he uristic", + "ur geon", + "Ġleft most", + "ĠRE VIEW", + "Ġgast rectomy", + "ENT IAL", + "Me ans", + "ĠDys on", + "Ġbrand s", + "yield s", + "mercap to", + "r ub", + "oun cement", + "err no", + "Ġview ers", + "but an", + "ĠMal ay", + "ylind rical", + "Ġpromin ently", + "Ġescap ing", + "Ġquer ying", + "Stor age", + "F os", + "c odec", + "Ġc M", + "str ates", + "gl ove", + "ĠTra jectories", + "Ġster ol", + "Ġhemat opoiesis", + "Ġcup rates", + "O k", + "d aily", + "ĠB IO", + "ĠL ICENSE", + "ell ations", + "ass y", + "SU RE", + "Ġep inephrine", + "Ġdown wards", + "cor ner", + "assert True", + "ĠẠij", + "ĠSou za", + "M AG", + "por ph", + "Ġeff luents", + "lo em", + "oad dition", + "obut yl", + "eles tial", + "F em", + "m pi", + "ĠR s", + "ell ates", + "ĠK ag", + "Ġunc oupled", + "Ġleg umes", + "Ġomit ting", + "à »", + "ĠT ABLE", + "hal ed", + "ĠÅ ģ", + "Ġmis fit", + "Ġmol ars", + "otechn ological", + "Mark ov", + "Ġpra ised", + "ĠD ab", + "ĠV ij", + "enti lation", + "ĠCh atter", + "Ġbo iled", + "Ġcat ches", + "annot ation", + "Sign al", + "Ġlever ages", + "Ġadvis ory", + "s ong", + "on dition", + "Ġf ug", + "ra ps", + "ĠM CD", + "par ticip", + "ob ian", + "Ġcoun sel", + "ĠPR P", + "edi ol", + "ĠÅ ¨", + "Ġbr uce", + "Sh anghai", + "Data Frame", + "ĠCorrespond ingly", + "Ġacryl amide", + "f ellow", + "l ob", + "ig t", + "ĠC rystallization", + "Ġind omethacin", + "ĠPD R", + "gi ate", + "ĠPan els", + "complex es", + "ĠNic ol", + "Ġfoli ar", + "c ubic", + "Ġd E", + "ĠC CM", + "pl ating", + "Ġres istors", + "ĠG az", + "Ġover turn", + "Ġrep ress", + "Ġpot s", + "ĠPI K", + "Ġderm is", + "Rep resent", + "ĠAnders son", + "Ġretrotrans pos", + "A SA", + "C ounter", + "T et", + "im in", + "per formed", + "ĠN ept", + "Ġhe el", + "rol d", + "ai res", + "Ġread ability", + "Ġbenef ited", + "Ġpuls ation", + "ĠBal ancing", + "Ġevapor ator", + "Ġeig ens", + "ĠH ospit", + "Ġtra ils", + "ĠCo ordinate", + "acc ase", + "ĠHR MS", + "sign aling", + "ĠNP Y", + "Ġamelior ated", + "tu ples", + "Ġmetas urface", + "ĠFrances co", + "Ġspo of", + "îĹ ¸", + "F u", + "J K", + "e j", + "Ġg oss", + "ĠH im", + "Ġprior itized", + "Ġmes othelioma", + "idx s", + "Ġrecon naissance", + "Ġlam ps", + "ãĢ Ĥ", + "Ġreform ulation", + "Ġdeli rium", + "ĠN PR", + "ĠG amb", + "ill as", + "---- -", + "Ġdr illed", + "ĠGen otyping", + "ĠBl ank", + "Ġprop eller", + "Ġcere als", + "ĠAir borne", + "ĠPhot ocatalytic", + "ĠCav ity", + "Ġdol phins", + "Ġsg RNA", + "underst ood", + "e ous", + "Ġs ax", + "ol ayer", + "ĠP end", + "ĠG ET", + "cl ed", + "Ġà ¼", + "Ġcyt osine", + "Ġparallel ization", + "MM s", + "ĠOrgan isation", + "Mod els", + "Ġaccommod ated", + "Ġchol est", + "Ġin activity", + "ĠB oss", + "ĠG CS", + "Ġso aked", + "ĠSec reted", + "Ġvacu olar", + "zo an", + "ĠGre ene", + "Ġbol t", + "b j", + "ĠT all", + "Ġst or", + "ĠM ob", + "Ġbl urred", + "IN O", + "ĠMet allic", + "uff s", + "ĠNOT E", + "Ġsonic ated", + "obuty ric", + "Ġt DCS", + "ĠN es", + "osp ir", + "we igh", + "ĠReg ulator", + "Ġhem olysis", + "Ġsound ing", + "Ġcruc iate", + "Ġcaps aicin", + "ĠTy rosine", + "ĠT ell", + "ĠP EP", + "ĠR c", + "ĠE ating", + "ĠGo als", + "ure t", + "Ġear n", + "Ġcolle ges", + "Ġchemo attract", + "Ġá» ¹", + "ĠEch ocardi", + "F ort", + "s odium", + "am ined", + "ĠN PP", + "ĠK alu", + "Ġdec ipher", + "tet ramethyl", + "ĠOP N", + "stra ight", + "Ġtemp ered", + "ĠHind u", + "ĠOrd inary", + "ĠACh E", + "J NK", + "f os", + "v cpu", + "en amide", + "ĠC rack", + "ap ical", + "Ġanti serum", + "tri plet", + "dec ision", + "Ġcanc els", + "ĠPM N", + "Ġporph y", + "ĠD SA", + "Ġsub matrix", + "Ġj as", + "Ġrep tiles", + "ĠSo on", + "ĠStat istically", + "Ġlever aged", + "Willi ams", + "F LD", + "f olk", + "Ġb ang", + "ĠS CL", + "ass es", + "Ġtend ons", + "found ed", + "ĠRick etts", + "in set", + "Ġsp un", + "Ġun ramified", + "Ġra pe", + "ĠZ Z", + "ĠNe bula", + "Ġthromb otic", + "ĠBor on", + "ĠArg on", + "pool ing", + "ĠMarg inal", + "Ġfellow ship", + "Ġerythrop oietin", + "mathp zc", + "x L", + "ĠS ik", + "ĠB ayer", + "Ġover dose", + "ĠCO I", + "ĠLes ions", + "ĠCompe titive", + "ĠODE s", + "w rap", + "ach lor", + "Ġsub ordinate", + "ĠY Ba", + "head ed", + "Ġgrass es", + "Ġbir ational", + "ĠJeff rey", + "Ġmold ing", + "Ġlid ocaine", + "ĠFOX O", + "termin ated", + "ĠâĩIJ âĩĴ", + "ĠM EL", + "tic ulum", + "Ġr é", + "Ġcl aud", + "Ġj amming", + "St atic", + "Ġtribut ary", + "at et", + "ed onia", + "ĠC MP", + "ĠV N", + "rep resents", + "SO URCE", + "uck land", + "ĠInterest s", + "ĠNan oscale", + "ocon jug", + "Ġcatalog ues", + "ĠActin obacteria", + "F ixed", + "b asal", + "Ġanti parallel", + "Ġconf using", + "Ġmark ings", + "Ġdistinc tions", + "ĠHu a", + "ĠWat ts", + "Ġnanoflu id", + "Ġdiffract ometer", + "L ater", + "m igration", + "Ġco planar", + "Ġhyp omethyl", + "PD S", + "SO s", + "Cor respond", + "Ġelucid ating", + "IZ ED", + "E Vs", + "g art", + "m Tc", + "ĠT UR", + "ur acies", + "Ġfollow er", + "Ġhaz e", + "OU TPUT", + "ĠMyel oid", + "BUFF ER", + "C amp", + "an im", + "ĠT ES", + "ĠC ricket", + "ĠP aired", + "ĠP AGE", + "ĠB id", + "Ġy rs", + "Ġend ow", + "irc ase", + "ĠSup ported", + "Ġleaf let", + "ĠProm oter", + "Ġconvinc ed", + "l iers", + "he ra", + "Ġs eller", + "ag reement", + "Ġun ary", + "onstr ucted", + "Ġrest rained", + "ĠPet ersen", + "Anal og", + "Ġexacerb ations", + "Ġperfor ated", + "ti ds", + "ĠM SH", + "ou i", + "ĠCor i", + "ĠCr uc", + "Ġfract uring", + "Ġinfer tile", + "ĠPRO BLEM", + "ĠFried mann", + "Ġspectrophot ometry", + "ERG Y", + "ot us", + "pro posed", + "ĠMo isture", + "ĠNo ether", + "ĠLa unch", + "ĠLear n", + "Ġven a", + "Ġfasc i", + "Ġquies cence", + "ĠP rand", + "ĠCon vert", + "Ġtri age", + "AN E", + "Ġfeed stock", + "ĠdB m", + "Ġneo formans", + "G SE", + "ĠA PE", + "Ġcardi ometabolic", + "Ġmagnet ometer", + "En vironment", + "Ġfulf ills", + "ĠMang anese", + "B MP", + "ĠR atios", + "ist able", + "ass ume", + "Ġresp ected", + "Ġsc ars", + "Ġsup porters", + "ĠAug mentation", + "Ġglycos ylated", + "ĠUltra fast", + "Ġdemethyl ation", + "metast atic", + "c ylinder", + "Ġh ang", + "ĠM AV", + "dis joint", + "pha rose", + "ĠLe banon", + "PI s", + "lab eling", + "Ġneutral ino", + "ĠSO CS", + "xc b", + "ĠTerr itory", + "ĠPolic ies", + "K ing", + "Ġall ied", + "Ġsatur ates", + "mus cle", + "odim ers", + "Ġb t", + "ĠH ang", + "ĠE b", + "Ġch imer", + "Ġnot ational", + "Ġcol der", + "ult z", + "trans verse", + "HO UT", + "ĠKar ls", + "tors ion", + "J I", + "Ġm ari", + "em on", + "Ġlogarithm ically", + "ĠâIJ ¦", + "ìĿ Ħ", + "Ġa eration", + "Ġs oma", + "ĠS omal", + "Ġsp oil", + "di ver", + "Ġbreak points", + "ĠHar mon", + "Ġpharmac ologic", + "ĠM osquito", + "ĠMod ifications", + "Ġadj o", + "ĠPa pers", + "gener ally", + "ïĺ ¹", + "T ARGET", + "ĠP rix", + "oc aps", + "ĠE in", + "Ġmicro grid", + "ĠInter play", + "Ġcop ying", + "Al pha", + "ĠSl ope", + "ĠLip ofectamine", + "hig hest", + "D RO", + "ĠH ipp", + "Ġsh aken", + "Ġunder line", + "Ġfil med", + "mat urity", + "ict ure", + "IL S", + "Sp an", + "Ġinver ters", + "QU E", + "determ ining", + "Ġeosin ophilic", + "D Y", + "ĠL ID", + "ĠG ig", + "Ġintra epithelial", + "Nb O", + "fre edom", + "Ġass ured", + "ĠAr che", + "ĠSub stitution", + "ĠSri vastava", + "ĠMoz amb", + "Ġa ro", + "or c", + "ĠI brahim", + "ĠD ST", + "Ġab l", + "Ġx er", + "ount able", + "Ġloss less", + "Ġconcentr ating", + "Ġstain s", + "ĠSol ve", + "continu ity", + "ĠTor r", + "Ġpit falls", + "best os", + "Other wise", + "adhy ay", + "b ard", + "ĠC AA", + "ode tic", + "Ġast hmatic", + "Ġrational ity", + "ĠYork shire", + "neighbor hood", + "Ġhero in", + "Ġscatt erers", + "ĠH earing", + "ĠE FT", + "ĠN urses", + "ĠG LI", + "ĠZ eta", + "ĠNe igh", + "Ġvent ure", + "Ġtoxic ological", + "Ġroll s", + "f v", + "Ġc rick", + "Ġd Ïī", + "av ia", + "eld er", + "Ġinv ade", + "ext racted", + "ML P", + "ĠPA I", + "ĠMell itus", + "Ġbruce i", + "g pio", + "em otional", + "ĠD ale", + "ĠE z", + "Ġtrans activation", + "Ġquanti les", + "Ġnucle osynthesis", + "ĠAm el", + "Ġchrom ophore", + "Ġliter ally", + "band width", + "ato hepatitis", + "Ġultraf iltration", + "Mart in", + "Ġangio plasty", + "inser tion", + "D an", + "s queeze", + "us r", + "uc onazole", + "ĠF AR", + "Ġsh adows", + "Ġim itation", + "ĠK ann", + "hes i", + "Ġmic ellar", + "ves ter", + "ĠPer se", + "acet amol", + "GR APH", + "ĠAI PS", + "Ġprompt ly", + "anch or", + "Ġischa emia", + "p ump", + "Ġm afic", + "Ġl azy", + "ĠC EL", + "ĠG orenstein", + "ĠW GS", + "Ġsign ifies", + "Ġspl ines", + "determ ination", + "Ġrelay ing", + "piper azine", + "Ġsyncy tial", + "ĠA ub", + "ĠD X", + "Ġorth otopic", + "ĠLink age", + "Ġharmon y", + "ĠKaz akh", + "ĠVlad imir", + "Ġp ray", + "im olar", + "Ġgra yscale", + "Ġanaly st", + "ĠTrans l", + "Ġmen iscus", + "ĠMed ica", + "osa urus", + "ĠÐ ²", + "Ġinfiltr ated", + "Ġâĸ ³", + "Ġsacc ades", + "Ġdisent angle", + "H art", + "f ined", + "Ġb icycle", + "os itory", + "un likely", + "ere phthal", + "ĠL ia", + "Ġgroup ings", + "Ġcategor ize", + "Ġbioge ography", + "ĠAPPRO ACH", + "ĠN ing", + "ĠG rap", + "vers a", + "Ġradi ologists", + "ĠRec ording", + "Ġbo iler", + "add ers", + "C andid", + "M Q", + "Ġb w", + "ĠS ector", + "ĠH IT", + "ĠE SCC", + "ess ence", + "ore an", + "est yles", + "SU CCESS", + "ne in", + "ult ra", + "ram p", + "Th omas", + "ĠPre par", + "ĠInstit ut", + "Ġherb icide", + "ĠCha otic", + "Ġsph incter", + "Ġcompac tifications", + "C lear", + "Tr p", + "Dec oder", + "Ġsap phire", + "ĠIda ho", + "per sing", + "ch iral", + "ĠDis charge", + "According ly", + "ĠArth ritis", + "ĠJane iro", + "n j", + "ĠK d", + "Ġout lets", + "Ġsuscepti bilities", + "Ġdiver ged", + "Ġroll er", + "su fficient", + "clust ering", + "ĠTeh ran", + "Ġt b", + "bl ank", + "Ġdigit ally", + "Ġnecro tizing", + "F ALSE", + "Ġwh or", + "err als", + "ĠMo tivated", + "enz ae", + "ĠRef inement", + "Ġtick et", + "Ġprotr usions", + "ĠDonald son", + "ĠB eth", + "Ġsp uttered", + "Ġaut ocrine", + "cop ene", + "Ġcoll ar", + "Ġupper most", + "Ġoxygen ated", + "Int ro", + "âĨ IJ", + "ĠHip po", + "Ġd une", + "id ines", + "ĠH ä", + "Ġreg i", + "Ġno is", + "Ġphot odiode", + "ĠFe b", + "mut ated", + "ĠCF L", + "step ping", + "Se lection", + "ĠWeb ster", + "ĠHER A", + "indic ating", + "Ġtraine es", + "R ot", + "ĠF AK", + "ĠAs n", + "Ġfat s", + "fol iation", + "Ġartic ulation", + "Ġcus ps", + "ĠJenn ifer", + "Ġin timately", + "ĠP ing", + "so v", + "ox ious", + "hyd rate", + "ĠArch ives", + "Gon z", + "Ġ é", + "Ġch l", + "ĠO LS", + "cop h", + "Ġair line", + "Ġfo etal", + "ĠRoll ing", + "ĠGENER AL", + "O NAL", + "ag ons", + "ĠD orsal", + "Ġr itual", + "but yrate", + "ogl ut", + "Ġhex a", + "ĠSy ria", + "Ġont ogeny", + "ĠFB G", + "cover age", + "Ġtachy on", + "ĠPerman ent", + "l um", + "Ġs v", + "Ġo o", + "en ergetic", + "al titude", + "In c", + "ĠNe braska", + "ĠRE SP", + "Ġdys biosis", + "Ġmarket ed", + "oxic illin", + "ĠBroad cast", + "racycl o", + "ĠFif teen", + "ĠNar ayan", + "Ġlett uce", + "ore a", + "Ġinter cepts", + "Ġwork station", + "ĠPl ains", + "CC L", + "Ġorient able", + "ĠBo osting", + "ĠSO I", + "ĠCheck ing", + "ĠFIF O", + "Ġin sets", + "ĠS RT", + "Ġac rom", + "own er", + "MI X", + "ĠAr b", + "Ġfa eces", + "ĠCarl son", + "Ġperiv ascular", + "infiltr ating", + "Ì ħ", + "Ġm alle", + "oc ate", + "ĠB old", + "unc tive", + "ex cess", + "Ġlo osen", + "Ġprior itization", + "Ġannot ate", + "Ġgram mars", + "Ġb red", + "Ġex ocytosis", + "ĠD ahl", + "ath yroidism", + "vel i", + "Ġop ted", + "Ġsm oked", + "ĠPl ates", + "EM G", + "RO W", + "IF IC", + "OL S", + "oreg ulatory", + "Ġwhisk ers", + "secret ase", + "Ġexagger ated", + "ĠB ib", + "de formed", + "Ġz ur", + "rop ine", + "Ġpair ings", + "chrom osome", + "Ele ments", + "prior ity", + "Ġlyophil ized", + "ĠChaud h", + "W ilk", + "ĠC ation", + "ot ta", + "Ġnon convex", + "Ġdep olymer", + "MM ARY", + "Cont rolled", + "carbox y", + "Ġaugment ing", + "Ġappoint ments", + "Ġtravers ed", + "ĠF letcher", + "Ġexp iratory", + "Ġele phant", + "ĠBl ocks", + "ĠFlu ids", + "wall s", + "incre ased", + "propan amide", + "ĠAka ike", + "ĠC BM", + "ĠE cho", + "ad missible", + "Ġdis assembly", + "Ġar Xiv", + "ick e", + "LI ST", + "phen otype", + "ĠProv incial", + "leg end", + "P AS", + "r nn", + "s and", + "Ġb ariatric", + "ĠP ush", + "ĠAp oE", + "cap rolactone", + "model ing", + "ĠÅ µ", + "Ġsupercapac itors", + "or on", + "Ġp K", + "st rophy", + "ĠS uc", + "und a", + "te am", + "Ġit iner", + "Ġsw ell", + "ĠBio active", + "ĠIndic ators", + "ĠI FT", + "ĠD K", + "Ġcap it", + "sh apes", + "Ġtrac hea", + "delay ed", + "ĠGuang dong", + "L epid", + "T GA", + "h k", + "ol on", + "ogen in", + "ĠAc k", + "Ġlog ically", + "cont ributions", + "ĠCle avage", + "hur st", + "b dd", + "ST D", + "ĠF ut", + "te k", + "ĠIn her", + "Ġchem is", + "Ġbreak point", + "estim ates", + "ĠOtt oman", + "ĠNaf ion", + "WID TH", + "Ġs izable", + "ĠT su", + "emb olic", + "Ġright most", + "ĠCell ulose", + "iction aries", + "ĠMy coplasma", + "ĠBur gers", + "ĠKepler ian", + "U CTION", + "V B", + "Ġb cc", + "ra id", + "END IX", + "Ġsc oping", + "ĠPR I", + "ĠCd Se", + "ĠGre edy", + "ĠHam mer", + "ĠBacter oides", + "inform ative", + "Ġresemb led", + "yll ium", + "T wenty", + "Ġp ounds", + "Ġun polarized", + "Ġconfig ure", + "Ġtranscription ally", + "Ġmicros cale", + "ĠPut ting", + "Ġpyr rol", + "ĠLAS SO", + "f iltration", + "Ġt ech", + "per forming", + "Al ong", + "ĠCT LA", + "Ġauthor ization", + "UR AL", + "Ġleak y", + "Op tical", + "ĠReve al", + "ĠHUV ECs", + "W u", + "c ustom", + "di ble", + "Ġï£ ¦", + "CD Cl", + "Ġemph ys", + "Ne ut", + "coll agen", + "necess arily", + "ĠRoot s", + "P ose", + "T u", + "Ġcl ue", + "Ġperturb ing", + "ĠHel ium", + "ĠComb ustion", + "n itrogen", + "am plified", + "pro ve", + "ĠSo ils", + "normal ization", + "ĠCH OP", + "ĠMc Le", + "Ġstri kes", + "Ġcrop ped", + "ĠKu o", + "Ġvag al", + "Ġdin ucleotide", + "ĠIsa ac", + "ĠL OX", + "Ġdirection ality", + "Ġchem oradiotherapy", + "calc ulus", + "ĠMoh ammed", + "m apped", + "Ġre forms", + "Ġre ordering", + "ĠB m", + "ĠE SCs", + "ĠN UC", + "th aw", + "Ġnan oporous", + "Ġtrain able", + "ĠAT T", + "fe ats", + "OF DM", + "ĠSH P", + "ĠRich ter", + "Ġspray ed", + "ĠJeff erson", + "F OX", + "b h", + "ot te", + "Ġle iomy", + "osp ores", + "specific ity", + "ĠRef er", + "ĠHa as", + "M ove", + "M aterials", + "t ec", + "u tility", + "en tional", + "ĠM PP", + "ch ond", + "Ġse epage", + "Ġpe ach", + "ĠÎĶ t", + "embry onic", + "Y an", + "Ġlip osomal", + "ĠVal encia", + "ĠEnd o", + "ĠPA O", + "Ġdial ect", + "Ġchond rocyte", + "ĠMill imeter", + "ĠRegular ity", + "dest roy", + "ĠCond ensation", + "Bay es", + "abund ance", + "Ġd U", + "ĠS SI", + "ĠH AND", + "Ġcons ulted", + "Ġsup pliers", + "Ġdem o", + "reg istered", + "Ġmicros omal", + "Ġlam bs", + "respons iveness", + "D y", + "G AS", + "U ME", + "Ġa ero", + "Ġcal modulin", + "Ġcalc ined", + "Ġins ula", + "ĠMe i", + "ĠRE AL", + "Ġcontrac tible", + "ĠEss entially", + "Ġgam ing", + "Ġspill over", + "resid ues", + "â İ", + "ĠE MC", + "ĠSD E", + "ĠSer ine", + "eck i", + "ĠPrinc eton", + "ĠBACK GROUND", + "m asks", + "ĠL om", + "ff ield", + "ef itinib", + "Ġpat ents", + "ĠBe z", + "load s", + "Ġgon adal", + "Ġnitro cellulose", + "âĻ Ĥ", + "Ġth rown", + "Ġrec tification", + "min a", + "isc id", + "ĠBi obank", + "param agnetic", + "GS K", + "ĠDeriv ative", + "criter ion", + "ĠMonth ly", + "ë ¥", + "ĠS ichuan", + "Ġimmun ologic", + "Ġheter otic", + "ĠMc Cl", + "ĠSM ART", + "ĠBatter ies", + "Ġpremi ered", + "Ġcryopres ervation", + "N u", + "val ho", + "Ġfl otation", + "top ological", + "ĠNan jing", + "Ġju xt", + "ĠFed er", + "Ġprofound ly", + "c ad", + "i enced", + "ch uk", + "ĠIn g", + "ĠK SHV", + "amin obenz", + "ĉĉĉ ĠĠĠ", + "Ġmeta ph", + "ĠEpid emic", + "ĠAssoci ate", + "Ġsacc ade", + "Ġd awn", + "Ġre heating", + "Ġsp ell", + "frac tive", + "ĠTo olkit", + "Ġrecogn ise", + "path ogen", + "Ġophthal mic", + "Ġquer ied", + "t hens", + "ith ine", + "um ably", + "Ġstr ides", + "ha ul", + "Ġpass ion", + "Ġdys functions", + "By te", + "Ġca esarean", + "pre y", + "ĠHor se", + "ĠGAB AA", + "N atural", + "k os", + "in ators", + "od ings", + "AR RAY", + "Ġun ipotent", + "Ġelect romy", + "com part", + "Li u", + "encephal ic", + "ĠCOMP AR", + "Ġsymbion ts", + "ivac aine", + "O I", + "P VA", + "ĠN VIDIA", + "cal ibrated", + "Ġqu est", + "NA D", + "ĠX yl", + "Ġpharmac ist", + "direct ly", + "Ġquadrup le", + "ethan one", + "ĠBulg aria", + "Ġovip osition", + "r uns", + "Ġn ociceptive", + "Ġas exual", + "SU LT", + "Ġwould n", + "ĠInd ustries", + "abil izing", + "ĠComp ressive", + "CO OH", + "US H", + "ki ewicz", + "Ġign eous", + "Ġdisapp oint", + "ĠCK M", + "ĠDiagram s", + "ĠF lam", + "ĠG ould", + "Ġco enzyme", + "Ġpar an", + "Ġ ¶", + "Ġprogram mer", + "ĠTrans forming", + "Ġmus carinic", + "onucle otide", + "FI ELD", + "ĠFu ji", + "Ġnond ec", + "Ġblank et", + "Ġpredis posing", + "ĠTrig ger", + "Ġwel come", + "F amily", + "U INT", + "h fill", + "t vb", + "ĠB att", + "Ġun met", + "ĠAp o", + "oti ent", + "Ġfund us", + "ĠLear ned", + "Ġintr usions", + "Ġsolub ilization", + "fund amental", + "ĠSanti ago", + "Ġh pi", + "th row", + "ĠIn to", + "time out", + "Ġthick ened", + "ias m", + "Ġgravit ino", + "bran ched", + "V III", + "Ġo ch", + "Ġg ym", + "ĠK rylov", + "Ġcorrec tive", + "ĠInstit ution", + "Ġcrim es", + "ĠBacteroid etes", + "ĠE hr", + "Ġse ated", + "rol izumab", + "Ġfactor ized", + "rot ational", + "Ġadministr ators", + "âĭ Ĩ", + "ineral ization", + "l ining", + "â Ĺ", + "ur ai", + "ĠF AP", + "ĠF isheries", + "ĠE SO", + "tem per", + "Big gr", + "ĠAltern ating", + "t win", + "am atsu", + "Ġint rad", + "over flow", + "Ġcompar ability", + "Ġsyn optic", + "US B", + "db g", + "dem onstr", + "ĠAch ieving", + "Ġtect onics", + "ĠRand all", + "ĠPrep ared", + "Ġsublim ation", + "ĠB aj", + "Ġcl utch", + "Ġsub domain", + "Ġfl aws", + "inf lu", + "Ġwid ening", + "Ġmel ted", + "Ġadministr ator", + "Ġsubsidi ary", + "ĠP ricing", + "tic us", + "og i", + "ĠAl ign", + "ĠAD V", + "Ġvast ly", + "bench mark", + "Ġprioriti ze", + "R adi", + "ess ed", + "Ġsup rac", + "acc ard", + "Ġbiom imetic", + "ĠIr radiation", + "ĠALG OR", + "Ġpedig ree", + "ĠC MT", + "od ym", + "ĠV ig", + "ĠBi ochemistry", + "ĠAcc um", + "Ind ices", + "hard tii", + "ĠRal ph", + "Ġrumin ants", + "i T", + "on au", + "an er", + "pl anned", + "ever s", + "Ġret roviral", + "Ġquantif ier", + "ĠExt racting", + "Ġacet ylated", + "Or th", + "ĠSen ator", + "Ġnanos econd", + "Ġanticip ation", + "ĠECM O", + "Ġsemic irc", + "ĠCrypt osporidium", + "ĠT ARGET", + "Ġap ples", + "ef ield", + "Ġrem an", + "Ġser ovar", + "ĠTrans actions", + "trans itions", + "urs ions", + "ĠMel atonin", + "Ġcholecyst ectomy", + "ĠAntiv iral", + "h ous", + "Ġo tol", + "Ġm aj", + "Ġe clip", + "are l", + "AT IONAL", + "MI M", + "ĠCI mg", + "ĠEnd omet", + "ĠHay ashi", + "Ġchimpan zees", + "m bf", + "ĠI PV", + "act oring", + "out side", + "ne apolis", + "Ġdisc arding", + "num type", + "ĠRE ST", + "Ġflag ellar", + "ĠChand rase", + "hof er", + "Ġelectrocardi ogram", + "G b", + "m ock", + "o eb", + "ĠS MO", + "ĠM ord", + "ĠB oz", + "Ġmin ors", + "IN LINE", + "Ġtherm ogravimetric", + "ĠMel ting", + "ĠNS W", + "S ham", + "l otinib", + "Ġac quisitions", + "ta z", + "Ġdef aults", + "Ġoscill ates", + "ĠCap tion", + "Ġdisrup tive", + "Ġswe eping", + "ĠTool box", + "Ġureth ral", + "H BV", + "ĠR CS", + "Ġox ys", + "immun o", + "ht m", + "ofl avin", + "H IF", + "ĠS BA", + "ĠC PE", + "Ġwh ites", + "ĠRe actor", + "Ġpur p", + "Ġelectro catalytic", + "Ġnone x", + "Ġty phimurium", + "Ġeu rop", + "conc ave", + "macroph age", + "S ER", + "Ġl apse", + "Ġan atom", + "ĠR AC", + "ta x", + "Ġmin s", + "Ġsens u", + "ĠHe brew", + "Ġreal ism", + "ĠMicro glia", + "Ġserial ized", + "ĠHaz ard", + "Ġmetamorph osis", + "ĠI RA", + "Ġsm earing", + "Ġphot olysis", + "Ġchild birth", + "Ġsil enced", + "raw al", + "Ġquad rants", + "but anol", + "Ġstochastic ally", + "ĠCham bers", + "ĠNav arro", + "Ġproc urement", + "c ite", + "ĠS le", + "ĠH adoop", + "Ġdelay ing", + "At lantic", + "Sp ain", + "fal fa", + "od ialysis", + "yn ia", + "Ġplate aus", + "Ġmultim ode", + "RES ET", + "ĠRock y", + "ĠRodrig ues", + "f MRI", + "r int", + "ĠT AL", + "Ġspec ular", + "con struction", + "ĠAt hens", + "Ġcross link", + "Ġcount ably", + "Ġspread sheet", + "crib es", + "cons istently", + "Ġflood plain", + "E INVAL", + "M aca", + "Ġe i", + "Ġh itherto", + "Ġsem if", + "Ġcontin ual", + "ĠHom ology", + "Ġphotoc atalysts", + "is able", + "ĠH AT", + "Ġpoly hedra", + "ĠMay o", + "Ġlact ating", + "sam pler", + "Ġappl iances", + "T U", + "Ġc hess", + "ĠT ing", + "Ġinv itation", + "Ġdistrib uting", + "ash ima", + "Ġult ral", + "tre nd", + "Ġrelax ations", + "ĠHel en", + "Ġbed ding", + "Ġgland ular", + "Ġincrement ally", + "Ġconce al", + "claim ed", + "ĠEdd y", + "Ġm os", + "ĠT ube", + "ĠT oda", + "ra j", + "ĠM ü", + "ĠU ll", + "Ġun e", + "ber ine", + "Ġpolic ym", + "Ġscholar ly", + "Ġshore line", + "Ġald osterone", + "ĠBruc ella", + "T HE", + "RE AL", + "Ġex ome", + "ĠD AB", + "Ġext ras", + "Ġband ing", + "ĠSi emens", + "ĠBo ost", + "ĠSuper novae", + "ĠTrac ing", + "Ġascorb ate", + "Ital y", + "b und", + "Ġdecre ment", + "Ġneu rophysiological", + "Ġblack body", + "ĠMc N", + "Ġcompet encies", + "osc ape", + "ĠHon ours", + "Ġmas titis", + "criter ia", + "Ġb iaxial", + "Ġth awed", + "ĠF oll", + "ore ceptor", + "Ġinv ention", + "AD s", + "Sh ow", + "-------------------------------- ----------------", + "Ġellipso idal", + "Ġfoc ussed", + "ĠD at", + "ĠR im", + "ĠL X", + "ĠG ER", + "ins ler", + "Ġtop oisomerase", + "Ġhyper lipidemia", + "Ġmy stery", + "Ġnit rification", + "Ġonc ogenes", + "ĠFull er", + "ĠBart lett", + "Ġamphib ians", + "S ST", + "b ly", + "le ads", + "ec ycle", + "am pl", + "ĠP OM", + "ĠD CF", + "str ass", + "anti body", + "non linear", + "ĠBroad way", + "ĠCatal ogue", + "Ġμ A", + "Ġacet aminophen", + "Ġcrystall ites", + "ĠNan otubes", + "ĠAcknowledg ment", + "Ġmetam orphism", + "Ġtwin ning", + "ĠAzer bai", + "x A", + "CC C", + "ĠSol ids", + "pred s", + "ĠMont ana", + "WR ITE", + "R atio", + "Ġp unch", + "Ġr iding", + "Ġac ne", + "ĠU re", + "Ġcor r", + "ĠQ OL", + "Ġins ult", + "Ġdominant ly", + "Ġsubs amples", + "rew s", + "ĠPres ervation", + "ĠAff ine", + "methan one", + "Ġhedge hog", + "J H", + "Ġl ined", + "Ġst en", + "ĠD armstadt", + "ĠL asso", + "Ġde proton", + "Ġsh oes", + "Ġmo tives", + "Ġmic roscop", + "oph thora", + "Ġmac ron", + "Ġencour agement", + "acryl ic", + "ĠTensor Flow", + "W rapper", + "o ise", + "ay ak", + "Ġrep resses", + "Ġpr uned", + "ĠCl ar", + "ĠâĬ ²", + "ĠUnder lying", + "Im plemented", + "Ġswe at", + "Ġmeteor ites", + "Ġtwe ez", + "Ġpros ocial", + "Ġabras ion", + "h ail", + "Ġsh orth", + "ism atch", + "IN TR", + "ĠTr in", + "Ġphysic ists", + "ĠPE O", + "ĠMagn eto", + "ĠJacob son", + "ĠMMP s", + "ĠIntra venous", + "Ġneurotrans mission", + "ĠPneum onia", + "L ind", + "y re", + "Ġm aternity", + "ĠI ris", + "ri atal", + "ĠâĢ ļ", + "med etomidine", + "Ġtr iterpen", + "ĠMan uscript", + "ĠEnd oplasmic", + "ĠPot ter", + "Ġgerm inal", + "Ġphotos ystem", + "Gu ided", + "Ġguitar ist", + "ĠChile an", + "ĠSalv ador", + "É Ļ", + "Ġc elestial", + "om and", + "Ġn k", + "Ġv endors", + "ĠP INK", + "ĠIn organic", + "Ġmod erated", + "SU S", + "ĠJ oshi", + "ĠSt ata", + "ik es", + "oy e", + "ĠJohn ny", + "Le ica", + "Ġka on", + "ĠEquip ment", + "K im", + "g ado", + "t ures", + "Ġe lem", + "ĠA AC", + "ce a", + "od ality", + "Ġan iline", + "Ġex othermic", + "ĠG unn", + "ĠJ U", + "plic able", + "sc apes", + "typ ed", + "Ġinsp iratory", + "REG IST", + "ĠBry an", + "Ġanxi ous", + "ĠCarp enter", + "ĠPharmacokine tics", + "infer ior", + "F rag", + "Z Y", + "Ġo esophageal", + "ĠS uk", + "ĠP ron", + "ĠCD I", + "AG C", + "key words", + "sus ceptible", + "Germ any", + "M AS", + "i C", + "an mar", + "Ġex iting", + "ĠH ale", + "Ġr hamn", + "ind ustrial", + "Ġra ft", + "emb rolizumab", + "Ġdeploy ing", + "Ġsalic ylic", + "R n", + "Ġc ensor", + "Ġd X", + "Ġfor um", + "MS I", + "bl ad", + "Ġsqu ir", + "CP P", + "Ġgrap evine", + "ĠRA FT", + "Mon te", + "Ġmicrof lora", + "r cl", + "Ġdec ap", + "AN C", + "Ġbroad en", + "Ġfre ed", + "Ġsouth ward", + "ĠJac ques", + "Ġrequest ing", + "ĠAsp ect", + "araj an", + "F ailed", + "f printf", + "p ytest", + "Ê ¹", + "ĠC m", + "un til", + "ne iss", + "Ġmon os", + "osp inal", + "ols ky", + "cont rib", + "Con tainer", + "ĠVol unte", + "ĠAtt ributes", + "ĠTum our", + "Ġrein hardtii", + "Ġcentrom ere", + "ĠS ymph", + "ĠA o", + "ag ens", + "ple ted", + "ied er", + "Ġactiv ist", + "ĠAl meida", + "Ġdisturb ing", + "Ġreflex es", + "D SS", + "Ġfor wards", + "ron ym", + "ĠIntegr ity", + "WE EN", + "Ġôı¼ Į", + "Ġfaith fully", + "Ġperic ardial", + "Japan ese", + "ĠCEN P", + "K r", + "Ġdef ending", + "Ġz on", + "ins ensitive", + "Ġlab s", + "ĠCa M", + "ĠEu rop", + "ME A", + "B LAST", + "x N", + "al en", + "Ġcl k", + "line age", + "co ating", + "Ġtail oring", + "CON TR", + "Ġadren ergic", + "interp reted", + "N IH", + "am oeba", + "ĠC yr", + "Ġtri plicates", + "def ining", + "ĠLog an", + "tes y", + "ĠTw ist", + "ĠGram mar", + "ĠSustain ed", + "Ġan harmonic", + "Ġal ve", + "Ġr uler", + "Ġqu anta", + "Ġdirec ts", + "Ġoff loading", + "ĠGe ophysical", + "Re quire", + "Ġhepat oma", + "Ġfo o", + "ĠGeor ges", + "Ġb outs", + "ĠT AK", + "Ġanti diabetic", + "ĠRe ported", + "present ing", + "ĠLay ered", + "REN CE", + "Ġuve itis", + "b age", + "Ġf entanyl", + "ens emble", + "ĠO SCC", + "Ġmin ers", + "lo oking", + "ĠBe er", + "prec ipitation", + "ĠEnter prise", + "Ġseroton ergic", + "Ġsees aw", + "ĠAth letics", + "Ġhydroly tic", + "Ġtal ent", + "Ġdiscern ible", + "F IL", + "l ives", + "ĠS ales", + "ĠS Sc", + "ere nd", + "cl im", + "anti d", + "IN TS", + "Ġatten uating", + "Ġtw ists", + "Ġoxygen ase", + "rin i", + "Maca ulay", + "z m", + "ĠP OT", + "ĠM p", + "ĠH ey", + "ĠO VER", + "ill ion", + "Ġinv aluable", + "Ġanti platelet", + "Ġmut ans", + "Ġgrad uates", + "GR AM", + "isp heric", + "Ġincomp atibility", + "Ġcarboxyl ase", + "Ġbioc ontrol", + "ĠPhysic ochemical", + "ï Ļ", + "Ġl ae", + "ĠA ortic", + "ĠR acing", + "ĠE CD", + "iv ic", + "Ġelect romechanical", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "Ġste er", + "ĠOut side", + "Ġaden ocarcinomas", + "ĠKe ep", + "Ġcoc on", + "Ġmoder ating", + "Ġreform ulated", + "Ġfundament als", + "ĠTes la", + "ĠStir ling", + "or ated", + "op id", + "Ġpa rox", + "Ġtri valent", + "Ġexchange able", + "Ġdeb uted", + "V ery", + "re ements", + "ĠT omm", + "ĠC yn", + "ĠC atalysts", + "qu at", + "ĠF ER", + "ĠR um", + "Ġsc anners", + "ĠâĨĴ âĪŀ", + "otrop ical", + "Ġven ues", + "estim ator", + "Ġempt ying", + "G PP", + "V IR", + "Ġcom plicates", + "ĠN IS", + "ĠZ hen", + "ĠBl ues", + "Ġtext books", + "Ġsi xty", + "Ġether s", + "Ġfinanc ially", + "Ġm Health", + "ĠT ut", + "Ġl aryng", + "ĠG s", + "ĠW atch", + "Ġse v", + "Ġit al", + "ass ed", + "Ġà ·", + "ĠCons ent", + "Ġnut s", + "vit real", + "Ġmeta phase", + "Ġtit ania", + "Ġfo ils", + "Ġgal ectin", + "initial ize", + "Ġadvis or", + "Ġadminister ing", + "B ool", + "Ġc em", + "Ġre forming", + "Ġg n", + "ys h", + "Ġatt or", + "SC I", + "Ex c", + "bu ilder", + "Ġcer ium", + "Ġregist ries", + "ĠMatsum oto", + "Ġtempt ing", + "is ha", + "Ġre orientation", + "ĠM old", + "ĠR AGE", + "ys on", + "Ġun equiv", + "Ġrel ocation", + "Ġà ķ", + "ĠRe form", + "ĠRE QU", + "Ġcommens urate", + "catal og", + "ĠT PS", + "Ġl amb", + "Ġpre factor", + "arch y", + "Ġdop ants", + "dr v", + "ĠPAR AMET", + "sched ule", + "ochem ically", + "Ġe Health", + "un as", + "ĠP inus", + "ĠH SA", + "Ġinter relations", + "Ġdep ot", + "ĠPl atinum", + "Ġlif elong", + "Ġpersist ently", + "ĠParad ox", + "ĠConform ational", + "es ophag", + "ĠA AT", + "pl in", + "ĠF CN", + "ĠD t", + "op oside", + "Ġch al", + "Ġhal t", + "ĠDet ect", + "Ġdiscrim inated", + "ĠLag rangians", + "Ap pro", + "ĠÈ §", + "Ġimpuls ivity", + "B AT", + "C hemical", + "g ather", + "ĠU NC", + "int ron", + "ĠSim ulator", + "ĠGl a", + "TT T", + "ĠVol atile", + "Ġsubs id", + "ĠBroad casting", + "Ġstrept ozotocin", + "Ġf umar", + "ĠM PEG", + "Ġinflu enzae", + "sub jects", + "Ġappropri ateness", + "Ġarc min", + "Ġstrand ed", + "o ylation", + "ĠD EX", + "ov iral", + "ĠQu arter", + "col ytic", + "Ġfriend ship", + "H ES", + "l oxacin", + "Ġe re", + "ĠT rad", + "ur istics", + "ĠE CT", + "ĠE GCG", + "ĠL RP", + "ĠG AG", + "ĠIn P", + "Ġcont empor", + "Ġmic ror", + "ier strass", + "ĠElect rosp", + "need ed", + "atmosp here", + "n T", + "Ġband widths", + "Ġdivers ified", + "ĠAppro priate", + "rest ore", + "roc nem", + "ĠLag uerre", + "ĠSong s", + "ĠKalu za", + "ĠS ymmetries", + "ĠSch mitt", + "Ġbiom olecular", + "scale box", + "Ġintra hepatic", + "under standing", + "ĠABC G", + "Ġunderestim ates", + "ĠStream ing", + "Ġfic titious", + "oplasm osis", + "res ident", + "ĠB ary", + "ĠCom a", + "sc rip", + "Ġdeg ran", + "ĠCa MKII", + "ĠBal mer", + "ĠPlas m", + "Ġchel ating", + "ĠParad igm", + "Ġopp onents", + "E K", + "P in", + "Ġm sec", + "ad one", + "ach t", + "CC G", + "EC O", + "normal ize", + "ĠDesign s", + "Ġyellow ish", + "glut amyl", + "Ġdomestic ation", + "Ġmonoph yletic", + "d les", + "n ested", + "ĠG race", + "ĠStud ios", + "ĠDisc ussions", + "ophen oxy", + "Ġveter in", + "Ġendos ym", + "utting er", + "b atches", + "ĠF iji", + "ĠR NF", + "ous a", + "ĠK Y", + "Ġspect rograph", + "ER IC", + "ĠMy anmar", + "ĠConst raining", + "Ġecological ly", + "Ġfro st", + "arb oux", + "ĠFib onacci", + "Ġcancel ed", + "ĠISS N", + "R ect", + "an other", + "ĠM MA", + "OL O", + "ĠTr uth", + "Ġorth opaedic", + "Ġtravers ing", + "ischem ic", + "ĠMozamb ique", + "ĠM SR", + "ap ace", + "ĠTh read", + "olog ia", + "Ġcal m", + "methyl transferase", + "ĠÍ ª", + "Ġdro ve", + "Ġcommand ed", + "Ġf eline", + "ĠR ush", + "ĠL isa", + "Ġsuper space", + "arc y", + "ĠReg ulated", + "ĠRest ing", + "caus ing", + "psycho tics", + "q t", + "Ġt ulare", + "Ġrel ocated", + "Ġrep ell", + "Ġpred atory", + "pe ople", + "tra its", + "E uclidean", + "F DA", + "X RT", + "p C", + "p and", + "Ġ Æ", + "re ve", + "Ġb ids", + "Ġco usin", + "Ġsub domains", + "til b", + "é nez", + "linear ly", + "oprotein s", + "Ġcod ec", + "Ġcontrac eption", + "ĠCd k", + "Ġrail road", + "B ench", + "r ng", + "ĠD LA", + "enti le", + "ĠCO CO", + "ĠMat th", + "ĠOver l", + "ĠRout ine", + "Ġmultif ocal", + "Ġarte fact", + "Ġsculpt ure", + "c ies", + "m ate", + "Ġ Ø", + "ure k", + "ĠB end", + "ĠN athan", + "Ġde w", + "ym ia", + "az zi", + "ĠEr k", + "Ġgrad uation", + "Bound ary", + "G ra", + "Ġb fd", + "ĠS ert", + "Ġover shoot", + "ĠSe o", + "Ġsk learn", + "Ġconserv atively", + "pir acy", + "Ġla unching", + "X D", + "ar bitrary", + "per one", + "Ġsh ops", + "comp etitive", + "ĠPak istani", + "Ġcompetit or", + "b iotics", + "ra its", + "ĠN oble", + "Ġsub regions", + "ĠJ ump", + "roll er", + "tr is", + "Ġmac rol", + "ó s", + "ĠPen ic", + "Ġmicros omes", + "Ġimprec ise", + "Ġdownt own", + "Ġe QTL", + "if est", + "ĠM FI", + "Ġr arity", + "âĢĻ âĢĻ", + "Ġbel ts", + "Ġglycos yl", + "ĠNic olas", + "synt hesis", + "O h", + "h ierarch", + "p ps", + "an ets", + "ro ads", + "AT IC", + "MI MO", + "ĠCont ract", + "Le ib", + "opy rox", + "Ġinform ational", + "Syn onyms", + "chall enge", + "ĠProxim al", + "ĠCraw ford", + "Ġis opropyl", + "Ġsub families", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "Ġannot ators", + "Ġreconc ile", + "Ġparsim ony", + "Ġcasp ases", + "c ott", + "en vironments", + "Ġd rm", + "ĠP IL", + "ĠM ec", + "ĠIn fer", + "ĠSir t", + "S hell", + "ag ulants", + "se ismic", + "Ġsub urban", + "ĠX XX", + "iod es", + "Ġback propagation", + "tra ditional", + "Ġphotoc on", + "ĠMicrobi ology", + "Q T", + "ur idine", + "Ġch op", + "ĠTh é", + "Ġpre jud", + "Ġenc oders", + "col lected", + "rem ark", + "Ġsun spot", + "ĠPhen olic", + "Under standing", + "Ġreject ing", + "Ġrom antic", + "Ġcentim eters", + "Ġhalluc inations", + "H ome", + "c asted", + "Ġc w", + "ra i", + "ĠDis placement", + "PH Y", + "carb am", + "Ġxen on", + "Ġnarr atives", + "Ġdoll ar", + "Ġdyn asty", + "ì §", + "Ġin forming", + "ĠO CD", + "á k", + "Ġoverhead s", + "ju ana", + "ĠKra us", + "f x", + "k aya", + "Ġn id", + "ĠG rab", + "Ġinf lores", + "Ar c", + "======== ====", + "Ġcondens er", + "Ġnanoc ar", + "omm ens", + "Ġsatur ating", + "re ce", + "el if", + "ĠA LE", + "ĠB ub", + "ĠL af", + "and ran", + "Ġpo uch", + "rol ine", + "AC HE", + "CC D", + "Ġcool ant", + "Ġgrass lands", + "ĠSynchron ous", + "izz iness", + "Ġcet uximab", + "Ġdichotom ous", + "ro ch", + "ĠA uckland", + "ob esity", + "ik it", + "Ġoper ad", + "ĠOn set", + "Ġbefore hand", + "Ġunc omp", + "US ED", + "ubb ing", + "ĠSMB H", + "ĠExped ition", + "Ġh ib", + "ĠP PR", + "ĠN ED", + "ud io", + "ĠJ al", + "ĠAr p", + "ĠBe e", + "ĠVari eties", + "Com m", + "Ab out", + "ĠAtt achment", + "ODU LE", + "Calc ulate", + "T an", + "in ism", + "Ġa ra", + "Ġc abin", + "Ġcon nexin", + "Ġcom ets", + "ump tive", + "Ġdest abilization", + "ĠHol t", + "ruct ose", + "anish i", + "plastic ity", + "omyc osis", + "ovic ian", + "________ ________", + "r ar", + "Ġw ore", + "ud ine", + "ĠIn variance", + "Ġper itonitis", + "Ġmet rology", + "Ġclos es", + "Ġcolor less", + "No ise", + "DI O", + "ĠLif shitz", + "z ul", + "es tive", + "ĠM PA", + "ĠB ooth", + "ĠD oll", + "are ne", + "gen ess", + "Ġmolecular ly", + "ĠPer kin", + "Ġdos imetry", + "ĠSO FT", + "ĠPy Torch", + "Ġquar ters", + "ĠKu hn", + "Ġsplen ocytes", + "R W", + "c art", + "le b", + "Ġcon dom", + "ĠH oc", + "Ġext ents", + "Ġsl ug", + "ĠSup plementation", + "diff ic", + "ester ly", + "Y u", + "an tigens", + "Ġà Ĵ", + "Ch anges", + "Ġprop ylene", + "ĠPr ison", + "ĠAlgorithm ic", + "Ġtoler ances", + "Ad am", + "Ġester ase", + "Ġmil der", + "ĠConv ection", + "P TR", + "k pc", + "Ġex o", + "ĠF ah", + "ĠY FP", + "ĠCR M", + "Ġhepat otoxicity", + "Ġnic otinamide", + "Ġpatch y", + "depend s", + "Ġp B", + "Ġe el", + "Ġn v", + "ĠS es", + "ĠH Z", + "Ġim print", + "ep ileptic", + "fl uctuations", + "Ġformal ize", + "che v", + "Ġdip ping", + "ĠPy ramid", + "Ġhol o", + "ĠMT s", + "Ġlamin ates", + "Ġworm hole", + "L AP", + "h ape", + "Ġa k", + "Ġre als", + "Ġby stand", + "Ġinter leaved", + "Ġx z", + "ov y", + "Ġcop rime", + "ucl ides", + "Ġtrim ming", + "MIC AL", + "pyr role", + "I a", + "N LS", + "Q uality", + "t akes", + "z inc", + "ĠP ione", + "ĠE wing", + "ĠL CA", + "Ġà Ķ", + "ict us", + "Ġcoll im", + "Ġphyl ogenetically", + "ĠKe eping", + "ĠFa ith", + "bond s", + "ti ter", + "Ġsub categories", + "sh aded", + "Ġphot ospheric", + "ĠApp earance", + "ĠUnivers ities", + "Ġglomer uli", + "ĠPref rontal", + "Ġprivi lege", + "i H", + "u ya", + "ĠL CL", + "ĠIn GaAs", + "In spired", + "atal og", + "ĠPer ceptions", + "ĠNa HCO", + "Ġstream line", + "tra jectory", + "ĠMic rom", + "Ġbed side", + "ĠRom ero", + "Ġgaug ino", + "D EN", + "F a", + "O lymp", + "e al", + "u els", + "ic ylic", + "Ġg od", + "Ġat taining", + "Ġprot ests", + "Ġnow here", + "des orption", + "ĠHydro xy", + "ĠEr bB", + "ĠSP AR", + "Ġhind ers", + "heren kov", + "KERN EL", + "Ġs ect", + "ul ong", + "Ġpre processed", + "frac tional", + "oy age", + "Ġphosph atases", + "Ġcoast line", + "Ġh ref", + "ĠS utherland", + "ox one", + "Ġhom omorphic", + "D EM", + "Ġb ovis", + "ĠC BP", + "pl en", + "ĠB uc", + "ĠG ior", + "Ġcomp ost", + "ĠO racle", + "ĠSp here", + "ĠSch re", + "deriv atives", + "ly tes", + "ĠY o", + "Ġcycl ones", + "ĠMa ize", + "Ġunf air", + "Tem plate", + "Ġimpregn ation", + "Ġlapa roscopy", + "Ġh amiltonian", + "ign ore", + "Ġdis posable", + "ear ic", + "Ġelect oral", + "cc os", + "ĠSh h", + "Ġturb o", + "Ġintr usive", + "Ġpreced ence", + "annot ated", + "Ġdyst onia", + "F at", + "u ins", + "Ġs way", + "ar izing", + "ill en", + "Ġy i", + "Ġnorm ed", + "ĠÌ Ĥ", + "ĠExt r", + "ĠProte ome", + "Doc ument", + "ĠQUANT UM", + "ti ti", + "ĠC PC", + "ĠM iles", + "ĠB oc", + "ĠR TS", + "CT X", + "Ġsaf egu", + "ĠNorm ally", + "ĠÃľ ber", + "on ious", + "ĠS CE", + "Ġal falfa", + "ĠL ut", + "Ġco ut", + "Ġen large", + "ĠEn able", + "Ġvir ion", + "ĠSh allow", + "def initely", + "ĠCol in", + "ĠRet ention", + "Ġmimic ry", + "################################ ################################", + "NSC LC", + "Ġgrat itude", + "Ġt ending", + "ĠI DS", + "ere t", + "ric an", + "Ġx n", + "ĠY oo", + "Ġoptim ise", + "Ar row", + "ĠTransfer ase", + "PK C", + "ĠGuang zhou", + "r uc", + "y rid", + "is z", + "ĠF IX", + "ĠD atabases", + "ast ron", + "Ġplay back", + "Ġnarrow ly", + "Cor relation", + "ĠAff inity", + "Ġfunctor ial", + "Ġlect ins", + "Ġrup tured", + "Dis play", + "ĠSympt om", + "Ġequid istant", + "ĠRicc ati", + "ĠAchie vement", + "g rand", + "on ated", + "Ġd H", + "ĠF ID", + "ĠD ER", + "ĠCo A", + "Ġgas ification", + "ĠCON S", + "Ġaccompan ies", + "Ġimped e", + "Ġpreced e", + "Ġkit chen", + "prog ress", + "Ġw iring", + "le renes", + "ĠG ius", + "Ġtrans p", + "ret rie", + "ij er", + "aff er", + "Ġbirth day", + "ĠHal d", + "Ġmusc ulus", + "ĠTok en", + "ĠBow el", + "Ġskip ped", + "C ha", + "b v", + "ĠB low", + "Ġpre operatively", + "Ġgl ove", + "ĠLe ven", + "Ġmes op", + "ĠAux iliary", + "ensure math", + "j us", + "Å ©", + "Ġv oter", + "ĠH itch", + "pro xy", + "ĠK ut", + "Ġpo ems", + "ĠAn gl", + "cer a", + "Ġstar red", + "AG ES", + "Sc ience", + "Anal yses", + "Ġrefere es", + "Ġabrog ated", + "Ġdesal ination", + "ĠPrand tl", + "P it", + "Ġn atal", + "og ran", + "ys titis", + "Ġdes m", + "Ġcur ious", + "Ġdem on", + "uz zi", + "ochond rial", + "ĠTreat y", + "Track er", + "rhoe ae", + "L W", + "f urt", + "Ġo mp", + "is ational", + "Ġmem orial", + "ĠLat ency", + "ĠHyp ot", + "Ġglu ed", + "exact ly", + "Ġcontra ind", + "C ancer", + "Ġf fi", + "ĠN AA", + "ĠCh r", + "eg g", + "ĠMo tiv", + "Ġlay outs", + "Ġclim b", + "Ġappend icitis", + "CU DA", + "Ġphotop roduction", + "ĠS IP", + "Ġv eto", + "per in", + "ĠUn ity", + "by ear", + "Ġforward ed", + "ĠDom inant", + "hol z", + "ĠThor acic", + "DEF INE", + "Ġtyros inase", + "B ad", + "I NA", + "f uel", + "Ġg i", + "ĠV IS", + "ast olic", + "Ġox aliplatin", + "eff ector", + "ĉĉĉĉ Ġ", + "е ÑĢ", + "ĠBab y", + "Ġwash out", + "pit uitary", + "N GC", + "Ġd ns", + "ĠP oz", + "ĠU z", + "pos itron", + "ĠElect rons", + "Ġhem angi", + "ĠZn S", + "ĠTE MP", + "ĠExperiment ally", + "fluor ouracil", + "Ġlap arotomy", + "analy zer", + "ocortic oid", + "ĠIMP L", + "ĠDNN s", + "ĠFres nel", + "M ont", + "Ġt apes", + "ul omb", + "im pedance", + "ĠH ET", + "ath a", + "mod ulation", + "ĠCor tic", + "Ġâľ ĵ", + "ĠFair ness", + "ĠSti ff", + "Ġbutt ons", + "c ss", + "Ġand roid", + "el ast", + "ĠT eflon", + "ĠM BC", + "ĠJ T", + "Ġmulti layered", + "ĠRe e", + "uit ar", + "ĠPhil ips", + "ĠSk ip", + "doc toral", + "iy ama", + "ĠLead ership", + "ĠCris is", + "Ġdesens itization", + "v ous", + "ĠS PP", + "ĠP GA", + "ĠN ever", + "Ġdef eating", + "Ġfib romyalgia", + "ĠMR P", + "ĠAB CA", + "ĠLow e", + "Ġer oded", + "Ġaug ments", + "ĠBor is", + "Ġneph rectomy", + "ĠSher man", + "Ġrefrig eration", + "ĠHern ández", + "à ĺ", + "ĠT ors", + "ch us", + "ĠV arg", + "Ġro set", + "CL R", + "DE P", + "Str ong", + "Ġcin erea", + "ĠHein rich", + "R out", + "od us", + "ĠPh one", + "ĠPer l", + "Ġseason ally", + "hold ing", + "Ġencephal omyelitis", + "Ġfasc ia", + "Ġlitterm ates", + "ĠWIT HOUT", + "Ð ±", + "Ġal erts", + "ĠK oll", + "ĠU rs", + "elf and", + "ĠRNA P", + "Ġinvari ably", + "Ġscin tigraphy", + "ĠSebas tian", + "kines ia", + "C UR", + "in ants", + "Ġp ET", + "id ial", + "ĠU PLC", + "Ġsu is", + "Ġbas olateral", + "ĠMod ulates", + "orb ic", + "Im g", + "Ġparas itism", + "Ġlamin ate", + "oge ographic", + "ĠRib eiro", + "ĠGlut athione", + "ĠAber rant", + "Ġs clero", + "ĠD LS", + "ĠR uth", + "Ġrec ast", + "rec ated", + "ok ie", + "ĠPark s", + "Ġfoli ations", + "ĠDaw son", + "Ġtann ins", + "ĠAar on", + "p S", + "it ating", + "ĠI TC", + "ip ients", + "oh y", + "CC s", + "Ġeth anolic", + "cor hynchus", + "Ġorient ational", + "Ġhabit uation", + "Ġconvers ational", + "ĠVent ricular", + "Ġintercal ated", + "Ġphosphodies terase", + "ĠSeif ert", + "w k", + "al gesia", + "Ġst egan", + "ĠL us", + "oph antine", + "Ġcorrec ts", + "ĠOb ama", + "lat ency", + "Ġson ar", + "ORM AL", + "Ġseaw eed", + "ĠPow ers", + "ĠShap ley", + "L ore", + "Ġa wa", + "al ach", + "ĠF on", + "ens ate", + "Ġoptim a", + "IN F", + "Ġpoly genic", + "Ġmes oderm", + "Con ver", + "BR ID", + "ĠHel p", + "ĠRas mussen", + "Ġprokary otes", + "ĠEur asian", + "ĠPerme ability", + "Ġn au", + "ĠC lem", + "od ilation", + "ĠD iaz", + "iti ous", + "ĠCh ad", + "OR A", + "ĠSim ons", + "ĠDist ances", + "Ġast rometric", + "ĠCP Us", + "Ġthi oredoxin", + "perturb ation", + "Ġdendrim er", + "al gal", + "Ġc eliac", + "as z", + "ĠP PE", + "qu a", + "ĠB oll", + "ch r", + "Ġpre view", + "ĠPro jections", + "ĠAs ians", + "ĠInf erring", + "ĠNa ive", + "ĠHig gins", + "ĠLoc ated", + "cardi ac", + "ĠLars on", + "haz ard", + "ĠScienti sts", + "Ġp inn", + "EN CY", + "form e", + "chit ects", + "oflu orescent", + "ĠPor tal", + "Ġpup ae", + "interest ing", + "į Ģ", + "re act", + "at os", + "en in", + "ti o", + "ĠC app", + "ĠM au", + "ĠL SC", + "ĠV lasov", + "Ġsub sum", + "Ġdes erve", + "AS D", + "Rec e", + "Ġconson ant", + "Ġimpregn ated", + "Ġlignocell ulosic", + "Ġs ows", + "le ment", + "ĠT ier", + "ĠM EF", + "ĠH ugh", + "inc k", + "py razole", + "UL ATIONS", + "ĠAL I", + "ĠDr ift", + "Ġsolub ilized", + "Ġdraft ing", + "icycl ic", + "Ġredes ign", + "Ġdelib erate", + "Ġt apping", + "ĠT omas", + "ĠT unneling", + "ĠC BR", + "Ġan odes", + "ĠL SR", + "ĠN ath", + "ros ive", + "ĠHe idelberg", + "Ġcr ushing", + "ĠSh ore", + "Ġmal ondialdehyde", + "ĠMR D", + "ogl oss", + "nc ia", + "Ġgranul oma", + "Ġplain text", + "Ġarteri ovenous", + "Ġrifamp icin", + "Lepid optera", + "O ct", + "Ġl one", + "ĠAp pe", + "ĠInter mitt", + "comp ile", + "pot entials", + "ĠStandard ized", + "Ġventil atory", + "Ġhypercholesterolem ia", + "ĠEVALU ATION", + "k ed", + "x C", + "en os", + "Ġb authorbsnm", + "ĠR ost", + "math open", + "Ġcont ested", + "Ġro s", + "oth o", + "Ġem its", + "ero zo", + "Ġprop ranolol", + "Ġexacerb ate", + "Integr ating", + "ĠWars aw", + "Ñ ĩ", + "re fractory", + "ĠM ort", + "phosph onate", + "GL T", + "ĠChlor ide", + "ĠLU AD", + "ĠSQU ID", + "ĠOBSERV ATIONS", + "Ħ ĺ", + "ag les", + "ug er", + "Ġdiff using", + "yl ar", + "Ġanti p", + "ren ormal", + "Ġshe ared", + "ĠAnd r", + "ympt otics", + "ĠIdentif ied", + "Ġflex or", + "Li ouville", + "ĠCyt otoxic", + "L ock", + "d onald", + "ĠS HA", + "pro jected", + "plic ial", + "Ġbas ics", + "ĠCar valho", + "Ġheter ocyclic", + "Ġfluor ophore", + "ĠIntr igu", + "ĠAnne aling", + "G ln", + "H ispanic", + "Ġs aus", + "ĠT CS", + "ĠH AP", + "Ġy tt", + "Ġcons ulting", + "rec ts", + "Ġinf all", + "LE V", + "tri azole", + "Ġnarrow ed", + "Ġamph oteric", + "ĠSor ting", + "ĠMom ents", + "Ġarab in", + "Ġcocon ut", + "ĠIntrigu ingly", + "Ġp ushes", + "Ġm ec", + "ĠN air", + "Ġcol istin", + "ĠOb tained", + "df s", + "Ġcompet ency", + "W ORD", + "ĠA AS", + "ĠB NP", + "ĠH AS", + "ĠL un", + "ĠL nc", + "Ġhydro cephalus", + "Ġhom ological", + "Ġcarbon ic", + "ĠHi Seq", + "commun ity", + "Ġcephal ospor", + "Ġhos tile", + "prov ide", + "Ġskyrm ion", + "D AG", + "Ġc nt", + "Ġh ay", + "Ġorder ings", + "Ġfl ock", + "HE A", + "ĠNeu rom", + "Ġboost s", + "ĠCard inal", + "ĠBac helor", + "Ġdec ent", + "ĠY ak", + "Ġcalc d", + "ĠBo er", + "Ġtranscript omics", + "Ġrearrang ed", + "ĠPolym orphisms", + "ĠPras ad", + "oinositi de", + "b ars", + "Ġ ãģ", + "ĠS AA", + "Ġon ion", + "ag el", + "ĠH p", + "og rel", + "di visions", + "and an", + "ari as", + "Ġcol o", + "rag on", + "Ġsch izophren", + "âī ¡", + "Ġreplic ative", + "Ġdegener ated", + "Ġsteep est", + "Vol ume", + "I ENT", + "P ublic", + "T en", + "en berger", + "ĠC oun", + "ĠE pp", + "iz o", + "Ġcomplex ed", + "Ġfer roc", + "ken stein", + "ĠJer ry", + "Ġparadox ical", + "x g", + "ic er", + "os ol", + "Ġan nu", + "Ġan kyl", + "ch ung", + "enti ous", + "Ġpres he", + "ene tic", + "ĠHe aling", + "ĠPar abolic", + "Ġfig s", + "ĠKin ematic", + "Ġoblig ate", + "ĠLay out", + "Ġtelem edicine", + "ĠLenn ard", + "p ci", + "ar one", + "ĠZ ach", + "Ġprot otyping", + "ĠMet agen", + "IM AL", + "cons cious", + "Ġquadr ilateral", + "ĠUncertain ties", + "ĠPref ecture", + "G BM", + "r als", + "al us", + "Ġh opes", + "Ġcl icks", + "ĠJ D", + "lect ance", + "Ġpath ologists", + "uss els", + "tis one", + "CP T", + "Ġmis con", + "ĠNeuro de", + "Ġmutagen ic", + "ĠMultim edia", + "Orig inal", + "ĠDra ke", + "P WM", + "Ġp iles", + "st ant", + "AR A", + "ĠR ING", + "mod ifying", + "Ġast rocyt", + "ĠCy st", + "Ġleg ends", + "gluc uron", + "Ġincom pletely", + "ĠConf ed", + "ĠDL BCL", + "ĠPap ua", + "Ġcontras tive", + "ĠSIM ULATION", + "ĠJu venile", + "aggreg ated", + "Ġc GMP", + "ic tive", + "ĠH NF", + "ĠN PV", + "ĠK oc", + "omet allic", + "min i", + "ĠQu antit", + "ĠCor nell", + "Ġded uction", + "Ġcoinc iding", + "ĠIr r", + "Prec ision", + "Ġgins eng", + "õ es", + "j er", + "ĠRe ader", + "ĠBy r", + "cor rections", + "dev ices", + "Ġamb ul", + "Ġped icle", + "ĠDepend ency", + "ĠStri king", + "Ġware house", + "Ġrecirc ulation", + "Ġgonor rhoeae", + "ĠP RES", + "ĠB har", + "Ġfl ushing", + "tor us", + "ĠIR B", + "gly cine", + "Ġmeth amphetamine", + "Ġmir rored", + "ĠWilliam son", + "Ġcath odes", + "hydrox ylase", + "Rad io", + "Ġfurn iture", + "ĠRosen berg", + "ĠNSA IDs", + "s emiconductor", + "Ġas ynchron", + "ĠB erm", + "ĠIn ten", + "ib e", + "For ce", + "path ogenic", + "sm okers", + "Ġdip henyl", + "ĠÐ ¸", + "Ġstand alone", + "Ġlith ospheric", + "Ġtrade offs", + "Ġantic h", + "Ġthym idine", + "ĠMedic inal", + "Ġentrepreneur ial", + "Ġtrapez oidal", + "ĠAs ynchronous", + "tif ying", + "ĠColl apse", + "ĠHE V", + "ĠFro zen", + "ĠTeich müller", + "rocnem ius", + "Ġf ern", + "Ġw s", + "om ol", + "Ġen closing", + "rap id", + "Ġlog ged", + "var vec", + "Ġampl ifying", + "diff erences", + "oton in", + "ĠProm oting", + "ĠFr itz", + "Ġattain able", + "Ġal tim", + "ĠO GD", + "Ġtherm ometer", + "Sol ver", + "ĠBir k", + "LEN BQU", + "ĠGate way", + "Ġengraft ment", + "F IF", + "H SD", + "Ġre structuring", + "ĠT ensile", + "ĠC ele", + "yl us", + "Ġfe ather", + "Ġdr ifting", + "ĠPre clinical", + "yr role", + "Ġcomm em", + "Ġfix ations", + "Pet sc", + "ĠIschem ia", + "a A", + "as oro", + "ĠS ony", + "ĠU t", + "Ġext ensor", + "ĠCh au", + "ĠIs otopic", + "IL I", + "CN P", + "ĠDE F", + "Ġmountain ous", + "Ġsarcom as", + "ugos lav", + "C ALL", + "S ensitive", + "at ro", + "Ġunc oupling", + "sk ew", + "ĠEm issions", + "inn ati", + "Ġconceptual ization", + "Ġow ns", + "Ġsquad ron", + "ĠStreng ths", + "C oh", + "U AL", + "m agenta", + "us b", + "ĠS PC", + "con es", + "ĠSe lecting", + "ĠPar ish", + "Ġvalid ates", + "ĠÍ Ĺ", + "Ġposterior ly", + "omon ad", + "V OL", + "j ectivity", + "ĠC LO", + "ĠV TA", + "Ġun pleasant", + "Ġcare ers", + "Ġautom orphic", + "ĠNan ow", + "Ġaster isks", + "ĠSchul z", + "publ ication", + "Ġb iv", + "Ġr ug", + "rec ognition", + "Ġref errals", + "Ġneur ones", + "ĠCa ffe", + "Con nor", + "ĠShe ffield", + "unit inib", + "ĠAnt agon", + "Ġpneum atic", + "Ġclean er", + "ĠBA O", + "ĠScilab String", + "neigh bour", + "E uler", + "ĠT uple", + "ot y", + "di an", + "Ġy oga", + "Ġev anes", + "Ġstar ved", + "Ġfluct uate", + "ĠBiomark er", + "Ġimpuls es", + "Ġoss ification", + "Ġdemyel ination", + "ĠS AD", + "ess ing", + "Ġred dish", + "Ġsyn th", + "Ġcurv ilinear", + "ĠDen is", + "Ġphone tic", + "Ġham mer", + "Ġepiderm idis", + "Ġplagi oclase", + "Ġ ĉ", + "Ġw olf", + "os ced", + "Ġphot othermal", + "Ġche wing", + "Max imum", + "Ġmism atched", + "ĠFc γ", + "Ġum brella", + "ĠSiber ian", + "ar ra", + "ip ped", + "ym pathetic", + "acc eleration", + "Ġeigen modes", + "ĠEqu ivalently", + "ĠPR ISMA", + "cons ervative", + "ñ ez", + "Ġvolcano es", + "Ġtelem etry", + "m ile", + "ĠB och", + "op rim", + "Ġinc ipient", + "Ġunderstand able", + "atric yclo", + "ĠLog ical", + "ĠQue ue", + "Ġcry ostat", + "defin ecolor", + "ĠS ae", + "Ġar ct", + "Ġso ul", + "ĠHist opathological", + "ĠNeu rot", + "Ġmethan olic", + "P x", + "ĠT itle", + "ot omic", + "ĠE ld", + "ĠE MA", + "Ġde brid", + "tim ulatory", + "ĠZ an", + "Ġnorm ot", + "Ġfluid ity", + "Ġfluid ized", + "pre viously", + "Ġcrack ed", + "ĠExpl aining", + "ĠON E", + "ĠFlor a", + "ĠHybrid ization", + "Ġretic ul", + "F K", + "n otic", + "Ġn A", + "ĠP ab", + "tic um", + "and y", + "ug ia", + "ile t", + "MI NG", + "Ġrest s", + "omp act", + "Ġtrack ers", + "phosph atase", + "ĠTransf ection", + "ĠHospit als", + "ac rine", + "ĠD ell", + "ĠV AE", + "ĠThrough put", + "hev sky", + "ĠSom mer", + "P SA", + "ì ļ", + "Ġb ush", + "Ġl unch", + "ĠS we", + "ĠIn struction", + "ak ami", + "Ġdis infect", + "Ġcor ps", + "ĉĉ ĠĠ", + "Ġprom pts", + "MS H", + "ĠAg rawal", + "Ġlys osome", + "integr in", + "Ġá» ¸", + "Ġnondec reasing", + "ĠRe quest", + "ĠRE P", + "occ us", + "Ġlag rangian", + "oreg ulation", + "оР»", + "ĠBos on", + "I so", + "at ellites", + "res ectable", + "ri v", + "Ġde aminase", + "Ġco heren", + "Ġdec oy", + "ĠExt inction", + "acet one", + "Ġgovernment al", + "Ġcum ulants", + "Ġviscos ities", + "Reg ister", + "document ed", + "Ġimmortal ized", + "D PP", + "G el", + "b ron", + "k ow", + "ĠPro portion", + "ĠCh ase", + "ĠCl ad", + "Ġadap ts", + "ĠCA V", + "ĠÅ ¼", + "Ġpel leted", + "Ġpeng uin", + "ĠZhe jiang", + "feas ible", + "D IV", + "i ya", + "Ġth rowing", + "res ia", + "ĠN r", + "ES P", + "CD F", + "sup pressed", + "Ġtet rachlor", + "Ġaer ospace", + "Un til", + "Ġpay offs", + "Ġtown ship", + "Ġester ification", + "ĠAch illes", + "Ġrac em", + "opyran oside", + "ĠC SM", + "ass is", + "Ġsuper cell", + "ĠReg ime", + "IR A", + "Ġsubsequ ences", + "ĠPen et", + "ĠAnaly tics", + "ĠLV EF", + "Ġbip henyl", + "G radient", + "os ylation", + "ĠW RF", + "of s", + "con ductors", + "Ġback ed", + "pid al", + "ĠNF AT", + "ĠRem ember", + "Ġtel omeric", + "Ġta urine", + "incre ases", + "Ġunint ended", + "ĠNerv ous", + "R as", + "y lyl", + "Ġa estiv", + "ĠS ick", + "ĠThe ta", + "Ġcl iques", + "Ġso fter", + "ĠQ RS", + "llip tic", + "ĠImmun otherapy", + "QU F", + "onom ously", + "ĠFL U", + "ĠIncor poration", + "ĠFormic idae", + "J R", + "w hole", + "Ġc asing", + "Ġn ob", + "ĠD ou", + "Ġint ronic", + "Ġent rapment", + "orb its", + "Ġsal am", + "ĠCR S", + "ĠSw an", + "ĠEd gar", + "Ġconcomit antly", + "atet racyclo", + "ĠA HR", + "tic ks", + "ĠB ing", + "ĠR ift", + "Ġpl ugging", + "Ġsc RNA", + "Ġout reach", + "ins kii", + "Ġcustom ary", + "Ġm d", + "ĠO zone", + "uss ing", + "other s", + "Ġentire ty", + "Ar th", + "Ac et", + "ĠFle et", + "ĠBehaviour al", + "ĠQSO s", + "ar ina", + "Ġpro drug", + "ĠB ros", + "ĠW orth", + "Ġy z", + "con tig", + "ĠAm orphous", + "ĠEr lang", + "Ġhon our", + "ĠâIJ ¥", + "Ġinfiltr ates", + "ĠIvan ov", + "ĠMunic ipality", + "ĠDial ogue", + "t one", + "Ġp ytest", + "ic ulus", + "ĠG oth", + "ĠX C", + "ĠSU MMARY", + "Ġshr inks", + "Ġinvers es", + "i omas", + "ro bi", + "ĠT PR", + "ĠA NA", + "ist ries", + "Ġreg iment", + "ind o", + "ĠRe production", + "lo qu", + "inf lation", + "ET X", + "Ġïĺ »", + "ĠAPP ENDIX", + "Ġwors ened", + "Ġpsori atic", + "Ġmidw ives", + "Ġtouc hed", + "Ë ĩ", + "ĠP atric", + "ĠD ON", + "ĠL IM", + "ak os", + "ĠV ie", + "ĠAn tit", + "Ġfl ake", + "ĠSch le", + "ĠCor onal", + "Ġsal ary", + "sl ight", + "ĠCA F", + "Ġsummar ise", + "Ġflav us", + "ĠBal anced", + "ĠPH OT", + "Ġmil let", + "Ġurg ency", + "ĠGle ason", + "ĠM ie", + "ĠD p", + "ĠG arg", + "Ġle prosy", + "Ġun occupied", + "ĠSt ret", + "ile pt", + "ĠCh or", + "ibr ate", + "ĠÍ ļ", + "ĠPH B", + "Ġmonot er", + "ĠJava Script", + "bt n", + "ĠPuls ar", + "ĠKirch hoff", + "Ġoverse as", + "Ġde phosphorylation", + "ort in", + "ĠPoly akov", + "Ġinsight ful", + "ĠPur ified", + "Ġanch orage", + "ĠGly coprotein", + "stud ies", + "Ġchron ology", + "rox ine", + "ĠNept une", + "B an", + "Ġl ion", + "PS D", + "ĠBar r", + "Ġdon key", + "Ġlikelihood s", + "atche wan", + "ot et", + "os pha", + "tic ism", + "Ġr y", + "ast hen", + "rho tic", + "ĠSub group", + "ye v", + "ĠPat ri", + "provid es", + "S GD", + "b erell", + "v w", + "ĠA ACR", + "Ġsm ears", + "OD S", + "sup plemented", + "ĠEng agement", + "oglob ulins", + "Ġirregular ly", + "ĠSz eg", + "ĠWol ff", + "Ġenanti omers", + "Ġobey ing", + "Ġdestro ying", + "om ially", + "ĠA ti", + "ĠG AT", + "ĠIn variants", + "ĠSc oring", + "Ġhal ides", + "Ġtransform ants", + "Ġforest ed", + "Ġgall ic", + "ĠBet ti", + "thread ed", + "ĠBud get", + "junc tive", + "ĠInnov ative", + "Ġposit rons", + "B razil", + "e ira", + "Ġl avas", + "ĠL t", + "ph oto", + "Ġsp am", + "Ġi h", + "ust ering", + "Ġbi oluminescence", + "ĠSh apes", + "UL TI", + "tri angles", + "ĠSM N", + "enh ancing", + "ĠReduc es", + "ĠTHEO REM", + "D op", + "Ġd L", + "em ptive", + "Ġrem inder", + "Ġgon ads", + "Ġxyl an", + "cult ures", + "t les", + "Ġt d", + "Ġe rected", + "ter one", + "ĠPD C", + "Ġincongru ent", + "Ġmembran ous", + "p ac", + "yl ess", + "Ġsub algebras", + "ĠCh ir", + "ĠZ IP", + "au tious", + "Ġlight ly", + "ĠPhot ometric", + "Trans fer", + "Ġket o", + "Ġexerc ised", + "dispers ive", + "ĠBET WEEN", + "ro u", + "Ġg arbage", + "ĠM af", + "ĠD oming", + "ĠSub space", + "ĠMar ÃŃa", + "Ġtetra hedra", + "ĠBark er", + "S ide", + "b ishop", + "i D", + "re versible", + "orm an", + "ores cein", + "ĠCont rib", + "Ġderiv atization", + "rome res", + "ĠAL D", + "EE K", + "ĠTre ating", + "comb ination", + "ïĺ »", + "restric tion", + "supset eq", + "ĠRAP D", + "Ġamend ment", + "zyn ski", + "Ġc aves", + "il ot", + "Ġabund antly", + "н а", + "Ġinject able", + "ĠReinfor ced", + "ĠWid th", + "ĠHaem ophilus", + "il ane", + "pro ps", + "Ġinter vertebral", + "Ġsc roll", + "Ġam put", + "ĠUn usual", + "Ġstat ically", + "Ġsyn ergies", + "Ġdim s", + "plas mic", + "Ġneutral ized", + "Se lected", + "Ġinher its", + "ĠAutom ation", + "Ġproto planetary", + "Stat ement", + "ĠAPO BEC", + "Ġcertif icates", + "ĠCit rus", + "quadrup lex", + "N ord", + "Ġf ran", + "ĠC arcin", + "ut an", + "ĠP ump", + "ĠB av", + "ĠG ras", + "ting ales", + "Ġcaus ally", + "Ġrad on", + "Comp are", + "Ġclamp ing", + "irre ducible", + "I HC", + "Ġ Ù", + "Ġc yp", + "ĠT PP", + "ĠS uff", + "und ra", + "ĠV illa", + "Ġrel ieved", + "ĠJ CM", + "Ġtreat y", + "IG EN", + "ĠDev onian", + "Ġerythrop o", + "R AP", + "Ġa versive", + "ent ate", + "od actyl", + "ĠPar al", + "Ġmill ed", + "Ġbio informatic", + "okine tic", + "ĠSTR ING", + "ĠPed ersen", + "d atabase", + "in organic", + "Ġde put", + "Ġne b", + "ip ed", + "Ġdiff used", + "oth ione", + "Ġnon stationary", + "Ġunder taking", + "ĠEn abling", + "Ġden atured", + "Ġload er", + "ĠLy on", + "ipar ametric", + "Ġmer istem", + "ĠAngi ogenesis", + "ĠPuls ed", + "Ġex cer", + "ĠD f", + "arc hes", + "Ġcoll ide", + "ĠRel ational", + "ĠNF κB", + "Met adata", + "ĠAdd ressing", + "Ġperc ussion", + "ĠFlore nce", + "Ġnymph s", + "C n", + "st orm", + "ĠG raz", + "com posite", + "ĠAd miral", + "ĠSc otia", + "Ġbre msstrahlung", + "aps ack", + "Ġminim izers", + "Ġmanage able", + "Ġcarboxyl ate", + "Ġintermedi ary", + "ĠBran ching", + "sched uler", + "inoc ulated", + "ĠExtrem ely", + "Ġantenn ae", + "ĠT ill", + "RE SH", + "Ġop acities", + "Ġchem opre", + "Ġaden ylate", + "Ġcircumst ance", + "ĠHash imoto", + "Ä Ľ", + "ce ae", + "ĠF m", + "ĠB X", + "Ġmean time", + "acc urate", + "col linear", + "ACT IC", + "ĠSlov enia", + "F ed", + "K h", + "T m", + "f ork", + "in ology", + "le f", + "ĠD CS", + "Ġher itable", + "Ġann ouncement", + "Ġbusiness man", + "Ġbor tezomib", + "Ġtour ist", + "ĠEt ymology", + "Ġdoctr ine", + "B IN", + "s uffix", + "ar as", + "ĠS au", + "un boldmath", + "ĠM EP", + "ink er", + "Ġoptim ism", + "ĠLe uc", + "eful ness", + "cr ust", + "ĠKe ys", + "ĠâĻ ¦", + "ĠBrand t", + "âĮ ¬", + "ĠSevent y", + "Ġnurs ery", + "Ġdeput y", + "à ¬", + "on is", + "am us", + "ĠC ig", + "Ġex ergy", + "ĠF requent", + "Ġab or", + "ĠJ azz", + "Ġstat ue", + "ĠSc enarios", + "Ġcyt ological", + "fig ures", + "MC I", + "dir name", + "Ġcytokines is", + "del ivery", + "ĠBow en", + "Ġflank ed", + "Ġregener ating", + "ĠFerr ari", + "k iss", + "ĠA val", + "ĠC IT", + "ĠM um", + "ĠL SB", + "og ging", + "Ġun ited", + "Ġtri tium", + "ont amination", + "co ef", + "Ġprop ell", + "tri ple", + "Ġimm ense", + "Ġcompl ained", + "Ġdielectric s", + "ĠCardi omy", + "Ġflood ed", + "ĠCov ariance", + "Att endance", + "T MP", + "Ġs ob", + "ĠS onic", + "ĠF TS", + "ĠR SD", + "ess ors", + "ĠW on", + "iff s", + "Ġflow chart", + "ĠEle mental", + "Ġì ŀ", + "Ġfoli age", + "differenti ated", + "ĠGlob ular", + "Ġpercept ron", + "candid ate", + "S ocial", + "W itt", + "d yn", + "p aces", + "Ġm Glu", + "Ġb anned", + "ol inite", + "ĠF riends", + "ĠL ibraries", + "unc es", + "ĠRe ach", + "ĠSk ills", + "Ġrecip es", + "Ġcann ula", + "ĠOrth odox", + "ĠCarb ohydrate", + "Ġarom atase", + "Åij s", + "Ġeman ating", + "e lected", + "Ġt ense", + "ĠF LC", + "ĠL ET", + "her jee", + "Ġsub band", + "oph one", + "ĠAc tual", + "ms gs", + "EM D", + "IS ON", + "ley ball", + "ĠNi u", + "Ġber ries", + "diagn ostic", + "N ER", + "Ġd Ω", + "per centage", + "ĠH erman", + "ĠG SD", + "Ġsub problem", + "over all", + "oph or", + "Ġdel ocalized", + "acc ount", + "ĠGe ographical", + "dist ances", + "Ġà µ", + "Ġneurot oxic", + "opod ia", + "ĠDic er", + "Ġðx Ãŀ", + "Ġd unes", + "Ġwh it", + "ĠIm mediate", + "ĠÌ ¸", + "Ġadhes ives", + "ĠNS s", + "Ġguess ing", + "ĠColumb us", + "ĠUr ugu", + "behavi our", + "ĠSerb ian", + "benzodiox ol", + "im plementation", + "os ensitive", + "ĠF ill", + "ph age", + "rec overy", + "ES R", + "Ġanaly sts", + "Ġdiss atisfaction", + "band ed", + "ĠDep ressive", + "ĠRT s", + "Ref s", + "mill imeter", + "ĠOls en", + "am pton", + "ĠA CA", + "ĠA vian", + "ĠF owler", + "ub ini", + "est amps", + "ĠPro test", + "Con nection", + "Ġmer chant", + "ĠEN C", + "ĠRy u", + "ĠLymph oma", + "ĠLar ry", + "Ġjaponic um", + "ĠSymbol s", + "L ib", + "V G", + "ĠT av", + "ĠAs sim", + "ĠLe ung", + "depend ency", + "larg est", + "ĠDO E", + "Ġalign s", + "ofl urane", + "ĠAdj usted", + "Ġpeculiar ities", + "decre ase", + "ĠPlac ement", + "v ig", + "z ak", + "Ġp enta", + "Ġf res", + "Ġac ros", + "Ġsol vability", + "ans ions", + "AL A", + "Ġmal function", + "ĠGiov anni", + "A OR", + "H ad", + "Ġp orn", + "und ice", + "ĠU i", + "Ġexp elled", + "ĠAn k", + "Ġdisc ounting", + "ĠReg ulating", + "aster y", + "phen ylethyl", + "Ġcast ration", + "Ġeryth romycin", + "Ġbif unctional", + "� �", + "ĠAlger ia", + "m ess", + "Ġw is", + "ĠT ay", + "ass umed", + "Ġes calation", + "Ġhydro per", + "Ġcall osum", + "Ġatom ization", + "ĠSA W", + "Ġacetyl cholinesterase", + "Ġsucceed s", + "Ġphysi otherapy", + "t ro", + "Ġm ason", + "ĠT MB", + "Ġph ant", + "Ġadjust s", + "anth a", + "ĠEisen stein", + "Ġshorth and", + "G ABA", + "Ġpro ver", + "Ġpat rol", + "ĠMod al", + "oll aries", + "ĠInter facial", + "ĠCI A", + "att n", + "ĠCrypt ococcus", + "athe cal", + "ĠFresh water", + "Ġspectro gram", + "opid ogrel", + "m orphism", + "Ġrel apsing", + "Ġgeneral izable", + "ĠSh ale", + "ĠTrans plant", + "cont raction", + "UR I", + "ĠPet rov", + "ĠSl iding", + "Ġanterior ly", + "Ġquas ilinear", + "Ġrip ples", + "Z P", + "b acterial", + "s pr", + "an imal", + "Ġre porters", + "ĠB SS", + "ĠD ia", + "ĠR SC", + "ound ing", + "IT HM", + "log ical", + "Ġpoly carbonate", + "An imal", + "umb ai", + "Ġarch ived", + "ĠDur ham", + "âĸ Ī", + "ĠVerm ont", + "Ġp w", + "ess en", + "Ġconst expr", + "ĠPr uss", + "Ġsharp ness", + "div ide", + "prim itive", + "Ġacryl ate", + "MY C", + "ĠMond ay", + "ĠSrin ivas", + "B orn", + "at tice", + "om orpha", + "ĠM ERS", + "ĠF actory", + "ĠW N", + "rec tile", + "Ġheat s", + "UN K", + "Ġsynchron ize", + "ĠAtten uation", + "Child ren", + "P at", + "p regnant", + "Ġw ished", + "Ġth awing", + "ĠB ey", + "ĠD ÃŃaz", + "Ġle ather", + "ĠUn ic", + "Ġspecial ised", + "Ġcataly tically", + "PL GA", + "hydroxy ethyl", + "Ġmag mas", + "Ġpron oun", + "Ġeut rophication", + "ĠWeek ly", + "M HD", + "m alloc", + "ec ologic", + "il o", + "ĠF requencies", + "Ġor chestra", + "Ġmetabol omic", + "ĠBlock ade", + "Ġasser ted", + "ĠLew y", + "Ġallevi ating", + "Ġoccl usions", + "Ġchor oid", + "techn ical", + "Ġenvision ed", + "ĠHous ing", + "P n", + "ĠT ECH", + "ĠS SH", + "ĠV alle", + "yl methyl", + "Ġph loem", + "ĠPro jects", + "but ton", + "Ġacceler ometers", + "umn i", + "ĠHand ling", + "Ġvas o", + "perme able", + "Ġc ords", + "ĠC f", + "ĠD z", + "Ġed itions", + "Ġhum erus", + "do ors", + "Ġdors olateral", + "Ġapt amers", + "Ġcommod ities", + "osper ms", + "Ġprednis one", + "I Q", + "M etal", + "t us", + "Ġis otopy", + "ĠThe ater", + "iff i", + "Ġy arn", + "de letion", + "ĠQ PO", + "Ġmulti objective", + "Ġur chin", + "Ġpuls ations", + "ĠSR P", + "ð tÃŀ", + "gluc oside", + "Ġdepart ures", + "Py Object", + "ĠBand width", + "ĠAccept ance", + "re ys", + "ĠI ON", + "Ġcomp uls", + "ĠJ W", + "Ġpart hen", + "Cl ose", + "ĠBa TiO", + "ñ oz", + "aggreg ate", + "Initi ally", + "q h", + "ĠC ancers", + "op in", + "ne ver", + "ism an", + "Ġconst ancy", + "Ġtr ucks", + "Ġvisual isation", + "ĠIll ness", + "Ġsulph ide", + "ĠMetabol ites", + "Ġoxys porum", + "H PP", + "Ġnor adrenaline", + "Ġcommut ativity", + "Qu ad", + "Ni O", + "ĠGet ting", + "Ġba it", + "Ġë °", + "Ġment ally", + "Ġaur oral", + "ĠDraw ing", + "S in", + "re ceiver", + "at ov", + "is otope", + "Ġis othi", + "ĠS enes", + "ĠA CO", + "ĠG CT", + "ys mal", + "ĠV og", + "Ġdist ractors", + "Ġconnected ness", + "Ġaccum bens", + "ä ck", + "hyd rated", + "Ġpharmac odynamic", + "Ġmineral ogy", + "Ġarth ropods", + "Ġmyc otoxins", + "Ġbatt les", + "ĠS ara", + "ĠE IS", + "ĠW inn", + "Ġlimb ic", + "WOR K", + "Å ½", + "Ġe aten", + "ĠT od", + "ap illary", + "ox yp", + "ĠNew ly", + "Ġcam el", + "arr ison", + "ECT OR", + "Ġhop efully", + "ĠHur witz", + "Ġib uprofen", + "ĠFIR ST", + "Ġbist able", + "Ġdismiss ed", + "g at", + "in ogen", + "ĠP ON", + "ph as", + "ĠK orn", + "Ġpoly aniline", + "ĠMic roscope", + "Ġmuc ous", + "Ġcollision less", + "hydrogen ase", + "Bu ild", + "pair ing", + "ĠWI MP", + "built in", + "ĠSepar ate", + "ĠCun ningham", + "ĠNecess ary", + "Ġb ry", + "ec rosis", + "ĠL SS", + "Ġsy philis", + "ĠV id", + "Ġcar rot", + "ĠRes istant", + "reg istration", + "Ġmy opathy", + "Ġang ry", + "MD R", + "Ġhypothesis ed", + "ĠVol terra", + "ele vation", + "Ġmyc obacteria", + "Ġcaud ate", + "i idae", + "Ġ Ç", + "ĠD ich", + "ĠR eth", + "ell us", + "ch amber", + "sh ine", + "och ore", + "ĠCol umns", + "CO UNT", + "Ġïĥ ²", + "ĠPrim ordial", + "Ġnegoti ations", + "sted t", + "R II", + "U ES", + "ti ques", + "ĠP fe", + "Ġpl ast", + "pr on", + "ĠZ w", + "ink ler", + "Ġmetabol ome", + "EG A", + "ĠSpect rophot", + "Ġubiqu ity", + "ĠElectro des", + "Ġchond ro", + "Domain Is", + "ĠResid ues", + "Ġdns DomainIs", + "D IC", + "p th", + "Ġa est", + "Ġc ient", + "Ġp essim", + "Ġre inst", + "ĠS ans", + "end azole", + "ĠU rine", + "Ġsub acute", + "ix imab", + "Ġprof itable", + "Ġmaxim ise", + "ĠDel aware", + "Ġclinic opathologic", + "Thermo Fisher", + "F AR", + "R AS", + "w itch", + "in activated", + "en esis", + "un less", + "ĠP anc", + "ĠM TS", + "ĠB ast", + "Ġch illing", + "Ġinc umbent", + "Ġj elly", + "Ġdistrib utive", + "Ġcy to", + "sc hen", + "Ġinduc ers", + "ĠNone quilibrium", + "ĠRob otics", + "ĠArgent ine", + "Ġmerid ian", + "Ġhun ger", + "Adap tive", + "Ġg or", + "ile psy", + "Ġnon vanishing", + "Ġpe ti", + "ĠMet formin", + "Ġbiom aterial", + "Ġanten nal", + "ĠAff ective", + "ĠAqu atic", + "enedi amine", + "ĠSiber ia", + "ĠPenic illium", + "F unctions", + "Ġ lec", + "Ġf eld", + "ĠS part", + "ĠC ement", + "ad di", + "se k", + "ĠN p", + "oles ky", + "ĠMac roscopic", + "è res", + "Ġcave at", + "Ġcourts hip", + "m ice", + "Ġf ence", + "Ġm ined", + "ul ink", + "ID A", + "Ġtrunc ate", + "ĠCatal an", + "Ġtran st", + "Ġamend ments", + "uncertain ty", + "Ġoroph aryngeal", + "ĠA id", + "ould er", + "ĠInc ident", + "Ġá IJ", + "angi ogenesis", + "ĠBE H", + "Ġic osa", + "ĠFOX P", + "frag ment", + "Ġscintill ator", + "J O", + "L aw", + "Ġp L", + "Ġet oposide", + "Ġpoly aden", + "Ġhabit ual", + "Ġtax i", + "Ġcum ulant", + "Ġhind rance", + "trig ger", + "r atios", + "il io", + "ĠP IR", + "ĠThe od", + "ĠM orton", + "ĠH af", + "ĠO ch", + "ĠEx o", + "Ġur tic", + "ĠCF RP", + "Sc reen", + "Sl ice", + "Ġmush rooms", + "Ġevanes cent", + "S x", + "Ë IJ", + "ì ŀ", + "Ġs igm", + "ic l", + "Ġg uests", + "ĠG IST", + "Ġdeform ities", + "poly acrylamide", + "Sign ificant", + "Ġimpression s", + "j math", + "em oral", + "ĠB n", + "ĠH DR", + "ĠK eck", + "Ġval ine", + "sp i", + "iter ate", + "Ġsyn c", + "oti ana", + "Inter val", + "ĠBra uer", + "Ġstic ky", + "ĠNeuros cience", + "Bax ter", + "Ġc asts", + "all ocation", + "ne al", + "Ġbi op", + "Ġrest orations", + "Im ages", + "mi tic", + "ĠEle vation", + "Ġabst inence", + "ĠLess er", + "ĠRain fall", + "P AM", + "W ol", + "us ch", + "Ġprom isc", + "na ïve", + "Ġded uc", + "acchar ide", + "Ġnom inally", + "ĠExpl oratory", + "Ġreconc iliation", + "linal g", + "T CR", + "Ġs ore", + "ĠN ab", + "Ġout group", + "Ġmon ophosphate", + "ins u", + "ĠAd dis", + "SP R", + "point ing", + "HE RE", + "ĠTechn ological", + "Ġcoch lea", + "Ġspheroid al", + "ĠBald win", + "F eed", + "Ġf using", + "Ġas per", + "Ġex osomal", + "ĠL inguistic", + "SC A", + "ĠEm pty", + "Ġvac ant", + "gly col", + "immun oprecipitation", + "ĠIT ER", + "Sn O", + "pattern s", + "contin ental", + "ĠAcceler ating", + "ĠAver aging", + "Ġchemoattract ant", + "h b", + "s ulph", + "ĠB x", + "Ġcom plicating", + "ĠW are", + "Ġso aking", + "Ġup regulate", + "-------- -", + "Ġsem ester", + "ĠBro d", + "Ġcasc ading", + "ĠCast ell", + "ĠẠ½", + "ĠEQU ATIONS", + "Ġparsim onious", + "Ġs orbent", + "Ġe ug", + "od in", + "ĠW ig", + "ĠTh ir", + "Ġsol v", + "Ġcar boplatin", + "Ġz ebra", + "ven ient", + "Ġmed Rxiv", + "Ġaut obi", + "Ġrepe atable", + "Ġmig rations", + "ĠÐ ´", + "hol onomic", + "Ġmoder ator", + "Ġchim era", + "ĠGrassmann ian", + "ĠR onald", + "ĠV ega", + "ast es", + "Ġqu otes", + "Ġmon ic", + "Ġprec oding", + "ĠAss isted", + "ĠNetwork ing", + "Ġfabric ating", + "Ġbot anical", + "Ġswarm s", + "Ġmartens itic", + "ellip tic", + "pher d", + "b aryon", + "x fe", + "ro ute", + "ĠF IL", + "op ies", + "ĠPC Bs", + "Ġer asure", + "ĠRem odeling", + "Ġana er", + "Sm ad", + "inj ured", + "Ġimmunocomp etent", + "d ell", + "f ailed", + "Ġs inking", + "or acic", + "Ġd red", + "ĠV DR", + "Ġconn ectors", + "Ġintr atumoral", + "Ġcommut ators", + "ĠAle ks", + "ĠDic ty", + "A k", + "Ġre calc", + "Ġis l", + "ot rim", + "nce phal", + "ĠRe es", + "Ġste atohepatitis", + "ĠPolar ized", + "SB ATCH", + "ĠCross ing", + "Acc uracy", + "ĠGi ardia", + "ĠNov o", + "Ġvig ilance", + "Ġphosphatidyl choline", + "ĠUE FA", + "J im", + "Ġf asted", + "ĠT iny", + "Ġl ang", + "iss ociation", + "Aut o", + "ĠNor folk", + "ĠArm s", + "ĠSW I", + "ĠAmb ros", + "transf ection", + "O ryza", + "h arm", + "ĠD s", + "Ġint rag", + "Ġcall er", + "Ġwr itings", + "ĠEl ast", + "ĠMar vel", + "ĠImmun odeficiency", + "ĠMill ion", + "Text ure", + "ĠIce Cube", + "sn ap", + "Ġenj oys", + "ĠChap el", + "ĠEstabl ishing", + "Act ually", + "Ġphosphoryl ates", + "Ġchin ensis", + "Ġrhabd omy", + "Ġemphys ema", + "M iddle", + "n ant", + "Ñ ħ", + "Ġt art", + "low est", + "hem ia", + "Ġutil ising", + "cons tit", + "Ġmag matism", + "о ÑĢ", + "ĠHas an", + "dispers ed", + "H ear", + "Q t", + "z ations", + "al on", + "ĠS tau", + "ĠA mer", + "os ystems", + "Ġdem arc", + "ĠNe oproterozoic", + "ĠMe k", + "ĠDis closure", + "Ġhemat ocrit", + "ĠCyt oscape", + "Ġram ification", + "Ġcommunic ative", + "Ġbutter flies", + "Ġantis era", + "Ġaestiv um", + "B ra", + "L TP", + "s ocket", + "ĠC herenkov", + "Ġch lam", + "ang ial", + "ult ured", + "eng ed", + "ĠCl inton", + "Ġmy oblasts", + "ĠComp ensation", + "ymmet rically", + "Ġemploy er", + "oz ol", + "ĠSA XS", + "Ġretin as", + "piper idine", + "XY Z", + "ĠRough ly", + "P rep", + "Ġb inge", + "Ġe rect", + "ĠO PER", + "Ġstress or", + "Ch rist", + "ĠPD Z", + "Ġsubst an", + "ĠSn ail", + "Ġlam ellae", + "ĠCycl ing", + "shif ting", + "ĠHs ieh", + "ver ify", + "Ġpre image", + "Ġar tillery", + "Ġep il", + "ĠAp ost", + "Ġhel met", + "Ġmach ined", + "ĠMin neapolis", + "ĠCr yp", + "Ġsitu ational", + "pass ing", + "quin azolin", + "ĠCro atian", + "Ġsta ircase", + "Bon net", + "N LP", + "c ium", + "Ġs keletons", + "Ġo xim", + "or ib", + "Ġre ticular", + "ĠS LS", + "ĠA romatic", + "ĠK es", + "Ġph or", + "Ġinv ocation", + "Ġdo zens", + "ai vely", + "Ġdetect ability", + "Ġconcer ted", + "yr ins", + "ĠProcess or", + "Ġtoler able", + "att ached", + "Ġanne xin", + "ĠROS AT", + "ĠAltern ate", + "ĠWa velength", + "ĠWill is", + "Ġsemic ontinuous", + "Ġadvoc acy", + "Ġoblig ation", + "chan ter", + "ĠInser tion", + "Ġsymbion t", + "Z M", + "Ġt ars", + "ro f", + "Ġre vival", + "ĠT ST", + "ĠE MP", + "Ġme x", + "ull in", + "ĠAd op", + "ĠDNA s", + "Ġemploy ers", + "MT s", + "ĠMart ÃŃn", + "electro des", + "ĠMedica id", + "Ġt gt", + "Ġl ognormal", + "ĠF rames", + "Ġper missive", + "ĠAr duino", + "Ġsem ilinear", + "ĠAss ign", + "ĠPr EP", + "ĠSi amese", + "benz imidazol", + "conn ectivity", + "ĠPE I", + "Ġbis ulfite", + "Ġacetyl transferase", + "Ġswim mer", + "ju ven", + "Ġjejun um", + "ĠCinc innati", + "ta i", + "ĠQ I", + "ĠCom mut", + "sp acing", + "Ġaff ords", + "itis ation", + "elastic ity", + "Ġdrag on", + "Ġproteas omal", + "Ġp ant", + "ĠN itro", + "Ġsp ic", + "Ġnan opl", + "ĠAll ied", + "Ġthor ax", + "ĠFT O", + "ĠJur kat", + "chiat ry", + "y oung", + "di rections", + "Ġne ocortex", + "ĠK ik", + "ang o", + "cl ay", + "iod o", + "Ġabove mentioned", + "ĠGu ardian", + "Con jecture", + "ĠTre nd", + "Ġfertil ized", + "ĠSulf ate", + "ochron ology", + "Ġcrani ofacial", + "ĠSask atchewan", + "Q Q", + "h man", + "Ġz ym", + "log s", + "Ġïģ ®", + "Ġgrad uating", + "pin ene", + "Ġî Ģ", + "Ġeti ological", + "ĠComprehens ion", + "Ġw andering", + "Ġl an", + "Ġsy st", + "return s", + "MO F", + "cho alveolar", + "ĠArm en", + "Ġbim etallic", + "ĠPoll en", + "F iles", + "Ġs sp", + "EN SI", + "ĠY us", + "Ġfin est", + "AG EN", + "Ġmicrobi omes", + "Ġpal ind", + "Ġpet als", + "ĠRadi otherapy", + "ophen one", + "spe aker", + "Ġcopep ods", + "Ġkan amycin", + "Ġdegran ulation", + "C onstruct", + "al ter", + "ĠF gf", + "ĠN BS", + "ĠIn complete", + "Ġpar cel", + "ne au", + "Ġà IJ", + "ĠCH A", + "Ġdual s", + "Ġsilic ates", + "ĠGlob ally", + "Ġkines in", + "f id", + "ĠC PD", + "ĠY ad", + "Ġdep ress", + "OD Y", + "ĠHist ograms", + "ĠSumm arization", + "aut omatic", + "ĠDom in", + "otrans formation", + "Ġventric les", + "Wid get", + "ĠPeters burg", + "Ġcholangi ocarcinoma", + "Ġnect ar", + "P IC", + "S cope", + "T ek", + "n itz", + "ĠP HD", + "Ġsp iro", + "ĠCO G", + "ĠDi oxide", + "conduc tivity", + "ĠGran ger", + "ĠWear able", + "ĠKenn eth", + "C CR", + "L INK", + "Ġ Ü", + "re tic", + "ly a", + "Ġdem ocratic", + "Ġradi ograph", + "ĠRel ax", + "ĠInc ubation", + "ĠDen oising", + "COL OR", + "ĠClos ure", + "H MM", + "ur d", + "ra da", + "ĠR v", + "ĠL uz", + "all s", + "Ġmulti spectral", + "IN ED", + "SC N", + "Ġdys lexia", + "Ġsett lers", + "ĠVL SI", + "Ġa vid", + "Ġl arynx", + "ĠC hess", + "ĠF AA", + "Ġdef ender", + "Ġlip olysis", + "ĠEl mer", + "ĠAff ymetrix", + "Ġrhod amine", + "M orph", + "S ite", + "p urity", + "Ġ Ê", + "ĠT ank", + "ĠM iao", + "Ġrec rystall", + "We yl", + "ĠGu il", + "Ġmis folded", + "su ited", + "ĠApproxim ations", + "ĠABC B", + "don or", + "GW AS", + "------------ ---", + "Ġpu tida", + "Ġimping ement", + "yam l", + "H ill", + "Ġt l", + "ag ua", + "tim ing", + "Ġreg enerate", + "Ġmulti lingual", + "rad or", + "class ifier", + "ĠJoh ansson", + "Ġsulf ides", + "ham mer", + "Ġwalk ed", + "Ġalloc ating", + "ĠGust av", + "Ġimmunoprec ipitated", + "ĠBris bane", + "Ġsandwic hed", + "ĠChatter jee", + "omand ibular", + "Ġo sc", + "Ġass ass", + "Ġmulti stage", + "Ġmulti partite", + "Ġpig mented", + "ĠVisual izing", + "Ke ys", + "pip eline", + "Ġdub bed", + "Ġc roc", + "ĠD LC", + "ĠR AT", + "ĠN ex", + "plic a", + "ting ham", + "ĠSp ider", + "Ġunc le", + "aut s", + "ĠHow e", + "Ġarth ropod", + "ĠPap ad", + "urg y", + "Ġaccl im", + "B road", + "ac er", + "ve z", + "ĠD ivers", + "Ġmod ifiable", + "Ġanti psychotics", + "Pro g", + "osa hexa", + "amb rian", + "ĠIon ization", + "Z A", + "o ate", + "Ġp ays", + "Ġe wes", + "Ġbe aches", + "Ġev il", + "ĠCD s", + "na ud", + "Ġconform ity", + "ĠDM N", + "Ġcollabor ate", + "Ġdeterior ate", + "VAL ID", + "ĠVeg as", + "Ġultrac ent", + "B RA", + "R ub", + "Y C", + "f h", + "å ľ", + "ĠO WL", + "ose ismic", + "of errin", + "och thon", + "ĠTNF R", + "small setminus", + "ĠArg ument", + "Ġgranul ocytes", + "Ġram ified", + "Ġepi phy", + "f usc", + "ec dot", + "Ġh w", + "ĠN MS", + "erc us", + "Ġtet her", + "ĠTra it", + "Ag Cl", + "ĠNear by", + "Ġhelmin th", + "Ġlae vis", + "ĠB AR", + "ĠN ancy", + "ĠG yn", + "Ġsec reting", + "St ellar", + "Ġsil hou", + "IM T", + "Ġscaffold ing", + "ĠConver ter", + "h id", + "Ġn ud", + "est rian", + "ann o", + "Ġdep iction", + "orem ost", + "ĠSh and", + "AB CD", + "ĠPD L", + "Ġdys phagia", + "Ġintr at", + "Ġhem ip", + "Ġadapt able", + "long mapsto", + "ss bauer", + "ĠMcC arthy", + "ĠAuto immune", + "ĠCut aneous", + "Inser ting", + "M aterial", + "ĠA a", + "ĠG av", + "Ġmon ocular", + "equ il", + "ĠGe off", + "Ġtet hered", + "obil ized", + "ĠShort ly", + "Det ails", + "Ġrefuge e", + "Ġabsc isic", + "FBQ yx", + "Ġdemoc racy", + "c rafted", + "d ifluor", + "y der", + "ess ment", + "Ġhist opathologic", + "Ġast rocytic", + "Ġwithd rew", + "Ġm oles", + "ath ic", + "mon o", + "man ual", + "Ġfood borne", + "ĠRep ository", + "Ġcover t", + "OT E", + "Ġtight ness", + "Ġinstanti ated", + "Ġwatermark ing", + "Ġartem isinin", + "L anguage", + "O ES", + "c ant", + "al ready", + "un ts", + "iti a", + "ĠK aren", + "Ġall uvial", + "stratig raphy", + "ĠP IV", + "ĠF aces", + "ĠB im", + "ap plications", + "ta ils", + "Ġel d", + "IR B", + "ĠIN TE", + "ĠNot Implemented", + "Ġmis classified", + "Ġfertil izers", + "ĠElectric ity", + "Ġtribut aries", + "ĠDeut sch", + "Ġslee ve", + "f uzzy", + "ĠM TL", + "ĠB res", + "ĠW yn", + "Ġk yr", + "ne uronal", + "ox ymethyl", + "dis order", + "inc hes", + "ram idal", + "Ġpoly imide", + "Res Net", + "ĠEd mund", + "Ġdegener acies", + "uther ford", + "Drop out", + "ij Ģ", + "Ġv oiced", + "ĠG omes", + "iv ities", + "con ductance", + "com pl", + "vec s", + "Ġtun a", + "ĠKin ect", + "Ġconvey ed", + "Ġsphing osine", + "b at", + "ĠP urs", + "ound ed", + "ĠSt am", + "ĠX III", + "ĠCom ics", + "MS M", + "SS L", + "Ġperf luor", + "Ġfluor inated", + "foli os", + "Ġre position", + "ĠS err", + "ĠC ors", + "ĠL abs", + "Ġco x", + "ĠAc quired", + "Ġreason ed", + "Gen ome", + "ĠPi per", + "Ġcompac tified", + "Ġherbiv ore", + "lofen ac", + "Ġb oss", + "ĠB s", + "ĠE MR", + "Ġsh oe", + "Ġcare rs", + "Ch rom", + "SV P", + "ĠTri angle", + "Ġhemat ite", + "dor f", + "ĠMove ments", + "ĠVes icles", + "Olymp us", + "M ol", + "Ġl end", + "ur as", + "ĠA SE", + "ĠW KB", + "pro ved", + "ĠK V", + "ĠU ART", + "log arithmic", + "ĠAD I", + "ĠDo ing", + "Ġce ase", + "Ġleng thening", + "Ġpyrophosph ate", + "F re", + "ĠC LD", + "ĠM LS", + "ĠPl um", + "Ġprop ionate", + "ĠGu atem", + "CK D", + "Ġis os", + "ĠM anning", + "ne uro", + "OP ER", + "ĠWil helm", + "Ġacad emia", + "ACh R", + "ĠIner tial", + "O cc", + "u jan", + "on as", + "Ġin ulin", + "ic ia", + "and al", + "ĠK ahn", + "Ġun manned", + "ĠCo arse", + "Ġgu ilty", + "ĠPe i", + "ĠLuc a", + "ĠFib roblast", + "a vian", + "v x", + "Ġd izziness", + "ĠD ox", + "ĠH our", + "Ġdec oration", + "Ġver ifier", + "rad o", + "Ġfoot prints", + "Ġdisp ensable", + "ĠAna erobic", + "Io T", + "ĠR isks", + "ĠG LS", + "Ġch ords", + "oid y", + "Ġneu rolog", + "ru h", + "Ġvirtual ization", + "Ġproton ation", + "ĠConstant in", + "Ġkeyp oints", + "B uck", + "H opf", + "M uch", + "reg ime", + "Ġprom ised", + "ai j", + "ĠDes ulf", + "ĠForm ulas", + "Ġhum p", + "ln c", + "ĠSu icide", + "ĠHO MA", + "ogly cer", + "ĠProte omics", + "Ġdict ate", + "ĠSper mat", + "F un", + "Ġs ag", + "ĠF am", + "ep pe", + "ĠJ ah", + "Ġar isen", + "oph armaceutical", + "SA GE", + "ĠTH IS", + "enh ance", + "Ġnap us", + "ro e", + "ens ch", + "de formation", + "bon es", + "ĠEr nest", + "ira bility", + "dec om", + "Ġcrust aceans", + "Ġguarantee ing", + "OV As", + "ĠMultic enter", + "Ġct DNA", + "Ġforamin ifera", + "L inn", + "Ġc ups", + "es ch", + "Ġd F", + "ĠT ah", + "pl l", + "pro jects", + "ĠU CI", + "Ġhuman ized", + "Ġabs l", + "ĠSch o", + "Ġliter als", + "ĠSV R", + "Ġtoxic ology", + "pg f", + "ĠIPT G", + "ĠMEASU REM", + "o ing", + "ĠP asc", + "ĠB au", + "ĠW annier", + "Ġhyp re", + "att ributes", + "Ġprecondition er", + "Wr iting", + "Ġgyp sum", + "y uan", + "Ġup regulates", + "Ġte lec", + "ĠDisc re", + "gu ard", + "Ġdeb ates", + "Ġparasit oid", + "L am", + "ti ge", + "Ġis opropanol", + "ĠI was", + "pl ify", + "ind olin", + "ĠAp ollo", + "Ġland ed", + "Ġbeam line", + "Un ion", + "Ġrecipro c", + "ĠRoss by", + "princ ipal", + "Ġdescend ant", + "ĠAnalog ously", + "Ġdereg ulation", + "D SM", + "c ta", + "Ġre built", + "ĠM und", + "ĠF EC", + "ry n", + "plic e", + "ĠY ugoslav", + "ĠNorth western", + "ĠHom ogen", + "ĠLI SA", + "Ġinvest or", + "H SA", + "H PO", + "Ġd ictionaries", + "ĠC ategor", + "Ġcomp acted", + "till ed", + "ç »", + "Ġf ines", + "ur ans", + "Ġbetween ness", + "ĠZ ig", + "sc hema", + "Ġcommun e", + "ĠQu inn", + "Ġana phylaxis", + "TI ES", + "Ġsnow pack", + "ĠDO A", + "ag os", + "ĠO dd", + "ard e", + "Ġev oke", + "ĠOc ular", + "Ġfa ulting", + "Ġvolcan ism", + "ĠPale ozoic", + "Ġmycel ium", + "ĠAdjust ment", + "I CT", + "N ov", + "al ias", + "ĠT ul", + "ĠH h", + "Ġev ade", + "OR s", + "Ġstreng thens", + "ĠUS GS", + "Ġlic ensing", + "ĠCle ment", + "ĠPhyt ophthora", + "r ified", + "Ġe ighteen", + "Ġto ps", + "ĠC LP", + "Ġst abilities", + "ĠP PT", + "ĠB IN", + "ĠR ak", + "Ġgen istein", + "vol ve", + "Ġquick er", + "ĠCaus ed", + "benef it", + "Y B", + "l ift", + "Ġh ood", + "ĠS Cs", + "of a", + "ĠMic ron", + "angi otensin", + "Ġfeat hers", + "Ġantifer romagnet", + "DEC REF", + "yled ons", + "Ġmyri ad", + "Ġ iz", + "ĠT rough", + "âĪ «", + "hem oglobin", + "ĠEn velope", + "ĠCl ick", + "sol iton", + "ĠSyn chrotron", + "Ġlag ged", + "MY B", + "Ġtroph oblast", + "Ġinterrog ation", + "onv uls", + "B ac", + "Ġa periodic", + "Ġg pu", + "Ġpro pidium", + "te ps", + "ĠK arp", + "ĠV az", + "ack age", + "ons on", + "In str", + "fil er", + "rifug ation", + "KO V", + "four th", + "Ġôı¼ IJ", + "hyper bolic", + "sche tz", + "Disc ussion", + "ĠOrient ed", + "j ad", + "Ġa uctions", + "us ivity", + "ĠC ran", + "Ġk d", + "Ġint est", + "ros arcoma", + "ugg er", + "ĠIL P", + "ĠST A", + "Ġrevers als", + "Ġgrap es", + "ĠPop ulus", + "ĠKit aev", + "ĠAV P", + "Pre viously", + "Ġquadr atically", + "ĠLOC AL", + "B ert", + "P ED", + "l ive", + "à ¬", + "Ġb idding", + "Ġto ss", + "ent o", + "Ġth ylak", + "Ġcomp rehend", + "Ġdi ve", + "Ġapplic ants", + "ĠÄ ħ", + "ĠVol canic", + "adap tation", + "Ġá¹ Ģ", + "ĠJans sen", + "Ġadjo ining", + "ozol omide", + "C IS", + "d C", + "duc ted", + "ĠAn ast", + "ĠEm ployment", + "ĠEnd ocrine", + "sil oxane", + "S ession", + "ĠN arr", + "ĠâĪĴ âĪĨ", + "de ev", + "oth iaz", + "ring ing", + "po inted", + "Ġacet ylene", + "Ġglob ulin", + "pack ing", + "ĠUs es", + "A ES", + "H en", + "ĠS avage", + "ĠC anc", + "ist o", + "ĠChrom osomal", + "Ġcement ed", + "Ġpyro x", + "ĠConstit utive", + "Ġphthal ate", + "mechan ism", + "Ġcyclospor ine", + "P AP", + "ar ted", + "ĠR DT", + "Ġpl ains", + "Cl one", + "prop anol", + "regular ity", + "Ġcot angent", + "ĠLes lie", + "ĠNit rate", + "ĠKaw asaki", + "ĠPage Rank", + "Ġanhyd rase", + "ĠKrish na", + "Ġhemicell ulose", + "Ġ ery", + "ll is", + "Ġmicro gram", + "ĠDel igne", + "Ġenfor ces", + "Ġthrombol ysis", + "P arse", + "or vastatin", + "Ġm ated", + "ĠC rystalline", + "Ġaut oradi", + "Ġtherm ophilic", + "inf ectious", + "Ġult ram", + "ĠML L", + "ĠFib ers", + "Ġulcer ation", + "omed ial", + "stratig raphic", + "Ġtouc hes", + "r he", + "Ġt ame", + "ĠC ulic", + "AR DS", + "ch ter", + "Ġcounter clockwise", + "Ġcam ps", + "VD C", + "Ġmeth adone", + "depend ently", + "valid ate", + "Ġprecl udes", + "Ġparliament ary", + "ĠINTE REST", + "ĠS erg", + "ĠC BC", + "ere lla", + "ay i", + "ĠR AB", + "Ġch ym", + "Ġnan ospheres", + "Ġdiab etics", + "cons ervation", + "Ġperme ate", + "plot ted", + "Ġna phthalene", + "ĠBon n", + "ĠElectro static", + "Ġinvent ories", + "Gaussian ity", + "ĠAden osine", + "Del ay", + "ĠBegin ning", + "Ġs ided", + "ĠC ushing", + "ĠH v", + "Ġco ined", + "ĠAl m", + "sc anning", + "fer til", + "Ġα v", + "ĠRe activity", + "Ġproxim ate", + "depend encies", + "Ġdens ification", + "Ġôı¼ ij", + "Ġbacteri ocin", + "weak ly", + "Ġdenti stry", + "ĠOri ental", + "Ġdorm ant", + "Ġp C", + "Ġm um", + "RE s", + "Ġcon val", + "Ġbi ota", + "Ġmulti linear", + "ĠPT FE", + "Ġnarrow band", + "ĠRot ational", + "Ġhoney bee", + "ĠChlor ophyll", + "Bas eline", + "F ern", + "Ġl k", + "ĠM ash", + "ri ved", + "ĠB ases", + "ĠD ah", + "ĠK ui", + "Ġà ĵ", + "ĠRec ycl", + "AG N", + "PD E", + "Ġclim atological", + "ĠBas ically", + "cons erved", + "abs orbing", + "ĠKos zul", + "ouss ines", + "Ġm dx", + "ith ymia", + "ĠH inton", + "Ġk h", + "Ġad mittance", + "ĠV y", + "Ġext rema", + "Ġcre ftype", + "sub st", + "Ġble omycin", + "LINE AR", + "A Q", + "i om", + "Ġn ong", + "op ian", + "se in", + "ud al", + "Ġear ning", + "Ġstandard ize", + "ĠPar ticular", + "Ġwave vector", + "dx dy", + "ĠMac Donald", + "ĠEst uary", + "valid ated", + "ĠHur st", + "ĠMuk herjee", + "Ġbival ves", + "Ġjug ular", + "U b", + "v ill", + "en ough", + "Ġin forms", + "an atomical", + "ul ou", + "res a", + "ĠP MC", + "ĠM ira", + "ĠR PL", + "ĠSD C", + "Ġhem i", + "Mo S", + "ĠFlo at", + "Ġoccl usal", + "ĠRain bow", + "ĠProvid ing", + "Ġsupercapac itor", + "os f", + "ĠI RT", + "Ġad m", + "Ġdec oders", + "ĠX R", + "ĠRes cue", + "Ġent om", + "Ġmor tal", + "An gle", + "Ind ia", + "ĠMal i", + "Ġinsp ecting", + "ĠGALAX Y", + "ĠEri ks", + "Y F", + "r ings", + "Ġs ir", + "Ġg sl", + "ĠB ubble", + "ĠD CA", + "ĠW idespread", + "ass ignment", + "Ġge omorph", + "ĠPre ference", + "CO PD", + "process ors", + "cut off", + "ĠFlow er", + "phen omen", + "mus ic", + "ĠSlov akia", + "Support ing", + "b low", + "ed it", + "ĠT rophy", + "ĠA SF", + "ĠM oses", + "Ġind els", + "Ġnon human", + "Ġhand ic", + "Ġrepair ing", + "Ġmicrom eter", + "ĠPhilip pe", + "Ġexud ates", + "ĠâĹ ĭ", + "Ġamalg am", + "K in", + "f ors", + "f ron", + "Ġan abolic", + "ĠE ich", + "NA N", + "Ġpseud ogap", + "analy zed", + "Ġtack led", + "agin ous", + "Ġlubric ant", + "Ġradion uclides", + "arrest in", + "oussines q", + "L if", + "Î ¥", + "re ceived", + "as tive", + "ĠP BC", + "Ġam oxicillin", + "cop per", + "ubl ing", + "oph ages", + "ĠSe as", + "ĠEl ite", + "PM MA", + "Ġchol ang", + "Depend ing", + "Ġas bestos", + "ĠF ecal", + "ĠR ath", + "ĠL ey", + "Ġfact ored", + "bb les", + "Ġtoken izer", + "Ġofficinal is", + "ĠNUC LE", + "ĠS emicon", + "ĠB ous", + "ĠR is", + "Ġlo ans", + "AC P", + "âĻ Ģ", + "phos ate", + "Ġc herry", + "an an", + "ar re", + "ĠC redit", + "ise xual", + "ĠAc ta", + "ĠLet ting", + "ĠInf arction", + "ĠAcc ounting", + "Ġcounter stained", + "Ġaer ogel", + "standard ized", + "Ġly ase", + "seg ments", + "Ġbac helor", + "Ġh ue", + "ĠN ETs", + "Ġun adjusted", + "Ġmicro hardness", + "Ġsingle ts", + "ĠSP ACE", + "ĠHyd raulic", + "MET HOD", + "ĠBj ör", + "ĠK U", + "Ġrep ur", + "Ġradi ocarbon", + "Ġheter ogeneities", + "Ġgast rocnemius", + "ĠLT D", + "Ġaccident ally", + "Process ing", + "Dop pler", + "T BI", + "Ġl ingual", + "ĠA GS", + "ĠF rontal", + "ĠB rack", + "the ma", + "Ġrepresent able", + "Ġpress urized", + "AD R", + "ĠMicro fluid", + "Ġê °", + "Ġreus able", + "Ġv endor", + "all er", + "Ġdi version", + "FA ST", + "ĠKir by", + "ĠStim ulus", + "Ġattach ments", + "ĠBrid ging", + "ĠRober to", + "Ġqueu ing", + "t ling", + "ro ots", + "ĠM x", + "ĠM arrow", + "ĠL ocus", + "Ġun important", + "erg arten", + "ÃŃ k", + "ĠPot ent", + "ĠBruns wick", + "ĠS CT", + "ĠM our", + "em ias", + "ĠN CS", + "ch icine", + "ĠO ryza", + "Ġwhere ver", + "ĠX GB", + "CO X", + "Ġhydrogen ated", + "Ġhyd raz", + "ĠPers ons", + "Ġframes hift", + "Ġelectroly tic", + "ĠSen egal", + "Ġphag ocyt", + "Ġinstantaneous ly", + "ĠGround water", + "Ġimper ial", + "ĠRhod e", + "ÅĦ ska", + "ovis ual", + "onts ize", + "ĠExplan ation", + "Ġempower ment", + "N TA", + "P u", + "P or", + "S ched", + "e ats", + "Ġ ys", + "in ous", + "Ġw ilt", + "ĠM ov", + "ect on", + "ĠG ins", + "int roduction", + "ince ption", + "ĠInter preting", + "Ġstart up", + "Ġalb ino", + "Ġtet ras", + "ĠHouse hold", + "ĠEL M", + "Ġspor ulation", + "Ġosm ol", + "B is", + "er ule", + "ĠE AR", + "Ġim balances", + "Ġk t", + "Ġj l", + "ges terone", + "eral a", + "ĠPo inter", + "ĠHR QoL", + "ĠRi et", + "ĠEsc ape", + "pur ified", + "Ġinstanti ation", + "m atis", + "ion a", + "Ġn oxious", + "ĠN og", + "Ġj am", + "ĠAnt oni", + "ĠGod d", + "ĠPersonal ized", + "Ġperm uted", + "ĠS HE", + "ĠO blast", + "ĠFor bes", + "ĠRes veratrol", + "ĠFe Se", + "Ġelectro deposition", + "Ġhome obox", + "Ġpy ogenes", + "Ġviol in", + "Ġiso electric", + "ĠPP G", + "prob ably", + "AMP K", + "ĠWol fe", + "Ġultraf ine", + "B eyond", + "on at", + "ed ian", + "EN ABLE", + "ĠH AM", + "so ut", + "ĠOp inion", + "rin ted", + "typ ing", + "Un known", + "Ġbuck ets", + "Ġintuition istic", + "algorithm s", + "S SC", + "b ir", + "ĠP ond", + "ad vert", + "ip in", + "Ġup wind", + "ĠCl aire", + "ĠMat uration", + "ĠPr P", + "OP O", + "FORM ANCE", + "Ġd M", + "ĠC ities", + "Ġinter related", + "ĠAp paratus", + "Ġprec ious", + "cript ors", + "Ġprepared ness", + "ĠAR CH", + "ĠPath ogens", + "HO ST", + "ĠGib bons", + "Ġirregular ity", + "ĠLip ids", + "Ġcf u", + "Ġvas odilation", + "imet re", + "impro ved", + "m q", + "ĠH ens", + "ĠL oci", + "unc redited", + "Ġmulti grid", + "tig o", + "Ġaccount ability", + "ench yme", + "Ġdisadvant aged", + "Ġbisp henol", + "Ġt ic", + "Ġfor ks", + "ĠW ester", + "ĠV ii", + "ĠJ ere", + "sim ultaneous", + "ĠGu arant", + "ĠDo yle", + "Ġpotenti ates", + "lass ified", + "Ġile al", + "Ġvasoconstr iction", + "M ODULE", + "N ano", + "W ood", + "ĠT AT", + "ur ious", + "un ya", + "Ġins tillation", + "ĠSim mons", + "ĠDi rectional", + "Ġmal ate", + "Ġplant ation", + "Ġuns olved", + "ĠTa uri", + "Ġov ine", + "Ġkeratin ocyte", + "ĠKull back", + "ĠKazakh stan", + "Ġh irs", + "ĠA erobic", + "ĠH ai", + "ĠR iley", + "ens ible", + "Ġinter planetary", + "Ġtrans its", + "Ġgener ous", + "Ġcal pain", + "Ġapp ended", + "ĠHydro dynamics", + "Ġcolon ize", + "Ġheart beat", + "Ġmetast as", + "Ġpy reth", + "ĠPA K", + "ĠÐ ¡", + "multi plet", + "ĠBrad y", + "Ġpropri a", + "ĠFron tier", + "ĠJoy ce", + "ĠP GF", + "ĠM cl", + "rec urrent", + "ĠRe placing", + "inf erence", + "ĠWh itt", + "Ġschool ing", + "ĠHa rold", + "Ġabst ractions", + "âĬ ķ", + "mem cpy", + "Ġmicron ucle", + "Ġradion uclide", + "ot yl", + "ĠM IF", + "ĠM US", + "Ġex foli", + "ĠF amilial", + "Ġcl am", + "ON O", + "Ġvan illa", + "Ġpast oris", + "ĠAT L", + "ĠBur sts", + "Qu antitative", + "Ġelic iting", + "Ġgranul omatous", + "Ġbrow sing", + "t racks", + "Ġh ij", + "ĠB CP", + "inc omp", + "az id", + "ck pt", + "Ġlink ers", + "Ġsqu id", + "Ġhead aches", + "ĠMor al", + "Ġstabil isation", + "&& &&", + "ĠSu fficient", + "ĠArch aea", + "Ġì ł", + "ĠLuc iferase", + "Cam era", + "expand ed", + "Ġmyster ious", + "H PS", + "ĠB J", + "ĠK NN", + "Ġsuper hydrophobic", + "ĠHydro thermal", + "ĠRus so", + "ĠArsen ic", + "Ġnormot ensive", + "ul timate", + "ĠC MIP", + "ex amined", + "Ġmicro porous", + "Ġfore ver", + "ĠST ING", + "IG S", + "ĉĉĉ ĠĠ", + "Pl ant", + "Ġcoherent ly", + "charg ing", + "Ġinher it", + "altern ative", + "ĠBap tist", + "F m", + "b ipy", + "Ġo ler", + "ĠSub stit", + "Ġult rap", + "free ze", + "perg ill", + "POS E", + "Ġadvertis ements", + "ECH AN", + "Bay esian", + "Ġcob ordism", + "¸ °", + "ĠA ER", + "ĠA IP", + "ĠL NA", + "ess entially", + "rec iprocal", + "ĠAn and", + "Ġsm eared", + "ones e", + "ethyl amine", + "ĠER S", + "Ġjud icial", + "Ġwood land", + "ĠGre gor", + "Ġtab ular", + "avir in", + "mir ror", + "Ġja undice", + "astig otes", + "ĠL GBT", + "ĠN aj", + "Ġsub scheme", + "Ġmulti user", + "Ġdrain s", + "Ġevac uated", + "phosphor yl", + "ĠFeld man", + "ĠTRI zol", + "ĠBLE U", + "a romatic", + "o viÄĩ", + "p ion", + "re pr", + "ro th", + "ĠF ES", + "ĠL eeds", + "Ġun g", + "ob ranch", + "Ġpat ency", + "ĠSc r", + "ĠSim plex", + "pec ies", + "Ġbenef ici", + "Ġpolymer ases", + "ĠCy gn", + "oct adec", + "Ġpunct ured", + "Ġjaponic us", + "ĠFPG As", + "f rown", + "Ġe b", + "ut iny", + "ĠP oy", + "ĠB rent", + "ĠB AM", + "ĠH ick", + "ĠN PS", + "ĠG DF", + "ĠV IRT", + "Ġinter l", + "Ġsc Fv", + "Ġte amm", + "Ġparticip atory", + "Ġexist ential", + "Ġoste omyelitis", + "Ġpneum othorax", + "std out", + "Ġsinglet ons", + "hyp othesis", + "strat ified", + "U SD", + "on asal", + "er is", + "im its", + "ĠI Cs", + "ĠE ncephal", + "iz i", + "ĠG radients", + "Ġall op", + "Ġcor p", + "con structed", + "Ġmon ument", + "sim ulator", + "ĠFerm ions", + "ĠWy oming", + "Ġprednis olone", + "L ang", + "N otes", + "e er", + "Ġf ighter", + "ent rant", + "ĠN ij", + "ĠG PD", + "ĠPro l", + "Ġreal isation", + "Ġpack ings", + "ĠDisc overing", + "ĠAng lo", + "ĠCass ini", + "exec ute", + "Ġinhab ited", + "ac ross", + "ĠC ram", + "ĠN BR", + "ant es", + "Ġdis persing", + "ach andran", + "ĠU ND", + "Ġshould ers", + "Ġcr ises", + "ustr ine", + "Ġprop ane", + "UN E", + "br ush", + "Ġeti ologies", + "Ġshot gun", + "show ing", + "ĠPhyt ochemical", + "ĠMeh ta", + "orr hea", + "ĠImag ery", + "T re", + "w c", + "Ġe luent", + "ond in", + "ĠAt titude", + "Ġfer romagnet", + "Ġcounter measures", + "Ġalk anes", + "ĠCap illary", + "lat ent", + "Ġsolub il", + "View er", + "áz quez", + "ĠPunj ab", + "a as", + "t ang", + "Ġim ports", + "ĠY ounger", + "rough ly", + "We inberg", + "ĠAt kinson", + "bf a", + "MP a", + "ste el", + "PC P", + "chlor inated", + "ĠPsych ometric", + "Ġpyro ptosis", + "Ġwat ched", + "ĠPerc utaneous", + "R BD", + "V ARI", + "at u", + "ĠW ake", + "Ġcan yon", + "ip arous", + "Ġsc all", + "com pletely", + "inter fer", + "ophy ceae", + "Ġfatal ities", + "cz ak", + "ĠPathophys iology", + "L em", + "l ach", + "t uary", + "Ġa lex", + "Ġs isters", + "Ġp um", + "ĠC atch", + "ĠE ber", + "ine x", + "ph the", + "Ġbo ar", + "ĠSo ul", + "Ġcat fish", + "Ġcloud y", + "ĠBu ilt", + "ophyl line", + "ĠRib osome", + "ĠAnomal ies", + "Y D", + "c ategorical", + "w or", + "op enta", + "ĠL IB", + "Ġr ick", + "Ġradi ations", + "Ġhyper cube", + "Ġmal treatment", + "Ġî ĦĦ", + "dispers ity", + "contin ent", + "Dig ital", + "ĠCory neb", + "Ġre vert", + "ĠT EA", + "ĠM LR", + "ĠF CM", + "ĠL amp", + "iz abilities", + "Ġcar ved", + "ĠMon oclonal", + "Ġpen is", + "ĠMor ales", + "En ter", + "ester ification", + "Ġcab bage", + "RAN TIES", + "Ġdebrid ement", + "L ead", + "c AMP", + "Ġc esium", + "ĠC ubic", + "Ġun imodular", + "ĠEx port", + "Ġanalys er", + "den otes", + "Ġrad ically", + "ĠHist ology", + "Ġmelan omas", + "Ġwors hip", + "ĠHimal ayan", + "ĠInte grable", + "benzenesulf onamide", + "Ġharb ored", + "P utting", + "ĠT ir", + "ĠU TI", + "cent ers", + "ĠPl uripot", + "Ġhar bors", + "Ġcarb am", + "ĠApp alach", + "ĠJo an", + "ĠCommission er", + "ĠGem ini", + "N ear", + "O PS", + "Q G", + "p ytorch", + "st aining", + "Ġh CG", + "Ġg avage", + "per haps", + "ĠG rib", + "ĠZ ah", + "Ġcompar ably", + "ĠBi oscience", + "SP L", + "Con nell", + "ĠAir way", + "prim ed", + "Ġsubmuc osal", + "Enh anced", + "Ġwis dom", + "V N", + "ĠM umbai", + "ri us", + "ĠR GD", + "ĠR Neasy", + "ma i", + "ĠAD L", + "Ġadop tive", + "Out lined", + "ĠWAR RANTIES", + "ĠViol ence", + "Ġcater p", + "F und", + "d θ", + "ĠP ok", + "ĠB enson", + "ĠR IG", + "ĠV s", + "Ġinst ants", + "ĠMulti drug", + "PD MS", + "CON ST", + "Ġcart ridge", + "ĠLif estyle", + "ĠCOND ITIONS", + "odys plastic", + "CONTR OL", + "L HC", + "ti re", + "ĠS tain", + "Ġy x", + "Ġj unctional", + "ob o", + "ann ah", + "ĠCP AP", + "Ġsound ness", + "ĠUl timate", + "sil icon", + "Ġparal og", + "E vents", + "G as", + "J E", + "ĠJ orge", + "Ġover production", + "Ġmax illa", + "ĠRe asons", + "we eks", + "ĠNe arest", + "Ġhead space", + "ĠAT C", + "bal ancing", + "Ġjud ging", + "ĠUnivers ality", + "Ġsinus es", + "Ġretro peritoneal", + "Det ection", + "Ġhydrolys ate", + "H och", + "w rapper", + "Ġp Ka", + "Ġl asso", + "ĠA lu", + "ĠA PR", + "ĠD ors", + "ĠD arboux", + "ĠR FS", + "ĠK har", + "ĠTh rom", + "Ġdesign ate", + "arc o", + "Ġtherm ostat", + "ĠGl acial", + "IF F", + "ĠMan ifest", + "Ġinters persed", + "haus er", + "ĠDD X", + "Ġa le", + "ti des", + "Ġl accase", + "ĠH ered", + "ĠR acial", + "ĠK ats", + "aj o", + "ĠCo ordinated", + "ĠProb ably", + "Ġtit anate", + "SL AM", + "dri ving", + "ĠEmerg ent", + "ĠDri ves", + "Ġoblig ations", + "Ġnebul ae", + "f ried", + "ith in", + "ĠP GD", + "oc clusion", + "ĠU H", + "Ġsub routine", + "oid in", + "Ġann oy", + "ĠVir asoro", + "inst ances", + "ĠDer by", + "Ġtriang ulations", + "Ġcutoff s", + "ĠOrganization al", + "ĠVen k", + "ĠEG TA", + "ĠDeut sche", + "Ġantine ut", + "ĠVulner ability", + "i ated", + "Ġa vium", + "Ġh sp", + "em ulsions", + "ad herence", + "ĠU PS", + "ma ph", + "ĠV AP", + "rel atively", + "Ġmax ill", + "oph ase", + "Th reshold", + "ĠSup p", + "eth oprim", + "Ġpenet rated", + "Ġblast ing", + "ĠAdvant ages", + "B US", + "ol son", + "rec v", + "Ġcar nitine", + "ten ing", + "Ġprov oked", + "vari ous", + "ĠCal ab", + "len eck", + "ĠPark in", + "Ġblow up", + "ĠDW I", + "synt hesized", + "Ġdisproportion ately", + "Ġcardio respiratory", + "ĠXanth omonas", + "Ġpunc ta", + "bdd c", + "ĠP ACS", + "ase g", + "Ġinc urs", + "ost a", + "ĠJ L", + "ĠWe ierstrass", + "ole ucine", + "Ġfin als", + "Ġcaus ation", + "ĠDi rective", + "ĠPor to", + "ĠFlo res", + "arbon yl", + "---------------------------------------------------------------- ------------", + "histor ic", + "K ähler", + "on na", + "Ġc el", + "ĠT BA", + "ĠO phthal", + "Ġsub threshold", + "Ġlip s", + "ĠSub strates", + "Ġpen insula", + "Ġads or", + "Ġdry ness", + "mass es", + "è me", + "stro k", + "ĠExpand ed", + "Ġg c", + "ĠG olf", + "Ġcri tique", + "ĠÍ ©", + "Ġlens ed", + "ĠKing ma", + "ĠGold man", + "ĠFac ile", + "Car l", + "Ġchond rites", + "ĠCoh omology", + "ĠSocio economic", + "ĠDominic an", + "ĠAzerbai jan", + "ĠA ne", + "ĠM idd", + "ĠN ed", + "Ġem ulate", + "ĠSh akes", + "Ġlik ed", + "Ġbuild up", + "Ġexcess ively", + "ĠÅ ¶", + "ĠAdap ted", + "Ġauthentic ated", + "Ġlocom otive", + "Ġsubm ill", + "Ġinterpre ter", + "ĠVibr ational", + "R α", + "l aden", + "p kl", + "r w", + "y et", + "en zymes", + "Ġw av", + "ĠN MT", + "ath ion", + "Ġbi otechnological", + "arc s", + "Ġact uated", + "Ġher ring", + "EC G", + "OC I", + "Ac tivated", + "Ġpara ph", + "Obs ervation", + "ĠEk man", + "ancell or", + "veli hood", + "G auss", + "H AL", + "r dev", + "t bl", + "ic its", + "ĠR oux", + "op ram", + "Ġser opositive", + "ĠPhys ically", + "ĠEd u", + "Ġdocument ing", + "ĠÐ ¾", + "ĠSmall er", + "cher y", + "Ġlanth anide", + "T oday", + "Ñ Ĩ", + "Ġo titis", + "ĠC ores", + "if olium", + "ĠZ el", + "Ġtim ings", + "co arse", + "rep air", + "ĠLD PC", + "Ġbow l", + "ĠEpid ermal", + "Ġâľ ²", + "Ġsynonym s", + "Ġ ENT", + "Ġb illiard", + "Ġe jac", + "ĠB AA", + "Ġsc ientif", + "Ġγ γ", + "Ġcaps ular", + "Ġaz ithromycin", + "Ġcred entials", + "ĠḠł", + "ĠGli oblastoma", + "Ġunco ated", + "Ġhib ern", + "ĠT os", + "ĠB aro", + "ĠK ass", + "yl and", + "ĠX M", + "Ġagg ra", + "Ġneutral ize", + "lic ted", + "Ġsound track", + "ĠKn ud", + "ensors hip", + "emp fer", + "ĠHald ane", + "ĠR ocks", + "ĠG ou", + "ĠO pi", + "ib acterium", + "ep tives", + "ust a", + "par s", + "uk awa", + "be in", + "eli us", + "aver aging", + "ĠMW CNT", + "Ġshield ed", + "Ġquatern ionic", + "Batch Norm", + "Ġd ella", + "ĠT p", + "Ġby product", + "ĠG ow", + "ĠJ O", + "Ġparameter ize", + "gl er", + "Ġfac ult", + "ĠÍ µ", + "Ġnom ination", + "Ġbath s", + "Ġinstall ations", + "ĠJust in", + "Ġchampionship s", + "t ap", + "ĠS anc", + "ĠS usp", + "Ġsub leading", + "Ġdef ended", + "Ġbut yl", + "rem ote", + "Ġcarb ides", + "ĠPredic ts", + "ĠPrior ity", + "ĠAntib iotics", + "ĠPU FAs", + "ĠMIC s", + "ĠMaxim ization", + "b are", + "ĠP CN", + "Ġinf ested", + "Ġsol enoid", + "Ġag ronomic", + "AN GE", + "Re v", + "ĠNK G", + "Ġsap onins", + "Recomm end", + "Ġshar pen", + "othio yl", + "s uspended", + "at ron", + "us age", + "il ter", + "ĠN ER", + "CR IPT", + "inf ections", + "Ġheter osexual", + "Ġmes oc", + "ĠBob by", + "alloc ate", + "ĠPay ne", + "ĠSult an", + "è ¡", + "rac les", + "rib e", + "ĠDo ub", + "ĠPA F", + "commun ication", + "Ġninet eenth", + "Ġpopl ar", + "pgf strok", + "pgfstrok ecolor", + "S LE", + "ec ia", + "Ġdet ach", + "Ġchar ity", + "Ġmon ochrom", + "Ġpres cribe", + "Ġsuper massive", + "Ġgu ards", + "Ġcycl oaddition", + "Co hen", + "phosph atidyl", + "cre ated", + "ĠElectro dynamics", + "Ġplasm ons", + "Ñģ к", + "ĠDaph nia", + "e asy", + "Ġa q", + "Ġf imb", + "Ġw rest", + "ĠT end", + "hip p", + "Ġorgan isational", + "MA E", + "OP Y", + "Ġpotenti ated", + "Ġbr ute", + "omass ie", + "aun ay", + "l uster", + "Ġo phi", + "un ge", + "ĠP om", + "Ġpl ague", + "ber ries", + "Ġinv iscid", + "ĠQ E", + "inc ident", + "xim ide", + "Ġest rogens", + "ĠTrans parent", + "vere ign", + "ĠPre ferred", + "Ġelast ase", + "C iv", + "J F", + "K u", + "c aster", + "Ġsp ends", + "Ġabst racted", + "otechn ical", + "Ġbreed ers", + "Ġsyring ae", + "Ġclot ting", + "Af rican", + "P EC", + "us ep", + "Ġst ark", + "so lete", + "of ovir", + "Ġsens ations", + "az awa", + "Ġbiom echanics", + "Ġemerg encies", + "Ġspectrom eters", + "Ġhemisp heric", + "Ġdiscrimin atory", + "ĠInsp ection", + "nd im", + "RE P", + "ĠW ess", + "Ġhyper algesia", + "IR C", + "Ġauthors hip", + "CP A", + "Ġrotation ally", + "ĠPy th", + "ĠYam aguchi", + "Field s", + "Ġenrol ment", + "ĠReth inking", + "G ate", + "ì ĺ", + "Ġc ements", + "ĠT TS", + "ĠF ink", + "ad us", + "ĠL l", + "Ġim plicate", + "ann ihilation", + "Ġfeed ers", + "ĠPD X", + "ĠFran çois", + "Sp earman", + "ĠBenchmark ing", + "F orest", + "e vidence", + "en oyl", + "ol actone", + "ce phaly", + "ĠP EA", + "ĠN SE", + "Ġno tified", + "Ġpoly electrolyte", + "ĠMal ik", + "anth ine", + "tet rad", + "Ġflag ella", + "ãĥ ¼", + "orp ion", + "Ġbuy ers", + "Ġoligodend rocyte", + "ĠNMD AR", + "ĠHarvest ing", + "Ġkar st", + "I BD", + "ĠF olk", + "Ġsub carrier", + "Ġno tices", + "ĠY ous", + "aw ak", + "Ġadvers aries", + "Lo oking", + "Ġthym ocytes", + "Ġmening ioma", + "Ġillumin ate", + "ĠSPD X", + "Ġimping ing", + "associ ative", + "Ġt iger", + "le on", + "Ġst ature", + "ĠH ood", + "ĠR utherford", + "ĠE IT", + "Ġinf antile", + "ĠQ ubit", + "Ġpack s", + "ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ", + "azol am", + "ภ²", + "ĠTun isia", + "dil ution", + "Ġsymp atric", + "Ġliquef action", + "porph yrin", + "G n", + "R ib", + "is othermal", + "ap o", + "Ġreg ressors", + "man i", + "ĠIL s", + "oxid ants", + "At om", + "lig o", + "ĠSR AM", + "alc one", + "cs r", + "Ġc autious", + "Ġhand lers", + "Ġgast ritis", + "ĠSuper vision", + "Ġevapor ative", + "R UN", + "ĠI CG", + "ĠP rague", + "ĠM LC", + "ĠM oney", + "ĠR m", + "ĠE CS", + "vel t", + "ĠV g", + "Ġbi ography", + "Ġmin istry", + "con volution", + "ogen omics", + "round ing", + "ĠPh ag", + "Ġaud iences", + "ĠHC Ws", + "Ġblast ocysts", + "Ġdiagon als", + "Ġpreca utions", + "Í ĵ", + "ec ewise", + "ĠT oxin", + "ĠH app", + "ĠâĢ ĭ", + "Ġpop ulate", + "mm ol", + "ĠPR S", + "Ġreinfor ces", + "IST IC", + "ozo ites", + "arri val", + "Ġpave ment", + "REGIST ER", + "ĠG ases", + "ĠEx hib", + "Ġfactor izations", + "Ġmy opia", + "Ġmov able", + "ĠLI MIT", + "Ġsole us", + "DO UBLE", + "ĠInput s", + "foot notes", + "BIT S", + "ĠCyp rus", + "re ports", + "ĠP AA", + "ist al", + "Ġgroup oids", + "orph in", + "ĠCo ordinates", + "bor o", + "ĠOs lo", + "when ever", + "Ġplaus ibility", + "ĠFox O", + "ĠIntr usion", + "Ġsimplic es", + "ĠFas o", + "Ġpic osecond", + "ĠAns atz", + "Import antly", + "ĠHutch inson", + "ov ani", + "ĠAs ymptotics", + "Ġapp ra", + "ĠEx ogenous", + "Ġcap tions", + "ĠAc anth", + "Ġill icit", + "ĠBl adder", + "Ġbo om", + "ĠSal inity", + "Ġmusc ul", + "eptid yl", + "Ġaval anches", + "Hel per", + "Ġbival ve", + "Ġreimburs ement", + "z zo", + "rom atosis", + "Ġpar acetamol", + "vi o", + "Ġval pro", + "cl amation", + "Ġu u", + "ĠSo C", + "ĠGi ac", + "Ġly copene", + "Fl ags", + "Ġstic king", + "Ġsquee ze", + "synt hetic", + "osahexa enoic", + "m obile", + "v ect", + "ĠB aryon", + "Ġne f", + "Ġfl atter", + "SS I", + "Ġsch w", + "ancre as", + "Bu f", + "Sol id", + "ĠRIP A", + "Squ are", + "Ġtranscend ental", + "Ġc yn", + "Ġm f", + "ĠS ew", + "ĠP IT", + "oc s", + "ĠB ash", + "Ġsur prised", + "Ġaut onomously", + "Ġlocal izing", + "Ġvis itor", + "Ġpers isting", + "Ġland fill", + "date time", + "Ġfire f", + "ĠEngine ered", + "ĠSn yder", + "ochrom es", + "fraction ated", + "G PI", + "Ġw oven", + "ĠT MR", + "Ġfor gotten", + "ĠM ult", + "ĠB ipolar", + "ĠH isp", + "op eptides", + "ap amil", + "Ġro uted", + "Ġag n", + "Ġday light", + "ĠÍ Ķ", + "BB B", + "ĠMajor ity", + "Ġconfound ed", + "ĠCarol ine", + "ĠShim ura", + "r uction", + "Ġt ympan", + "ac io", + "ĠT FE", + "ĠT utorial", + "Ġal lyl", + "ĠF rost", + "ĠR PS", + "ĠW ah", + "Ġi y", + "Ġsub problems", + "Ġair foil", + "Ġembed s", + "ĠMor ning", + "Ġminor ities", + "ĠMemb ership", + "Ġquadric eps", + "y ly", + "ĠB odies", + "ĠR AND", + "Ġr ationally", + "ĠMan ifold", + "phosph ine", + "cons idering", + "ez vous", + "ĠKnow ing", + "Ġtumorigen ic", + "Ġillumin ating", + "ĠFernand es", + "polynomial s", + "ĠBulg arian", + "ĠBhattach arya", + "ospi ra", + "A pi", + "hen ne", + "Ġmay s", + "ĠAr gin", + "inter pol", + "ĠAnd ean", + "ĠPD S", + "ĠCN P", + "Ġtransf usions", + "ĠNan om", + "Ġsynerg ism", + "Ġbent onite", + "Ġgravit ons", + "aqu ette", + "Ġfiss ure", + "t andem", + "w ash", + "ĠE yes", + "Ġdi lepton", + "Ġrec tified", + "ĠAr ist", + "isc ible", + "Ġir q", + "Ġlig aments", + "sec urity", + "Ġvascular ization", + "Na Cl", + "ĠStra ight", + "ĠLept in", + "ĠAbund ances", + "ĠKE Y", + "ĠMother s", + "ĠRenew able", + "Ġmason ry", + "ë ı", + "rac eutical", + "Ġar ity", + "ĠAl ves", + "osp ectral", + "Ġimmun od", + "Ġmar ble", + "Ġcover ings", + "ĠConst ants", + "ĠRever sal", + "Work s", + "ĠNur se", + "ĠAggreg ate", + "ac illin", + "pl ug", + "Ġj ury", + "one ogenesis", + "Ġam oeb", + "au kee", + "Ġphosphor ic", + "ĠRem oving", + "Ġwors en", + "ĠESR D", + "ĠHern andez", + "ĠEug ene", + "visc osity", + "F ID", + " ¦", + "Ġ Ý", + "ĠS tig", + "ĠS ING", + "ĠI MRT", + "ĠB q", + "ĠD ME", + "ĠH OM", + "ph ysis", + "ob es", + "Ġsuper fields", + "Ġarg c", + "Ġmal adaptive", + "ĠEd iting", + "Ġcond em", + "ube i", + "stim ulus", + "Ġabbrevi ation", + "H aus", + "ĠN eeds", + "Ġad hering", + "ĠV PA", + "of rontal", + "ĠÅ ª", + "ĠVer de", + "ĠSl av", + "ĠProp ag", + "Ġcongen ers", + "Ġtil apia", + "ĠRac hel", + "L ess", + "Ġm asc", + "ent angled", + "ĠD TI", + "ati k", + "rol ases", + "ĠY en", + "arm or", + "ĠDec isions", + "Ġη p", + "Int uitively", + "ĠPharmaceutical s", + "J u", + "ud din", + "ĠW ASP", + "nt on", + "Ġbi ot", + "ĠZ NF", + "Ġcr ush", + "ĠPar ity", + "SI ST", + "EV ENT", + "ĠSqu amous", + "Stud ent", + "Ġgingival is", + "f used", + "ĠM ises", + "ĠF DTD", + "ore ceptors", + "Ġdisc retion", + "OR TC", + "MS P", + "Ġexpos es", + "Ġchlor inated", + "ĠUp regulation", + "ĠLim b", + "Ġantic or", + "Reg ular", + "Adv anced", + "X e", + "ag han", + "ĠB LA", + "Ġco asts", + "ĠTh irteen", + "hes in", + "ĠMet hanol", + "rot us", + "ĠStep hens", + "Bo ok", + "ĠHistor ically", + "ĠEmploy ing", + "Ġcorrug ated", + "mercapto ethanol", + "ĠD nmt", + "ĠQu eries", + "DR B", + "ĠGR U", + "FL U", + "ĠCarbon iferous", + "OB JECT", + "ĠDiscrim inative", + "ĠBurg ess", + "Ġplanetes imals", + "ĠAmend ment", + "ĠStriking ly", + "t ric", + "ec ure", + "Ġtrans posable", + "rol ateral", + "Ġhis ti", + "ega ard", + "Ġsk im", + "ĠSP F", + "Stat istics", + "Ġintest ines", + "f eng", + "l ain", + "Ġthe at", + "Ġo rogen", + "Ġp ill", + "od opa", + "Ġcorrel ative", + "AC O", + "Ġadj unction", + "ĠCare y", + "Ġtele portation", + "ĠBound aries", + "ĠGood fellow", + "ĠLind a", + "ĠPolymer ic", + "Ġexer tion", + "Ġsteep ly", + "Ġprotr usion", + "Ġhyal uronic", + "ĠRoc hester", + "ENSI ONAL", + "D ar", + "f et", + "ĠF SS", + "hem ically", + "Ġfl ashes", + "Ġdevi ated", + "feld t", + "Ġstic ks", + "Ġoct et", + "Ġgravitation ally", + "footnotes ize", + "L ex", + "o vi", + "Ġw ired", + "ĠS MP", + "erm ans", + "Ġun broken", + "Ġem ulation", + "sim ulated", + "Ġminim ality", + "ardi ac", + "Ġship w", + "Gene tic", + "ĠHerm ann", + "ynchron ization", + "ĠNap ole", + "Ġmonodis perse", + "R ho", + "r ists", + "Ġf x", + "ĠF UV", + "ĠG elfand", + "hem ispheric", + "ron idazole", + "Ġsuper saturation", + "oud h", + "oli tical", + "ĠAir y", + "Ġmanifest ly", + "ĠHM G", + "Ġadvertis ement", + "ĠBrook lyn", + "Ġparalle led", + "answ ered", + "ĠNotImplemented Error", + "U PD", + "o ust", + "ĠT eng", + "Ġfor tified", + "ĠS ort", + "EN E", + "ĠF ris", + "ĠH IS", + "ĠR OT", + "ĠN ested", + "pro duce", + "ĠK erala", + "gen omic", + "ĠIs ab", + "Ġur acil", + "bur ger", + "ĠLog arithmic", + "Ġster ility", + "Ġunem ployed", + "Ġori ental", + "K o", + "j ima", + "ĠC TP", + "ĠL AD", + "Ġconform ers", + "CG G", + "Per kin", + "Ġbrid ged", + "ĠDiss ociation", + "ĠQi agen", + "Ġwealth y", + "Ġanaest hetic", + "ĠMinim izing", + "Ġacous tics", + "buck et", + "ĠSert oli", + "r ath", + "s aw", + "Ġg arn", + "ĠThe oretically", + "tic ul", + "ĠTh inking", + "ik er", + "ĠCh it", + "Ġtr in", + "AL ITY", + "ĠFe O", + "Ġpolymer ized", + "En coding", + "Ġanalges ics", + "ĠLex ical", + "Ġmari juana", + "âĸĪ âĸĪ", + "c rops", + "ent ropic", + "ol ocation", + "ĠP omp", + "Ġco factors", + "box times", + "ĠAr ri", + "An gel", + "ĠRequire ment", + "Ġmicrol ensing", + "ĠTRAN SF", + "å º", + "Ġd ma", + "Ġre rio", + "und ancy", + "ant el", + "Ġradi ometric", + "ĠSe an", + "rand n", + "ĠCR L", + "hal os", + "uber tal", + "Ġquin one", + "T ES", + "Ġd W", + "ĠC GM", + "Ġhe aled", + "ian e", + "Ġobtain able", + "ĠAd rian", + "Ġlik es", + "ĠMed ication", + "Ġcogn itively", + "Whe ther", + "B ob", + "d id", + "al cohol", + "Ġn ivolumab", + "ĠF Y", + "Ġat resia", + "ach s", + "ĠK ip", + "Ġun igenes", + "ĠJ accard", + "ust ri", + "Ġconf ine", + "Ġaut ofluorescence", + "Ġpy g", + "Se a", + "Set tings", + "Ġtrunc atula", + "Liter al", + "F ab", + "M ah", + "V en", + "Ġt ig", + "Ġc her", + "ĠC CI", + "ĠF unk", + "ĠB ess", + "ĠN asal", + "iff er", + "Ġobs essive", + "ĠOp ening", + "ochond ral", + "ĠTR PA", + "ĠRab in", + "Ġta per", + "Ġdeaf ness", + "D OS", + "is ites", + "an ite", + "le ost", + "ĠS TP", + "ĠB ACE", + "ĠH enn", + "ĠE SM", + "Ġsuper field", + "ĠOr land", + "ĠAMP s", + "ĠHem orrh", + "Ġresc ues", + "Ġtour ists", + "ĠVL BI", + "Ġneighbourhood s", + "communic able", + "g x", + "r atase", + "ĠN RT", + "Ġob structions", + "Ġdef orestation", + "Ġq p", + "ĠPh an", + "ĠST I", + "iment o", + "ĠIR I", + "SV s", + "Ġstrip ed", + "Po inc", + "ĠBed ford", + "ĠFrag ment", + "ĠRelig ion", + "Ġd rones", + "im ulation", + "ĠC et", + "Ġg ills", + "ĠN orton", + "ib atch", + "est ructive", + "ĠJ av", + "ĠÏ ½", + "Ġmic a", + "AG B", + "RA W", + "ĠMy D", + "ct l", + "Ġrevers ibly", + "Ġsuppress ors", + "ĠFA IL", + "ĠFuk ushima", + "E vidence", + "p ink", + "as array", + "ĠT ann", + "Ġl oved", + "Ġbi ologists", + "Ġend othermic", + "Ġbro ker", + "ĠPer kins", + "Ġcategor ised", + "ĠSO ME", + "hydroxy vitamin", + "rog ates", + "ĠAge ing", + "Ġtourn aments", + "ĠStrom al", + "Ġdefer red", + "ĠSRE BP", + "M AD", + "S ay", + "c gi", + "p he", + "ol ini", + "ĠD ü", + "Ġde hydro", + "ap eptide", + "Ġhe s", + "Ġdist ally", + "vers ions", + "Ġmed als", + "Ġfl aw", + "Ġdu o", + "Ġimpair ing", + "toplas ts", + "ĠHF ILL", + "Ġesc ulent", + "Class ification", + "ĠGriff ith", + "ĠWelling ton", + "Ġattor ney", + "A st", + "k A", + "Ġm ilit", + "Ġn ite", + "ĠC asp", + "ĠC hester", + "ĠM ok", + "ĠR AR", + "Ġch r", + "unc tor", + "Ġab duction", + "Ġun iv", + "ov ars", + "ou k", + "ER ICAL", + "é ri", + "orb ance", + "ĠIdentif ies", + "ament o", + "Ġparent hesis", + "ĠME Fs", + "Ġabsor bs", + "ĠArray List", + "Ġcareg iving", + "ĠFI LE", + "Ġfeld spar", + "ochthon ous", + "S ort", + "j al", + "Ġt antal", + "ar abine", + "ĠS aid", + "ĠB CE", + "ĠN GO", + "yn ure", + "dot eq", + "ĠLe yd", + "mod ality", + "ĠGe ometrical", + "Al most", + "Ġhard ened", + "no ea", + "new s", + "Ġclean up", + "ĠArm ed", + "ĠSn ake", + "multi ply", + "ĠMill ennium", + "ĠSmooth ing", + "posit ely", + "en ary", + "is se", + "ĠY uc", + "Ġgene al", + "Ġsuper s", + "Ġhand held", + "Ġemb ark", + "ĠBl a", + "hor st", + "ĠPD GFR", + "Ġcit r", + "Ġcalor ie", + "ĠBudd hist", + "M ember", + "Ġf ears", + "Ġf iscal", + "ĠA IF", + "LO AD", + "pe are", + "Ġbit umen", + "Par ticip", + "ĠIndian apolis", + "ĠAlb um", + "Ġscr utiny", + "acyl glycer", + "ĠSak ai", + "Ġthermod ynamical", + "Z B", + "Ġh pf", + "ĠL IP", + "Ġexp iration", + "til t", + "Ġfl ax", + "ĠSe lectivity", + "ĠSch ol", + "any a", + "orb ents", + "Ġincub ations", + "Ġmargin als", + "inv olved", + "Ġenthal pies", + "macroph ages", + "construct or", + "ĠRol and", + "ĠP m", + "ĠR Y", + "Ġbl obs", + "Ġann uli", + "Ġuns timulated", + "ĠPet roleum", + "Ġmerg es", + "Ġenvelop ing", + "ĠInitial ization", + "Ġshed s", + "Ġadvis able", + "ylethanol amine" + ] + } +} \ No newline at end of file diff --git a/tokenizer_config.json b/tokenizer_config.json new file mode 100644 index 0000000..28e11da --- /dev/null +++ b/tokenizer_config.json @@ -0,0 +1,5 @@ +{ + "name_or_path": "/content/tokenizer", + "special_tokens_map_file": "/content/tokenizer/special_tokens_map.json", + "tokenizer_class": "PreTrainedTokenizerFast" +}